HHsearch results for GI: 254781215 and protein with PDBid: 2zj8_A

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*
Probab=98.07  E-value=1.2e-05  Score=52.89  Aligned_cols=64  Identities=17%  Similarity=0.122  Sum_probs=43.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH
Q ss_conf             5578458999999999998740565554210124650257659789999999999980899669998085899999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT  122 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~  122 (511)
                      +|..|.+||.+++.+.   ..++        ..+-|.++.|.|||.++...++..+.. .+.++++++||..=+.+
T Consensus        20 g~~~l~~~Q~~ai~~~---~~~g--------~~~lv~aPTGsGKTlva~l~il~~l~~-~~~k~l~i~Pt~aL~~Q   83 (720)
T 2zj8_A           20 GIESFYPPQAEALKSG---ILEG--------KNALISIPTASGKTLIAEIAMVHRILT-QGGKAVYIVPLKALAEE   83 (720)
T ss_dssp             TCCBCCHHHHHHHTTT---GGGT--------CEEEEECCGGGCHHHHHHHHHHHHHHH-HCSEEEEECSSGGGHHH
T ss_pred             CCCCCCHHHHHHHHHH---HHCC--------CCEEEECCCCCHHHHHHHHHHHHHHHH-CCCCEEEECCHHHHHHH
T ss_conf             9999999999999999---9779--------979998099863999999999999996-79919998088999999