HHsearch results for GI: 254781215 and protein with PDBid: 2kbe_A

>2kbe_A ATP-dependent RNA helicase DBP5; DBP5P, ATP-binding, cytoplasm, hydrolase, membrane, mRNA transport, nuclear pore complex; NMR {Saccharomyces cerevisiae}
Probab=96.48  E-value=0.021  Score=32.37  Aligned_cols=68  Identities=22%  Similarity=0.233  Sum_probs=49.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHH
Q ss_conf             557845899999999999874056555421012465025765978999999999998089-966999808589999999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP-GISVICLANSETQLKTTL  124 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p-~~kv~vtApt~~Q~~~il  124 (511)
                      +|..|-+-|+..+..+-    ++..      +-+.+.|..|+|||.....-++..+.... ...+++.+|+...+..+.
T Consensus        41 g~~~pt~iQ~~aIp~~l----~g~~------~dvli~a~TGsGKTlay~lp~l~~l~~~~~~~~~~il~~~~~~~~~~~  109 (226)
T 2kbe_A           41 KFQKPSKIQERALPLLL----HNPP------RNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTL  109 (226)
T ss_dssp             SSSCCCSHHHHHHHHSS----CCSS------CCEEEESSTTCHHHHHHHHHHHHHCCCTTCCCCEEEECSSHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHH----CCCC------CCEEEECCCCCCCCEEEECCCHHEECCCCCCCEEEEEECCHHHHHHHH
T ss_conf             99999999999999997----4998------888998668987200222340101043578840899825578745577