HHsearch results for GI: 254781215 and protein with PDBid: 2px0_A

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A*
Probab=95.62  E-value=0.078  Score=28.80  Aligned_cols=102  Identities=17%  Similarity=0.035  Sum_probs=53.0

Q ss_pred             HHHHHHHHHHHH----CHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCC-CEEEEEE
Q ss_conf             467888999870----70666528866776421455777565557845899999999999874056555421-0124650
Q gi|254781215|r    9 PETEQKLFDLMW----SDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPE-VFKGAIS   83 (511)
Q Consensus         9 ~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~-~~r~aV~   83 (511)
                      |+..+++.+.+.    +.......++-++....=....       .++.=...+.+.+.+..........+. ..-+.+.
T Consensus        39 ~~~l~~~~~~L~~~~v~~~~~~~l~~~l~~~~~~~~~~-------~~~~~~~~l~~~L~~~l~~~~~~~~~~~~~vI~lv  111 (296)
T 2px0_A           39 PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGL-------TEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLF  111 (296)
T ss_dssp             CCHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHHSSSCC-------CTTTHHHHHHHHHHTTSCCGGGSCCCCCSSEEEEE
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-------CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEE
T ss_conf             38999999999986999899999999999873035789-------99999999999999870444444346788889998


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             2576597899999999999808996699980858
Q gi|254781215|r   84 AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE  117 (511)
Q Consensus        84 sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~  117 (511)
                      ...|+|||+++|=++.+++......-.++++-|+
T Consensus       112 GptGvGKTTtiaKLAa~~~~~~~~~v~lit~Dt~  145 (296)
T 2px0_A          112 GSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTY  145 (296)
T ss_dssp             ESTTSSHHHHHHHHHHHHHHTTCCCEEEEECCCS
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999888999999999999957990699980799