HHsearch results for GI: 254781215 and protein with PDBid: 3cpe_A

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*
Probab=100.00  E-value=2.7e-42  Score=283.97  Aligned_cols=419  Identities=16%  Similarity=0.153  Sum_probs=290.7

Q ss_pred             CCCHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf             46746788899987070666528866776421455777565557845899999999999874056555421012465025
Q gi|254781215|r    6 PTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAG   85 (511)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sg   85 (511)
                      ++.+++.+|+      ..|++||+-|+.-++---...+.+-.|+ |.+||+++++.+.++++            ..|..|
T Consensus       126 ~~t~~~~~e~------~kc~~d~~yF~~~y~~i~~~~~g~vpf~-l~~~Q~~~l~~~~~~Rf------------~Iilk~  186 (592)
T 3cpe_A          126 QWTREMVEEW------KKCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLKIMSSKRM------------TVCNLS  186 (592)
T ss_dssp             CCCHHHHHHH------HHHHTCHHHHHHHTCBCCBTTTBSBBCC-CCHHHHHHHHHHHHCSE------------EEEEEC
T ss_pred             CCCHHHHHHH------HHHHCCHHHHHHHEEEEECCCCCEEECC-CCHHHHHHHHHHHHCCE------------EEEEEC
T ss_conf             7789999999------9874088999862189987889844276-76999999999874376------------899946


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             76597899999999999808996699980858999999999999999855000134443222222333444321112357
Q gi|254781215|r   86 RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID  165 (511)
Q Consensus        86 rG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (511)
                      ||+|||++++++++|+++++|+.+++++||+++|++.+ +..++.++..+|.........           .....+...
T Consensus       187 RQ~GKSt~~a~~~l~~al~~~~~~i~ivA~~~~~A~~i-~~~ik~~~~~lP~~l~~~~~~-----------~n~~~i~~~  254 (592)
T 3cpe_A          187 RQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEV-LDRTKQAIELLPDFLQPGIVE-----------WNKGSIELD  254 (592)
T ss_dssp             SSSCHHHHHHHHHHHHHHTSSSCEEEEEESSHHHHHHH-HHHHHHHHTTSCTTTSCCEEE-----------ECSSEEEET
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH-HHHHHHHHHHCCHHHCCCCCC-----------CCCCEEEEC
T ss_conf             98869999999999999829997599991989999999-999999999681330466434-----------664126745


Q ss_pred             CCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCH--HHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHC
Q ss_conf             8616985303575561002120267614999711102997--88988888850799813899823899876556765303
Q gi|254781215|r  166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK  243 (511)
Q Consensus       166 ~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d--~i~e~i~~~Lt~~g~~~~~i~~~nP~~~~g~fy~~~~~  243 (511)
                      +++....    +..++++.+|.   +..++++||++++++  ++|.++.++++..+.. +++.+|+|++.. .||+.+..
T Consensus       255 Ngs~i~~----~a~~~da~RG~---s~~~l~lDE~Afi~~~~e~~~~~~~~l~~g~~~-kiii~STpnG~n-~fy~~~~~  325 (592)
T 3cpe_A          255 NGSSIGA----YASSPDAVRGN---SFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRS-KIIITTTPNGLN-HFYDIWTA  325 (592)
T ss_dssp             TSCEEEE----EECCHHHHHHS---CCSEEEEETGGGCTTHHHHHHHHHHHHSSSSCC-EEEEEECCCTTS-HHHHHHHH
T ss_pred             CCCEEEE----ECCCCCCCCCC---CCCCEEEEHHHHCCHHHHHHHHHCCCCCCCCCC-EEEEECCCCCCC-CCHHHHHH
T ss_conf             8725875----04788666677---666327531320406888875302334368873-699977998876-32789988


Q ss_pred             ---CCCCCEEEEECCCCCCCC--------CHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCEEECHHHHHHHHHCC---
Q ss_conf             ---524741798404336778--------977899999751898013544431756666787375599998864076---
Q gi|254781215|r  244 ---PLDDWKRFQIDTRTVEGI--------DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---  309 (511)
Q Consensus       244 ---~~~~w~~~~i~~~~~p~~--------~~~~ie~~~~~~geds~~~r~evlgeFp~~~~~~~i~~~~ie~a~~r~---  309 (511)
                         ....|..+.+.|...|..        +..|.....+..+.....|++|++|+|..++.. +|+.+.+..+....   
T Consensus       326 a~~g~~~~~~~~~~w~~~per~~~d~~~~~~~~~w~~e~i~~~s~~~F~QEy~~eF~~s~~~-vf~~~~l~~~~~~~~~~  404 (592)
T 3cpe_A          326 AVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGT-LISGMKLAVMDFIEVTP  404 (592)
T ss_dssp             HHTTCSSCEEEEECGGGSGGGGBCTTSBBCTTHHHHHHHHTTSCHHHHHHHHSCCCTTSCSB-SSCHHHHTTCCCCCCCC
T ss_pred             HHHCCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCCCCCCCCH-HHHHHHHHHHCCCCCCC
T ss_conf             74077766741234345776335542100043799999874577555301434332345430-56778987620222203


Q ss_pred             --------CCCCCCCEEEEEEECCCC-CCCCEEEEEEC--CC--EEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             --------531899708999623334-78417999822--75--589987327789889999999999861888299800
Q gi|254781215|r  310 --------PCPDPYAPLIMGCDIAEE-GGDNTVVVLRR--GP--VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDA  376 (511)
Q Consensus       310 --------~~~~~~~~~viGvDVAr~-G~D~svi~~r~--G~--~v~~~~~~~~~d~~~~a~~i~~~~~~~~~~~i~iD~  376 (511)
                              ..+.++..+++|+|||++ |+|.+++.+-.  +.  .+......++.++..++..|..++..|+++.|+||.
T Consensus       405 ~~~~~~iye~p~~~~~YvigvDvA~G~~~DySai~Vidv~~~~~eqVa~~~~n~i~~~~~a~~I~~l~~~YN~a~V~VE~  484 (592)
T 3cpe_A          405 DDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIEL  484 (592)
T ss_dssp             CSSSEEESSCCCTTCCEEEEEECCSSBTTBCEEEEEEECSSSSEEEEEEEEESSSCTTTHHHHHHHHHHHTTSCCEEEEE
T ss_pred             CCCCEEEEECCCCCCCEEEEEECCCCCCCCCEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             47781332446766602688512445777732799941478761899998358889899999999999972884899997


Q ss_pred             CCCCHHHHHHHH-HCCCE-EEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHCCCEEEECCCCEE
Q ss_conf             687636889898-64982-798427777664025522799999999999970899-981899999857967998799849
Q gi|254781215|r  377 NNTGARTCDYLE-MLGYH-VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL-INHSGLIQNLKSLKSFIVPNTGEL  453 (511)
Q Consensus       377 ~GvG~gV~d~L~-~~g~~-v~~v~~~~~~~~~~~y~N~rae~~~~~re~l~~g~l-~~d~~l~~el~~~~~~~~~~~gki  453 (511)
                      +|+|.+|++.|. ++++. +..-.......  ..-...|..++-+|+++|+.+.+ +++..|++||.+-.   . .+|+.
T Consensus       485 N~~G~~Vi~~L~~dl~y~nl~~~~~~~~Gf--~tT~ksK~~~is~Lk~liE~~~i~i~~~~li~EL~tFv---~-~~~~~  558 (592)
T 3cpe_A          485 NSTGVSVAKSLYMDLEYEGVICDSYTDLGM--KQTKRTKAVGCSTLKDLIEKDKLIIHHRATIQEFRTFS---E-KGVSW  558 (592)
T ss_dssp             SHHHHHHHHHHHTTSCCSCEECSSSSCSSE--ECCHHHHHHHHHHHHHHHHTTSEECCCHHHHHHHTSEE---E-ETTEE
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHH---H-CCCEE
T ss_conf             984999999998874557514677677787--57845599999999999974986989888999999986---4-49751


Q ss_pred             EEEECHHHCCCCCCHHHHHHHHH
Q ss_conf             99841254899989899999997
Q gi|25