HHsearch results for GI: 254781215 and protein with PDBid: 3b9q_A

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}
Probab=91.22  E-value=0.61  Score=23.17  Aligned_cols=38  Identities=21%  Similarity=0.046  Sum_probs=28.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             246502576597899999999999808996699980858
Q gi|254781215|r   79 KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE  117 (511)
Q Consensus        79 r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~  117 (511)
                      -+.+....|+|||+.++=++.|+.. ......++++-|+
T Consensus       102 vi~~vG~~G~GKTTTiaKLA~~~~~-~~~kv~lva~Dt~  139 (302)
T 3b9q_A          102 VIMIVGVNGGGKTTSLGKLAHRLKN-EGTKVLMAAGDTF  139 (302)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHHHHH-TTCCEEEECCCCS
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH-CCCCCCEECCCCC
T ss_conf             9997579888677499999999997-6998732115657