HHsearch results for GI: 254781215 and protein with PDBid: 2va8_A

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-binding, nucleotide-binding; 2.30A {Sulfolobus solfataricus}
Probab=98.03  E-value=1.1e-05  Score=53.02  Aligned_cols=64  Identities=16%  Similarity=0.141  Sum_probs=44.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH
Q ss_conf             5578458999999999998740565554210124650257659789999999999980899669998085899999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT  122 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~  122 (511)
                      ++..|.+||.+++..+   ..++        ..+.|.++.|.|||.++...++-.+. ..+.++++++||..=+.+
T Consensus        27 g~~~l~p~Q~~ai~~~---l~~g--------~nvlv~aPTGsGKTl~~~l~il~~l~-~~~~k~l~i~PtraL~~q   90 (715)
T 2va8_A           27 GIKKLNPPQTEAVKKG---LLEG--------NRLLLTSPTGSGKTLIAEMGIISFLL-KNGGKAIYVTPLRALTNE   90 (715)
T ss_dssp             SCCBCCHHHHHHHHTT---TTTT--------CCEEEECCTTSCHHHHHHHHHHHHHH-HSCSEEEEECSCHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH---HHCC--------CCEEEECCCCCHHHHHHHHHHHHHHH-HCCCEEEEECCHHHHHHH
T ss_conf             9999999999999999---9689--------96999829985499999999999998-679919998188999999