HHsearch results for GI: 254781215 and protein with PDBid: 2gxq_A

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A
Probab=97.56  E-value=0.00024  Score=44.62  Aligned_cols=72  Identities=15%  Similarity=0.094  Sum_probs=52.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCC----CCEEEEEECCHHHHHH
Q ss_conf             557845899999999999874056555421012465025765978999999999998089----9669998085899999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP----GISVICLANSETQLKT  122 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p----~~kv~vtApt~~Q~~~  122 (511)
                      +|..|-+.|++++..+-..      +      -+.+.|..|+|||.....-++-.+....    +.++++.+||..-+..
T Consensus        20 g~~~pt~iQ~~aip~il~g------~------dvi~~a~TGsGKTlay~lp~l~~~~~~~~~~~~~~alil~PtreLa~q   87 (207)
T 2gxq_A           20 GLTTPTPIQAAALPLALEG------K------DLIGQARTGTGKTLAFALPIAERLAPSQERGRKPRALVLTPTRELALQ   87 (207)
T ss_dssp             TCCSCCHHHHHHHHHHHTT------C------CEEEECCTTSCHHHHHHHHHHHHCCCCCCTTCCCSEEEECSSHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHCC------C------CEEEECCCCCCCCCEEECCHHHHHCCCCCCCCCCEEEEEECCHHHHHH
T ss_conf             9999999999999999779------9------889988899997434305077653011003689879999798999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999999
Q gi|254781215|r  123 TLWAEVSKW  131 (511)
Q Consensus       123 ilw~Ei~k~  131 (511)
                      + ..++.+.
T Consensus        88 i-~~~~~~l   95 (207)
T 2gxq_A           88 V-ASELTAV   95 (207)
T ss_dssp             H-HHHHHHH
T ss_pred             H-HHHHHHH
T ss_conf             9-9988876