BLAST/PSIBLAST alignment of GI: 254781215 and GI: 167032754 at iteration 1
>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1] Length = 499
>gi|166859242|gb|ABY97649.1| putative phage terminase, large subunit [Pseudomonas putida GB-1] Length = 499
 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 142/465 (30%), Positives = 222/465 (47%), Gaps = 27/465 (5%)

Query: 27  SFSN----FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           SFS+    +VL+ FPWGE G  L   + PR WQ E +E +    L +      EV + A+
Sbjct: 20  SFSDDPLGYVLYAFPWGEAGGELANKTGPRKWQREVLESI-GEQLRAGAKDRGEVIREAV 78

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
           ++G GIGK+ L +W++ W + T      +  AN+E+QL+T  W EV+KW  L    HWF+
Sbjct: 79  ASGHGIGKSALVSWVIKWALDTEVDTRGVVTANTESQLRTKTWPEVAKWNRLSITAHWFK 138

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT-YGMAIINDEAS 201
           +   +L      +D  H       K++      +S+   + F G HN    + +I DEAS
Sbjct: 139 LTGTALIS----TDPDH------EKNWRIDAVPWSDTNTEAFAGLHNEGKRILLIFDEAS 188

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI 261
              D++     G LT+ +    W    NP R SG+F E F K    W+  Q+D+RTV+G 
Sbjct: 189 AIADLVWEVAEGALTDADTEIIWAAFGNPTRNSGRFRECFTKFKHRWRHRQVDSRTVDGT 248

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMG 321
           + +     IA YG DSD  R+ V G FP+      IP + + EA+ R+        L+ G
Sbjct: 249 NKTQIAKWIADYGEDSDFVRIRVRGMFPRASDLQLIPTDWVAEAMRRDGVYGLDDALVCG 308

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHL--FDWSKTDLRTTN---NKISGLVEKYRPDAIIIDA 376
            DIA  G DN V+  RRG   + +       ++ R T     K+  LV ++RPDA+ +D+
Sbjct: 309 IDIARGGMDNNVIRFRRGMDAKSIKPIKIPGSETRNTTPFIAKVCTLVVEHRPDAVFVDS 368

Query: 377 NNTGARTCDYLEML--GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSG 434
              G    D L  L  G  +  V    +A D  +  N RT +  +M + ++    I    
Sbjct: 369 TGVGGPVADQLRRLLPGVMIIDVNFASQAPDRHYA-NMRTYIWWRMREAIKLGLAIESDT 427

Query: 435 LIQNLKSLKSFIVPNTGELAIESKRVKGAK---STDYSDGLMYTF 476
            ++   +   +   ++ ++A+E K+    +   S D  D L  TF
Sbjct: 428 ELETELTSPEYDHNSSDQIALEKKKDIKKRLGISPDDGDALALTF 472