BLAST/PSIBLAST alignment of GI: 254781215 and GI: 212710820 at iteration 1
>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM 30120] Length = 493
>gi|212686517|gb|EEB46045.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM 30120] Length = 493
 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 142/462 (30%), Positives = 214/462 (46%), Gaps = 36/462 (7%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
           ++ L+ FPWGE GT LE  S PR WQ E +  +  H  N      P   + A ++G GIG
Sbjct: 24  SYALYAFPWGEAGTELENASGPRQWQAEALNEIGEHLRNPETRHQP--LQLARASGHGIG 81

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL- 148
           K+   + ++ W M T     V+  AN+E QL+T  W E++KW  L   K WF     ++ 
Sbjct: 82  KSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQRLSITKDWFTCTKTAIY 141

Query: 149 -----HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI-INDEASG 202
                H   W +D +                 +SE   + F G HN     I + DEAS 
Sbjct: 142 SNDPNHANAWRADAV----------------PWSENNTEAFAGLHNQGKRIILVFDEASN 185

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
             D++     G LT+ N    WI   NP R +G+F E F K    WK  QID+RTVEG +
Sbjct: 186 IADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKFKHRWKTKQIDSRTVEGTN 245

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIM 320
               E  I  YG+D D  +V V G FP      FIP  + + A+ R        +AP+I+
Sbjct: 246 KEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDAAMKRTVTQAEVSHAPIIL 305

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT-DLRTTNNKISGLVEKYRPDAIIID-ANN 378
           G D A  G D+ V+ LR+G   + L+  SKT D      +I+   ++Y  DA+ ID    
Sbjct: 306 GVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIADYEDQYGADAVHIDFGYG 365

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           TG ++        + +    G      ++   N+R E++  +  WL+    I+   +  +
Sbjct: 366 TGIQSVGMNWGRNWQLVSFNGASTDPQMQ---NKRGEMYNNVKSWLKIGGAIDDQEVADD 422

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           L S   + V  +G++ +E K   + +  +S +  D L  TFA
Sbjct: 423 L-STPEYKVQLSGKILLEKKEDIKKRIGRSPNKGDALALTFA 463