HHsearch results for GI: 254781215 and protein with PDBid: 1sxj_E

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20
Probab=96.47  E-value=0.0061  Score=35.78  Aligned_cols=75  Identities=13%  Similarity=0.098  Sum_probs=43.4

Q ss_pred             HHCCCCCCEEEEECCHHCCCHHHHHHHHHHHCCCCCCEEEEEECCCC-CCCCHHHHHHHCCCCCCEEEEECCCCCCCCCH
Q ss_conf             12026761499971110299788988888850799813899823899-87655676530352474179840433677897
Q gi|254781215|r  185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR-RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP  263 (511)
Q Consensus       185 ~G~h~~~~~lvI~DEAsgI~d~i~e~i~~~Lt~~g~~~~~i~~~nP~-~~~g~fy~~~~~~~~~w~~~~i~~~~~p~~~~  263 (511)
                      .+..+.+ -.+|+||+..+......++...+........+++++|.. .....+.       ++-..+++     +..++
T Consensus       129 ~~~~~~~-kiiiide~d~l~~~~~~~L~~~le~~~~~~~~il~~n~~~~i~~~i~-------sR~~~i~~-----~~~~~  195 (354)
T 1sxj_E          129 DGLAHRY-KCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIK-------SQCLLIRC-----PAPSD  195 (354)
T ss_dssp             -----CC-EEEEEECTTSSCHHHHHHHHHHHHHSTTTEEEEEEESCSCSSCHHHH-------TTSEEEEC-----CCCCH
T ss_pred             CCCCCCC-EEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEHHHCCHHHHHHHHHH-------CCCEEEEC-----CCCCH
T ss_conf             6556772-59998454322246778998753331444110443022655446674-------66328980-----79799


Q ss_pred             HHHHHHHHH
Q ss_conf             789999975
Q gi|254781215|r  264 SFHEGIIAR  272 (511)
Q Consensus       264 ~~ie~~~~~  272 (511)
                      +.+.+....
T Consensus       196 ~~~~~~L~~  204 (354)
T 1sxj_E          196 SEISTILSD  204 (354)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999999