BLAST/PSIBLAST alignment of GI: 254781215 and GI: 315121940 at iteration 1
>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509
>gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509
 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/508 (74%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDPSFHEGII+RYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPLIMGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHAEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ NHSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPNHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508