HHsearch results for GI: 254781215 and protein with PDBid: 2vsf_A

>2vsf_A XPD, DNA repair helicase RAD3 related protein; NER, TFIIH, hydrolase, ATP-binding, nucleotide-binding, iron sulfur cluster; HET: DNA; 2.9A {Thermoplasma acidophilum}
Probab=94.62  E-value=0.027  Score=31.73  Aligned_cols=54  Identities=22%  Similarity=0.247  Sum_probs=35.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             24650257659789999999999980899669998085899999999999999985
Q gi|254781215|r   79 KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL  134 (511)
Q Consensus        79 r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~  134 (511)
                      .+.|-||.|+|||...-..++-+ ....+.+|++..+|..|.+.++ .|+.+....
T Consensus         6 ~~viEApTGtGKTlayL~~al~~-~~~~~~kivi~T~T~~lq~Q~~-~el~~l~~~   59 (602)
T 2vsf_A            6 GVALESPTGSGKTIMALKSALQY-SSERKLKVLYLVRTNSQEEQVI-KELRSLSST   59 (602)
T ss_dssp             EEEECCCSSSSTTHHHHHTTCSS-TTTTSCEEEEEESSHHHHHHHH-HHHHHHHTT
T ss_pred             EEEEECCCHHHHHHHHHHHHHHH-HHHCCCEEEEECCCHHHHHHHH-HHHHHHHCC
T ss_conf             59998897389999999999999-9876990999866899999999-999876404