BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781215|ref|YP_003065628.1| putative phage terminase,
large subunit [Candidatus Liberibacter asiaticus str. psy62]
         (511 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1]
 gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 511

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI
Sbjct: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM
Sbjct: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP
Sbjct: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511
           PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
Sbjct: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511


>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/508 (74%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDPSFHEGII+RYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPLIMGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHAEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ NHSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPNHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/508 (73%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDP+FHE IIARYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPNFHENIIARYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPL+MGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLVMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNVSSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHPEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ +HSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPHHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2]
 gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 516

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/512 (77%), Positives = 415/512 (81%), Gaps = 19/512 (3%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP  
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPQQ 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            I EAL R   PDPYAPLIMGCDIA EG D TVVVLRRG +IE +FDWS   +  TN KI
Sbjct: 301 YIVEALERVAIPDPYAPLIMGCDIAGEGEDKTVVVLRRGNIIERIFDWSGELIEVTNRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDY-LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           S L+ +Y PDAI+ID N  G     Y L M    V  +LGQ+R+ + E   N R EL+  
Sbjct: 361 SSLINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRSTEPEQYHNLRAELYDL 420

Query: 420 MADWLEFASLI--NHSGLIQNLKSLKSFIVPNTGELAIESKRVK----GAKSTDYSDGLM 473
           M   +     +  +   LI  LKS+KS I    G L IE KR      G +S D+ D L 
Sbjct: 421 MRSAITGGLQLPDDCPDLINELKSIKS-ISDTLGRLLIEKKRQGRSEFGVRSPDFVDALC 479

Query: 474 YTFAENPPRSDMDFGRCPSYQ------YEGVD 499
           YTFA +PPR D      P YQ      YE +D
Sbjct: 480 YTFAVDPPRKD-----NPLYQGQDISEYEALD 506


>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040864|gb|ACT57660.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 367

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 252/359 (70%), Positives = 299/359 (83%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ TN +
Sbjct: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359


>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 255

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 250/255 (98%), Positives = 254/255 (99%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
           IGKTTLNAWLVLWLMS RPG+S+ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS
Sbjct: 1   IGKTTLNAWLVLWLMSIRPGMSIICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 60

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI
Sbjct: 61  LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 120

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
           NLGILGFLTE+NANRFWIMTSNPRRLSGKFYEIFN+PLDDWKRFQIDTRTVEGIDPSFHE
Sbjct: 121 NLGILGFLTEQNANRFWIMTSNPRRLSGKFYEIFNRPLDDWKRFQIDTRTVEGIDPSFHE 180

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
           GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE
Sbjct: 181 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 240

Query: 328 GGDNTVVVLRRGPVI 342
           GGDNTVVVLRRGPVI
Sbjct: 241 GGDNTVVVLRRGPVI 255


>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861389|gb|EFL84326.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
          Length = 500

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 147/469 (31%), Positives = 213/469 (45%), Gaps = 38/469 (8%)

Query: 30  NFVLHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGI 88
            FVL  FPWG  G  L  +   P  WQ E +  +      S       V + A+S+G G+
Sbjct: 31  GFVLFAFPWG--GGALADYPDGPDVWQREILRGMGEQL--STGASAASVIREAVSSGHGV 86

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+ L AW++LW MST      +  AN+E QLK   WAE++KW  L    +WF+  + +L
Sbjct: 87  GKSALVAWIILWAMSTFSDTRGVVTANTENQLKGKTWAELAKWHRLCLCGYWFDCTATAL 146

Query: 149 ------HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT-YGMAIINDEAS 201
                 H   W  D++                 +SE   + F G HN    + +I DEAS
Sbjct: 147 ISTQAGHEKTWRVDMV----------------AWSERNTEAFAGLHNKGRRVLLIFDEAS 190

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI 261
             PD I     G LT+ +    W    NP R +G+F E F +    W   ++D+RT    
Sbjct: 191 AIPDAIWEVSEGALTDADTEIIWCCFGNPTRNTGRFRECFGRYAHRWNTRRVDSRTAAMT 250

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--APLI 319
           D +     +  YG DSD  RV V G+FP+     FI  +I+ EA  R   PD Y  AP I
Sbjct: 251 DKNQLAQWVEDYGEDSDFVRVRVRGEFPRAGDRQFISSDIVHEARGRSLKPDQYSFAPRI 310

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A  G D +V+  R+G        +   D  T    ++    ++  D I +D    
Sbjct: 311 LGVDVARSGSDQSVITRRQGLACLEQRKFRGLDTVTLAGIVAEECREWGADKIFVDGIGV 370

Query: 380 GARTCDYLEM---LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL-EFASLINHSGL 435
           GA   D L     LG+ V   +    A+  E   NRR E+   M  WL E  ++ + + L
Sbjct: 371 GAGVVDALRQVYGLGHLVVDAVAGATALQPERFLNRRAEMWTAMRKWLAEGGAVPDDAEL 430

Query: 436 IQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
            + L  L+ + V  +G+L +ESK   + +G  S D +D L  TF    P
Sbjct: 431 AEQLCGLE-YAVTVSGKLKLESKDDMKARGLTSPDCADALALTFYAPVP 478


>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291315400|gb|EFE55853.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 493

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 216/462 (46%), Gaps = 36/462 (7%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
           ++ L+ FPWGE GT LE  + PR WQ E +  +  H  N      P   + A ++G GIG
Sbjct: 24  SYALYAFPWGEAGTELENANGPRQWQAEALNEIGEHLRNPETRHQP--LQLARASGHGIG 81

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL- 148
           K+   + ++ W M T     V+  AN+E QL+T  W E++KW  L   K WF     ++ 
Sbjct: 82  KSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQRLSITKDWFTYTKTAIY 141

Query: 149 -----HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI-INDEASG 202
                H   W +D +                 +SE   + F G HN     I I DEAS 
Sbjct: 142 SNDPNHANAWRADAV----------------PWSENNTEAFAGLHNQGKRIILIFDEASN 185

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
             D++     G LT+ N    WI   NP R +G+F E F K    WK  QID+RTVEG +
Sbjct: 186 IADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKFKHRWKTKQIDSRTVEGTN 245

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIM 320
               E  I  YG+D D  +V V G FP      FIP  + + A+ R        +AP+I+
Sbjct: 246 KEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDAAMKRTVTQAEVSHAPIII 305

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT-DLRTTNNKISGLVEKYRPDAIIID-ANN 378
           G D A  G D+ V+ LR+G   + L+  SKT D      +I+   ++Y  DA+ ID    
Sbjct: 306 GVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIADFEDQYGADAVHIDFGYG 365

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           TG ++        + + +  G      +   RN+R E++  +  WL+    I+   + ++
Sbjct: 366 TGIQSVGMNWGRNWQLVQFNGASTDPQM---RNKRGEMYNNVKSWLKIGGAIDDQEVAED 422

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           L S   + V  +G++ +ESK   + +  +S    D L  TFA
Sbjct: 423 L-STPEYKVELSGKILLESKDDIKKRIGRSPGKGDALALTFA 463


>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1]
 gi|166859242|gb|ABY97649.1| putative phage terminase, large subunit [Pseudomonas putida GB-1]
          Length = 499

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 142/465 (30%), Positives = 222/465 (47%), Gaps = 27/465 (5%)

Query: 27  SFSN----FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           SFS+    +VL+ FPWGE G  L   + PR WQ E +E +    L +      EV + A+
Sbjct: 20  SFSDDPLGYVLYAFPWGEAGGELANKTGPRKWQREVLESI-GEQLRAGAKDRGEVIREAV 78

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
           ++G GIGK+ L +W++ W + T      +  AN+E+QL+T  W EV+KW  L    HWF+
Sbjct: 79  ASGHGIGKSALVSWVIKWALDTEVDTRGVVTANTESQLRTKTWPEVAKWNRLSITAHWFK 138

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT-YGMAIINDEAS 201
           +   +L      +D  H       K++      +S+   + F G HN    + +I DEAS
Sbjct: 139 LTGTALIS----TDPDH------EKNWRIDAVPWSDTNTEAFAGLHNEGKRILLIFDEAS 188

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI 261
              D++     G LT+ +    W    NP R SG+F E F K    W+  Q+D+RTV+G 
Sbjct: 189 AIADLVWEVAEGALTDADTEIIWAAFGNPTRNSGRFRECFTKFKHRWRHRQVDSRTVDGT 248

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMG 321
           + +     IA YG DSD  R+ V G FP+      IP + + EA+ R+        L+ G
Sbjct: 249 NKTQIAKWIADYGEDSDFVRIRVRGMFPRASDLQLIPTDWVAEAMRRDGVYGLDDALVCG 308

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHL--FDWSKTDLRTTN---NKISGLVEKYRPDAIIIDA 376
            DIA  G DN V+  RRG   + +       ++ R T     K+  LV ++RPDA+ +D+
Sbjct: 309 IDIARGGMDNNVIRFRRGMDAKSIKPIKIPGSETRNTTPFIAKVCTLVVEHRPDAVFVDS 368

Query: 377 NNTGARTCDYLEML--GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSG 434
              G    D L  L  G  +  V    +A D  +  N RT +  +M + ++    I    
Sbjct: 369 TGVGGPVADQLRRLLPGVMIIDVNFASQAPDRHYA-NMRTYIWWRMREAIKLGLAIESDT 427

Query: 435 LIQNLKSLKSFIVPNTGELAIESKRVKGAK---STDYSDGLMYTF 476
            ++   +   +   ++ ++A+E K+    +   S D  D L  TF
Sbjct: 428 ELETELTSPEYDHNSSDQIALEKKKDIKKRLGISPDDGDALALTF 472


>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
 gi|212686517|gb|EEB46045.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
          Length = 493

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 142/462 (30%), Positives = 214/462 (46%), Gaps = 36/462 (7%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
           ++ L+ FPWGE GT LE  S PR WQ E +  +  H  N      P   + A ++G GIG
Sbjct: 24  SYALYAFPWGEAGTELENASGPRQWQAEALNEIGEHLRNPETRHQP--LQLARASGHGIG 81

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL- 148
           K+   + ++ W M T     V+  AN+E QL+T  W E++KW  L   K WF     ++ 
Sbjct: 82  KSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQRLSITKDWFTCTKTAIY 141

Query: 149 -----HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI-INDEASG 202
                H   W +D +                 +SE   + F G HN     I + DEAS 
Sbjct: 142 SNDPNHANAWRADAV----------------PWSENNTEAFAGLHNQGKRIILVFDEASN 185

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
             D++     G LT+ N    WI   NP R +G+F E F K    WK  QID+RTVEG +
Sbjct: 186 IADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKFKHRWKTKQIDSRTVEGTN 245

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIM 320
               E  I  YG+D D  +V V G FP      FIP  + + A+ R        +AP+I+
Sbjct: 246 KEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDAAMKRTVTQAEVSHAPIIL 305

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT-DLRTTNNKISGLVEKYRPDAIIID-ANN 378
           G D A  G D+ V+ LR+G   + L+  SKT D      +I+   ++Y  DA+ ID    
Sbjct: 306 GVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIADYEDQYGADAVHIDFGYG 365

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           TG ++        + +    G      ++   N+R E++  +  WL+    I+   +  +
Sbjct: 366 TGIQSVGMNWGRNWQLVSFNGASTDPQMQ---NKRGEMYNNVKSWLKIGGAIDDQEVADD 422

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           L S   + V  +G++ +E K   + +  +S +  D L  TFA
Sbjct: 423 L-STPEYKVQLSGKILLEKKEDIKKRIGRSPNKGDALALTFA 463


>gi|290968649|ref|ZP_06560187.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781302|gb|EFD93892.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 487

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 143/463 (30%), Positives = 230/463 (49%), Gaps = 45/463 (9%)

Query: 31  FVLHFFPWGEKGTPLEGFSAPRSWQLEFM-EVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
           FV   F W  +   L+G   P++WQ++ + EV +   L++         + A ++G GIG
Sbjct: 22  FVYFAFDWDSE--ELKG-QNPQTWQIKTLKEVGEGLSLSTA-------LQHATASGHGIG 71

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL- 148
           K+ L AWL+LW +STRP    +  AN+ TQL+T  WAE+SKW  L   K +F + S ++ 
Sbjct: 72  KSALVAWLILWAISTRPDTRGVVTANTATQLETKTWAELSKWYHLFRGKKFFTLTSTAIF 131

Query: 149 -----HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASG 202
                H   W  D +  S+                +R ++F G HN    + +I DEAS 
Sbjct: 132 CRQEGHERTWRIDAIPWSV----------------DRTESFAGLHNQGNRLLLIFDEASA 175

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
             + I     G LT+++    W++  NP R +G+F++ F+K    W   +ID+RTV+  +
Sbjct: 176 IDNKIWEVAEGALTDKDTEILWLVFGNPTRSTGRFFDCFHKYKKSWITQKIDSRTVDISN 235

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP---YAPLI 319
            +  +  I  YG+DSD  +V V G+FP      FI   I+  A  R P       +AP I
Sbjct: 236 KTQLQKWIQTYGIDSDFVKVRVLGEFPDTSDTQFISTAIVRTAWERRPLRTAEYDFAPCI 295

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR-TTNNKISGLVEKYRPDAIIIDANN 378
           +G D A  GGD+TV+ LR+G   E L ++ + D       +++   +KY  DA+ ID   
Sbjct: 296 IGMDPAWTGGDSTVIFLRQGFFSEKLAEYKQNDNDGVMAARLAEFEDKYHADAVFID-KG 354

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH-SGLIQ 437
            G     +   +G   +R++        +   N+R E+   M +WL+   +I    GLI+
Sbjct: 355 YGTGIYSFGVTMGRQ-WRLVSFAEKSGAQAYANKRAEMWGNMKEWLQEGGVIPQVDGLIE 413

Query: 438 NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
            L + ++FI    GE+ +E K   + +G +S + +D L  TFA
Sbjct: 414 ELTAPQAFINAR-GEIQLEKKEDMKKRGIESPNMADALALTFA 455


>gi|323156136|gb|EFZ42295.1| terminase large subunit [Escherichia coli EPECa14]
          Length = 491

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 217/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A+++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPATRYQPLML--ALASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D+ H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDLGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        YAP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAYAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|304398406|ref|ZP_07380280.1| terminase, large subunit [Pantoea sp. aB]
 gi|304354272|gb|EFM18645.1| terminase, large subunit [Pantoea sp. aB]
          Length = 490

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 215/456 (47%), Gaps = 23/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L     PR WQ +  + + AH  N      P +   A  +G GIG
Sbjct: 24  GYALYAFPWGEEGTDLAYSKGPRQWQEDAFKQIGAHLQNPDTRHQPLMIGRA--SGHGIG 81

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + LV W M T     V+  AN+E QL+T  W E++KW  L   + WF   + +++
Sbjct: 82  KSAFISMLVKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQRLSITQDWFTCTATAIY 141

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI-INDEASGTPDVIN 208
                +D  H      +K +      +SE   + F G HN     I I DEAS   D++ 
Sbjct: 142 S----NDPSH------AKSWRADAIPWSENNTEAFAGLHNERKRIILIFDEASNIADLVW 191

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ N    W+   NP R +G+F E F K    WK  QID+R+VEG +    + 
Sbjct: 192 EVAEGALTDENTEIIWVAFGNPTRNTGRFRECFRKLRHRWKTAQIDSRSVEGTNKEQIQK 251

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIMGCDIAE 326
            +  YG DSD  +V V G FP      FIP  + + A+ R   P    +A  ++G D A 
Sbjct: 252 WVDDYGEDSDFVKVRVRGLFPSASEAQFIPTGLTDAAVGRVITPGQVAHAATVIGVDPAH 311

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI-SGLVEKYRPDAIIID-ANNTGARTC 384
           +GGD  V+ LR+G   + L ++ +T       KI +   ++YR DA+ ID    TG ++ 
Sbjct: 312 QGGDPAVIYLRQGLHTKKLGEYQRTTDDVLFAKIVASFEDEYRADAVFIDYGYGTGLKSV 371

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
                  + + +  G   + D +   N+R E++  +  WL+    ++   + + L + + 
Sbjct: 372 GDNWGRNWQLIQFGGG--STDPQMA-NKRGEMYNAVKTWLKDGGQLDSQQVAEELSAAEY 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
            +      + +E K   + +  KS + +D L  TFA
Sbjct: 429 KVRLKDSRIVLEDKTSIKERLGKSPNDADALALTFA 464


>gi|320175050|gb|EFW50163.1| terminase B protein, putative [Shigella dysenteriae CDC 74-1112]
          Length = 480

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 216/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 14  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 71

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 72  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 131

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 132 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 181

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 182 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQLQK 241

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 242 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 301

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 302 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 361

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+ +    WL    +++      +L S   
Sbjct: 362 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFISCKTWLRLGGMLDDQETADDL-SAAE 417

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 418 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 453


>gi|332344357|gb|AEE57691.1| terminase, large subunit [Escherichia coli UMNK88]
          Length = 491

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQNPATRHQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|327252187|gb|EGE63859.1| terminase large subunit [Escherichia coli STEC_7v]
          Length = 491

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPATRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|324008564|gb|EGB77783.1| hypothetical protein HMPREF9532_01752 [Escherichia coli MS 57-2]
          Length = 491

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 216/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D+ H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDLGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|300898423|ref|ZP_07116764.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300357890|gb|EFJ73760.1| conserved hypothetical protein [Escherichia coli MS 198-1]
          Length = 491

 Score =  190 bits (482), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|309702815|emb|CBJ02146.1| putative terminase, large subunit [Escherichia coli ETEC H10407]
          Length = 493

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 133/472 (28%), Positives = 225/472 (47%), Gaps = 23/472 (4%)

Query: 31  FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGK 90
           + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIGK
Sbjct: 26  YALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQNPATRHQPIML--ARASGHGIGK 83

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           +   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++ 
Sbjct: 84  SAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKEWFTCTATAMYS 143

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVINL 209
               +D  H       K +      +SE   + F G HN    + ++ DEAS   D++  
Sbjct: 144 ----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVWE 193

Query: 210 GILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGI 269
              G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    +  
Sbjct: 194 VAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKEQLQKW 253

Query: 270 IARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAEE 327
           +  YG DSD  +V V G FP    + FIP  + + A+ R   P    +A +++G D + +
Sbjct: 254 VDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPAVGRVITPAQVQHAAVVLGVDPSHQ 313

Query: 328 GGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTCD 385
           G D  V+ LR+G   + L +W + TD       I+   ++Y+ DA+ ID    TG ++  
Sbjct: 314 GKDPAVIYLRQGLHCKKLGEWQRTTDDVLFAKVIADFEDQYQADAVFIDYGYGTGLKSVG 373

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSF 445
             +  G +   ++      D E   N+R E++    D L+  + ++   L   L + +  
Sbjct: 374 --DNWGRNWTLIMFGSGTADPEMG-NKRGEMYKSARDALKLGAQLDSQELADELSAPEYK 430

Query: 446 I-VPNTGELAIESKRVKG--AKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
           + + ++ ++  +   VK    +S + +D  + T+A    +   ++G+  S Q
Sbjct: 431 VRLKDSRKILQDKDEVKELLGRSPNNADAYVLTYAAPVTKKQFNYGQQQSQQ 482


>gi|298381721|ref|ZP_06991320.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|301019339|ref|ZP_07183525.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|298279163|gb|EFI20677.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|299882256|gb|EFI90467.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|323948690|gb|EGB44595.1| hypothetical protein ERKG_04913 [Escherichia coli H252]
          Length = 491

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|218700994|ref|YP_002408623.1| putative phage terminase, large subunit [Escherichia coli IAI39]
 gi|218370980|emb|CAR18807.1| putative phage terminase, large subunit [Escherichia coli IAI39]
          Length = 491

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|294491573|gb|ADE90329.1| putative phage terminase, large subunit [Escherichia coli IHE3034]
          Length = 491

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-STAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|301046412|ref|ZP_07193572.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300301638|gb|EFJ58023.1| conserved hypothetical protein [Escherichia coli MS 185-1]
          Length = 491

 Score =  189 bits (480), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 214/456 (46%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEDGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|330007152|ref|ZP_08305894.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
 gi|328535499|gb|EGF61959.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
          Length = 495

 Score =  189 bits (480), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 212/456 (46%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE GT L   S PR WQ +    +  H  N      P +   A  +G GIG
Sbjct: 29  GYALYAFPWGEDGTELAHASGPRQWQADAFREIGEHLQNPATRHQPLMISRA--SGHGIG 86

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 87  KSAFISMLINWAMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKEWFTCTATAMY 146

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 147 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIVVVFDEASNIADLVW 196

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 197 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQLQK 256

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  +V V G FP      FIP  + +EA+ R        +AP I+G D A 
Sbjct: 257 WVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPRIIGVDPAY 316

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 317 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 376

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL+    ++      +L S   
Sbjct: 377 G--DGWGRTWQLVPFGGASADPQML-NKRGEMFNACKTWLKLGGALDDQETADDL-SAAE 432

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ +E K   + +  +S    D L+ TFA
Sbjct: 433 YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLLTFA 468


>gi|215487825|ref|YP_002330256.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265897|emb|CAS10306.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 493

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 133/472 (28%), Positives = 224/472 (47%), Gaps = 23/472 (4%)

Query: 31  FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGK 90
           + L+ FPWGE GT L   + PR WQ +    +  H  N      P +   A ++G GIGK
Sbjct: 26  YALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNPATRHQPLML--ARASGHGIGK 83

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           +   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++ 
Sbjct: 84  SAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKEWFTCTATAMYS 143

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVINL 209
               +D  H       K +      +SE   + F G HN    + ++ DEAS   D++  
Sbjct: 144 ----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVWE 193

Query: 210 GILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGI 269
              G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    +  
Sbjct: 194 VAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQLQKW 253

Query: 270 IARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAEE 327
           +  YG DSD  +V V G FP    + FIP  + + A+ R   P    +A +++G D + +
Sbjct: 254 VDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPAVGRVITPAQVQHAAVVLGVDPSHQ 313

Query: 328 GGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK-ISGLVEKYRPDAIIID-ANNTGARTCD 385
           G D  V+ LR+G   + L +W +T       K I+   ++Y+ DA+ ID    TG ++  
Sbjct: 314 GKDPAVIYLRQGLHCKKLGEWQRTTDDVLFAKIIADFEDQYQADAVFIDYGYGTGLKSVG 373

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSF 445
             +  G +   +       D E   N+R E++    D L+  + ++   L   L + +  
Sbjct: 374 --DNWGRNWTLIQFGSGTADPEMG-NKRGEMYKSARDALKLGAQLDSQNLADELSAPEYK 430

Query: 446 I-VPNTGELAIESKRVKG--AKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
           + + ++ ++  + + VK    +S + +D  + T+A    +   ++G+  S Q
Sbjct: 431 VRLKDSRKILQDKEEVKELLGRSPNDADAYVLTYAAPVTKKQFNYGQQQSQQ 482


>gi|331648179|ref|ZP_08349269.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331043039|gb|EGI15179.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 491

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNACKIWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|117624715|ref|YP_853628.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
 gi|115513839|gb|ABJ01914.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
          Length = 491

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 215/456 (47%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  ++ V G FP      FIP  + +EA+ R        ++P+I+G D A 
Sbjct: 253 WVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHSPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|30387381|ref|NP_848210.1| terminase large subunit [Enterobacteria phage epsilon15]
 gi|30266036|gb|AAO06065.1| terminase large subunit [Salmonella phage epsilon15]
          Length = 491

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 214/456 (46%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNPATRHQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKEWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG +SD  +V V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEESDFVKVRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
                  + +    G   + D +   N+R E+      WL+    ++      +L S   
Sbjct: 373 GDGWGRTWQLIPFGGG--STDPQML-NKRGEMFNSCKTWLKLGGALDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|89152423|ref|YP_512256.1| putative terminase large subunit [Escherichia phage phiV10]
 gi|74055446|gb|AAZ95895.1| putative terminase large subunit [Escherichia phage phiV10]
          Length = 491

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 214/456 (46%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKTAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG  SD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D A 
Sbjct: 253 WVDDYGEGSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL    +++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTWLRLGGMLDDQETADDL-STAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ IE K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|262043569|ref|ZP_06016682.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039103|gb|EEW40261.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 491

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 212/456 (46%), Gaps = 24/456 (5%)

Query: 30  NFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
            + L+ FPWGE GT L   + PR WQ +    +  H  N      P +   A ++G GIG
Sbjct: 25  GYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNPATRHQPLML--ARASGHGIG 82

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + +++
Sbjct: 83  KSAFISMLINWAMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKEWFTCTATAMY 142

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVIN 208
                +D  H       K +      +SE   + F G HN    + ++ DEAS   D++ 
Sbjct: 143 S----NDPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRIVVVFDEASNIADLVW 192

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
               G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +    + 
Sbjct: 193 EVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQLQK 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAE 326
            +  YG DSD  +V V G FP      FIP  + +EA+ R        +AP I+G D A 
Sbjct: 253 WVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLTDEAMKRVVTAVQVAHAPRIIGVDPAY 312

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTC 384
            G D+ V+ LR+G   + L+  +K TD      +I+   ++Y  DA+ ID    TG ++ 
Sbjct: 313 SGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYLADAVFIDFGYGTGLKSI 372

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
              +  G     V     + D +   N+R E+      WL+    ++      +L S   
Sbjct: 373 G--DGWGRTWQLVPFGGASADPQML-NKRGEMFNACKTWLKLGGALDDQETADDL-SAAE 428

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           + V   G++ +E K   + +  +S    D L+ TFA
Sbjct: 429 YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLLTFA 464


>gi|227355862|ref|ZP_03840255.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
 gi|227164181|gb|EEI49078.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
          Length = 494

 Score =  183 bits (464), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 223/501 (44%), Gaps = 39/501 (7%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MS  L  +PE EQ + D+       L ++ +    FPWGE G  LE ++ PR WQ E + 
Sbjct: 1   MSEALQKSPE-EQLIEDIASFTHDPLGYAYYA---FPWGEAGGELEEYNGPRQWQAEALN 56

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            +  H  N      P +   A ++G GIGK+   + ++ W M T     V+  AN+E QL
Sbjct: 57  EIGEHLRNPKTRHQPLLL--ARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQL 114

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSL------HPAPWYSDVLHCSLGIDSKHYSTMCR 174
           +T  W E++KW  L    +WF     ++      H   W +D +                
Sbjct: 115 RTKTWPEIAKWQRLSLTNNWFTCTKTAIYSNDPNHANAWRADAV---------------- 158

Query: 175 TYSEERPDTFVGHHNTYGMAI-INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
            +SE   + F G HN     I + DEAS   D++     G LT+      WI   NP R 
Sbjct: 159 PWSENNTEAFAGLHNKGKRIILVFDEASNIADLVWEVAEGALTDEGTEIIWIAFGNPTRN 218

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +G+F E F K    W   QID+RTVEG +    +     YG DSD  +V V G FP    
Sbjct: 219 TGRFRECFRKFKHRWNTKQIDSRTVEGSNKEQIKNWEEDYGEDSDFFKVRVRGVFPSASE 278

Query: 294 DSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLF-DWSK 350
             FIP  + +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +  
Sbjct: 279 LQFIPTGLTDEAMKRIVTQAEVAHAPVIIGVDPAYSGIDDAVIYLRQGLFSKCLWTGFKT 338

Query: 351 TDLRTTNNKISGLVEKYRPDAIIID-ANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
           TD      +I+   ++Y+ DA+ ID    TG  +   +      V+R++    A      
Sbjct: 339 TDDVVMAKRIADFEDQYKADAVHIDFGYGTGIHS---IGTSWGRVWRLVKFGGASTDPQM 395

Query: 410 RNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
            N+R E++  +  WL+    I+      +L   +  +     ++ +E K   + +  +S 
Sbjct: 396 LNKRGEMYNSVKTWLKIGGAIDDQETADDLSCGEYKVRVIDSKIVLEDKTEIKKRLGRSP 455

Query: 467 DYSDGLMYTFAENPPRSDMDF 487
              D L  TFA    + D ++
Sbjct: 456 GKGDALALTFAYPVTKIDRNY 476


>gi|282848875|ref|ZP_06258265.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282581380|gb|EFB86773.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 483

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 140/475 (29%), Positives = 217/475 (45%), Gaps = 62/475 (13%)

Query: 31  FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGK 90
           FV   +PWGE GTPLE    P  WQ++ ++ +        +       + A+++G GIGK
Sbjct: 21  FVYFAYPWGEPGTPLENMEGPDEWQIQILKDIGEQLKKGKDLQT--AIQEAVASGHGIGK 78

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           + L +WL+ + +ST      +  AN+E QL+T  W E+SKW ++   K  F   + ++  
Sbjct: 79  SALISWLIHFAISTHENTRGVVTANTEGQLRTKTWPELSKWHNMFIAKDLFTYTATAIFS 138

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRT----YSEERPDTFVGHHNTYG-MAIINDEASGTPD 205
           +               K Y    R     +S+  P++F G HN    + ++ DEAS   D
Sbjct: 139 S--------------DKDYEKTWRIDAIPWSKNSPESFAGLHNQGNRILVLFDEASAIDD 184

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF 265
           VI     G LT+ N    W    NP R SG+F E F K    W  +QID+RTV+  + + 
Sbjct: 185 VIWEVTEGALTDANTEIIWCAFGNPTRNSGRFRECFRKYRKFWNTYQIDSRTVKISNKTK 244

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCD 323
            E  +  YG DSD  +V V G FP      FI   I ++A  +  +P    + P+I+G D
Sbjct: 245 IEEWLEAYGEDSDFFKVRVRGVFPSASDLQFISTEIADKAQKQVYKPGQFEHLPVIIGVD 304

Query: 324 IAEEGGDNTVVVLRRGPVIEHLF-------DWSKTDLRTTNNKISGLVEKYRPDAIIIDA 376
            A  G D+  +V+R+G  ++ L        DW    L      I+   ++Y+ DA+ ID 
Sbjct: 305 PAWTGSDSLEIVMRQGYYMKSLASIPKNDDDWRMAQL------IAQFEDEYKADAVFIDM 358

Query: 377 N-NTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCR--------NRRTELHVKMADWLEFA 427
              TG           Y + + LG+K  + +EF          N R  +  +M +WL   
Sbjct: 359 GYGTGI----------YSIGKQLGRKWRL-IEFGGKSNDPVYLNMRAYMWGQMKEWLREG 407

Query: 428 SLI--NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
             I  N   L  ++   ++ I  N G + +ESK   + +G  S +  D L  TFA
Sbjct: 408 GSIPPNDQALYDDIVGPEAIIDKN-GRIQLESKKDMKDRGLPSPNKGDALALTFA 461


>gi|54302246|ref|YP_132239.1| terminase large subunit [Photobacterium profundum SS9]
 gi|46915667|emb|CAG22439.1| hypothetical protein PBPRB0566 [Photobacterium profundum SS9]
          Length = 513

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 125/446 (28%), Positives = 202/446 (45%), Gaps = 27/446 (6%)

Query: 37  PWGEKGTPLEGFSAPRSWQLE----FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT 92
           PW  K   + G   P +W  E      EV+  +  N V+    + F  +IS+G GIGK+ 
Sbjct: 48  PWASKYDSVYG---PDAWFCEMCDQLQEVIRKNDFNGVDPV--DAFLYSISSGHGIGKSC 102

Query: 93  LNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP 152
            ++WL+ ++MSTRP    +  +N+  QL+T  W E+ KW   L NKHWF   +   +   
Sbjct: 103 ASSWLIHFVMSTRPNSKGVVTSNTSEQLRTKTWGELGKWTKKLINKHWFVYNNGKGNMNF 162

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA-IINDEASGTPDVINLGI 211
           ++ D         ++ +    +T  EE  ++F G H        + DEAS  PD I    
Sbjct: 163 YHKDY--------AETWRVDAQTCREENSESFAGLHCASSTPWYLFDEASAVPDKIWEVA 214

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA 271
            G LT+     FW +  NP R SG+F E + +    W R QID+ TV+  +        +
Sbjct: 215 EGGLTD--GEPFWFVFGNPTRNSGRFRECWRRFRQRWNRKQIDSSTVQVTNKKKISEWES 272

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDN 331
            YG DSD  RV V G FP    +  I   ++E A++R     P +P +M  D+A  GGDN
Sbjct: 273 DYGEDSDFYRVRVKGVFPSASSNQKISGALLEAAMSRTAHVIPGSPRVMSLDVARGGGDN 332

Query: 332 TVVVLRRG--PVIEHLFDWSKTDLRTTNNKISGLVE---KYRPDAIIIDANNTGARTCDY 386
            V   R G    +        ++ R +    +  V+   +++PDA  ID    G    D 
Sbjct: 333 CVFRFRHGLNGGVRKKVTLPGSEYRDSMKLAAMAVQLCSEFKPDAFFIDETGVGGPVGDR 392

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH-SGLIQNLKSLKSF 445
           +  LG++   +    +A D  +  N R  ++ +  +WL+    +++  GL+  + +++  
Sbjct: 393 IRQLGFNCIGINFASKAPDPHYA-NMRAYMYHQWGEWLKAGGSLHYDEGLLTEVGAIEYT 451

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDG 471
                 E+ I    +K A      DG
Sbjct: 452 HDRKDREILIPKDVIKKAIGISTDDG 477


>gi|332981151|ref|YP_004462592.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
 gi|332698829|gb|AEE95770.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
          Length = 461

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 140/452 (30%), Positives = 206/452 (45%), Gaps = 58/452 (12%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
           + P  WQ E ++ +           NP V   A+ +G G+GKT L AW +LW + TRP  
Sbjct: 25  AEPDDWQAETLQAL---------ADNPRV---AVRSGHGVGKTALEAWALLWFLFTRPYP 72

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSL----HPAPWYSDVLHCSLG 163
            + C A +  QL   LWAE SKWL   P  K +FE Q   +    +P  W++        
Sbjct: 73  KIPCTAPTREQLHDILWAEASKWLERAPALKPYFEWQKTRIVQKQYPGRWFA-------- 124

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                     RT +  +P+   G H  + + II DEASG  D I   I G LT  +A   
Sbjct: 125 --------TARTSN--KPENMAGFHEEHLLFII-DEASGIADNIFETIEGALTTSDAK-- 171

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            +M  NP + SG F++ F K    +   ++     + +   + E +  +Y  DSDV RV 
Sbjct: 172 LLMCGNPTKNSGVFHDAFFKDRSLYWTRKVSCLDSQRVTLEYAERLKRKYHEDSDVYRVR 231

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           V G+FP+ + D+FI L+I+E A  R+  PD    L +G D+A  G D TV+  R G  + 
Sbjct: 232 VLGEFPKAEPDTFISLDIVEAATMRDVEPD--GVLEIGVDVARFGDDETVLAARAGLKLV 289

Query: 344 HLFDWSKTDLRTTNNKISGLVEKY-----RPDAII-IDANNTGARTCDYL------EMLG 391
           +L  ++K D  TT      L +       +P   I ID +  G    D        E L 
Sbjct: 290 YLKAYTKQDTMTTAGYAIALAKDLMKECGKPKCTIKIDDDGVGGGVTDRCREVVREEKLY 349

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASLINHSGLIQNLKSLKSFIVPN 449
             V          D E   N  TE    + D L  E A LIN   LI  L + K + + +
Sbjct: 350 IDVIDCHNGGAPEDKEHYENWGTEAWAYLRDLLQDEQAELINDEDLIGQLTTRK-YRITS 408

Query: 450 TGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            G++A+ESK   + +G  S D +D ++  +A+
Sbjct: 409 KGKIALESKDEMKRRGLMSPDRADAVVLAYAK 440


>gi|228968731|ref|ZP_04129698.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228790961|gb|EEM38595.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 459

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 137/492 (27%), Positives = 223/492 (45%), Gaps = 77/492 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +  +F+  +L F+P                WQ + +       ++   +P
Sbjct: 2   EIIDVYWDDPV--AFAEDMLGFYP--------------DEWQRKVL-------MDLAQSP 38

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 39  -----KVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++            +G + + ++T  RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVY-----------MIGSEERWFAT-ARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY------ 367
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 GET-LDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 368 --RPDAIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
             R D I +D +  G    D L      E L + VY V+   + +D E   N  TE    
Sbjct: 316 LKRVD-IKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGTEGWAV 374

Query: 420 MADWLE------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
           + D LE               + N   +I    S K + + + G++A+E K   + +G +
Sbjct: 375 VRDLLEENMKAFIQGEEPTMEIPNDEKMISQFSSRK-YRITSRGKIALERKEEMKKRGLQ 433

Query: 465 STDYSDGLMYTF 476
           S D +D ++  F
Sbjct: 434 SPDRADAIVLAF 445


>gi|228911519|ref|ZP_04075310.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
 gi|228848128|gb|EEM92991.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
          Length = 459

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 222/492 (45%), Gaps = 77/492 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +  +F+  +L F+P                WQ + +       ++   +P
Sbjct: 2   EIIDVYWDDPV--AFAEDMLGFYP--------------DEWQRKVL-------MDLAQSP 38

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 39  -----KVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++            +G + + ++T  RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVY-----------MIGSEERWFAT-ARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY------ 367
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 GET-LDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 368 --RPDAIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
             R D I +D +  G    D L      E L + VY V+   + +D E   N   E    
Sbjct: 316 LKRVD-IKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGAEGWAV 374

Query: 420 MADWLE------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
           + D LE               + N   +I    S K + + + G++A+E K   + +G +
Sbjct: 375 VRDLLEENMKAFIQGEEPTMEIPNDEKMISQFSSRK-YRITSRGKIALERKEEMKKRGLQ 433

Query: 465 STDYSDGLMYTF 476
           S D +D ++  F
Sbjct: 434 SPDRADAIVLAF 445


>gi|332976102|gb|EGK12970.1| hypothetical protein HMPREF9374_1123 [Desmospora sp. 8437]
          Length = 462

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 197/427 (46%), Gaps = 55/427 (12%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           A+ AG G+GKT   AW VLW + TRP   + C A ++ QL   LW E++KWL        
Sbjct: 51  AVRAGHGVGKTATEAWAVLWFLLTRPFPKIPCTAPTKPQLMDVLWPEIAKWL-------- 102

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
             M +  L P   +          + + ++T  RT +  +P+   G H  + + +I DEA
Sbjct: 103 --MNAPELAPYVEWQKTRVVMKQYEERWFAT-ARTSN--KPENMAGFHEEHLLFVI-DEA 156

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           SG  + I   I G LT   A    +M  NP R +G FY+ F++  D +  ++I     + 
Sbjct: 157 SGVDNAIFETIDGALT--TAGSKLVMFGNPTRTNGVFYDAFHQDRDLYWTYKISCLDSKM 214

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIM 320
               +   +  +YG DSD+ RV V G+FPQ D DSFIPL ++E+A  R+        L +
Sbjct: 215 ASKDYARNMARKYGEDSDIYRVRVQGEFPQGDPDSFIPLELVEDARVRDLEWIDEDELHI 274

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG--------LVEKYRPDAI 372
           G D+A  G D TV+  R GPV    F   +   RT   +  G        L+E++R D  
Sbjct: 275 GVDVARFGSDETVLAARIGPVA---FRLDRYGGRTPTTETVGRVLALARELMEEHRRDYA 331

Query: 373 IIDANNT--GARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH--VKMADW----- 423
           ++  ++T  G    D L+ +      V  +   +D+  C N  T  H      DW     
Sbjct: 332 VVKVDDTGVGGGVTDQLQEI------VAEEGLNIDVIPCNNGATPEHDPDHYHDWGTESW 385

Query: 424 ---------LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDG 471
                     E A  I+   LI  L + K  +  + G++ +ESK   + +G +S D +D 
Sbjct: 386 GTLLDRFKAGEIALKIDDEDLIGQLTTRKKEMT-SKGKIKLESKEKMKKRGQRSPDRADA 444

Query: 472 LMYTFAE 478
           L+  FAE
Sbjct: 445 LVLAFAE 451


>gi|209901239|ref|YP_002290878.1| putative terminase B [Clostridium phage phiCD27]
 gi|199612120|gb|ACH91293.1| putative terminase B [Clostridium phage phiCD27]
          Length = 469

 Score =  153 bits (386), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 134/437 (30%), Positives = 202/437 (46%), Gaps = 62/437 (14%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K +I +G+G+GKT L +   +W +STRP   V+  A +  QL   LWAE++KWLS    +
Sbjct: 44  KVSIRSGQGVGKTGLESIATVWYLSTRPFPKVVATAPTRQQLYDVLWAEIAKWLSNSKVE 103

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
              E          W    ++   G + + ++T  RT    +P+   G H  Y M  + D
Sbjct: 104 KLLE----------WTKTKVYMK-GFEERWWAT-ARTAV--KPENMQGFHEDY-MLFVVD 148

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT--- 255
           EASG  D I   ILG L+   A    ++  NP R SG FY+  N+  D +K F++ +   
Sbjct: 149 EASGVADPIMEAILGTLS--GAENKLLLCGNPTRTSGTFYDSHNRDRDLYKTFKVSSLDS 206

Query: 256 -RT----VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            RT    +E +   +HEG        SD  RV V G+FP+ + DS I L  +E +  RE 
Sbjct: 207 PRTSKDNIEMLKRKYHEG--------SDPWRVRVLGEFPKGESDSLISLEAVETSTIREV 258

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR-- 368
                  L +G DIA  G D T++  R G  +  L  +SK D   T   I   V+K++  
Sbjct: 259 NISNDYILNIGADIARYGDDETIIAPRIGGKVFDLLTYSKKDTMETVGNILRAVDKFKNM 318

Query: 369 -----PDAIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDL--------EFC 409
                   I  D +  GA   D L      E L Y V  +     A++         E  
Sbjct: 319 YHQINRVKIKTDDDGLGAGVTDRLKEVIRHERLKYEVIPIQNGSSAIEKDKYYNKASEMW 378

Query: 410 RNRRTELHVKMADWLE----FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKG 462
            N R EL   ++ +++       L N   LI+ L + K + V + G++ IESK   + + 
Sbjct: 379 DNMREELDANLSSFIQNKEAIIQLPNDDKLIKQLSNRK-YTVDSKGKIQIESKKEMKKRI 437

Query: 463 AKSTDYSDGLMYTFAEN 479
            +S D +D ++Y+FAEN
Sbjct: 438 GESPDRADAVIYSFAEN 454


>gi|150016512|ref|YP_001308766.1| hypothetical protein Cbei_1636 [Clostridium beijerinckii NCIMB
           8052]
 gi|149902977|gb|ABR33810.1| conserved hypothetical protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 470

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 132/438 (30%), Positives = 203/438 (46%), Gaps = 63/438 (14%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K ++ +G+G+GKT L + +V W + TRP   VI  A +  QL   LWAE+SKWL+    +
Sbjct: 44  KVSVRSGQGVGKTGLESIVVTWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLASSKIE 103

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           +  E     ++   +            S+ +    +T +  RP+   G H  Y M  + D
Sbjct: 104 NLLEWTKTKIYMKGY------------SERWWATAKTAT--RPENMQGFHEDY-MLFVVD 148

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT--- 255
           EASG  D I   ILG LT    N+  +M  NP R SG FY+  N+  D +K F++ +   
Sbjct: 149 EASGVADPIMEAILGTLTGYE-NKL-LMCGNPTRTSGTFYDSHNRDRDLYKTFKVSSLES 206

Query: 256 -RT----VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA-LNRE 309
            RT    +E +   +HEG        SDV RV V G+FP+ + DS I L   E A + + 
Sbjct: 207 PRTSKDNIEMLKRKYHEG--------SDVWRVRVEGEFPKGESDSLISLEYAETATITKI 258

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
                   L +G DIA  G D +V+  R G  +  L  ++K D   T   I    +K++ 
Sbjct: 259 NNIHNNFTLHIGADIARFGNDESVIAPRIGNKVFDLLTYTKKDTMETTGNILRATDKFKN 318

Query: 370 D-------AIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
           +        I +D +  G    D L      E LGY V  +    +A D E   ++  E+
Sbjct: 319 EYKHINKVKIRVDDDGLGGGVTDRLREVIRQEGLGYEVMPIKNGSKANDEEHYSDKSAEM 378

Query: 417 HVKMADWLE--FASLI----------NHSGLIQNLKSLKSFIVPNTGELAIESK---RVK 461
              M D LE  F + +          N+  LI+ L + K F + + G + +E K   + +
Sbjct: 379 WGNMRDILEENFTNFVQGKEPTIELPNNDKLIKQLSNRK-FRIDSKGRIDLEKKEEMKKR 437

Query: 462 GAKSTDYSDGLMYTFAEN 479
             +S D +D ++Y+FAEN
Sbjct: 438 IGESPDLADAVIYSFAEN 455


>gi|150390341|ref|YP_001320390.1| hypothetical protein Amet_2579 [Alkaliphilus metalliredigens QYMF]
 gi|149950203|gb|ABR48731.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 469

 Score =  147 bits (370), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 127/428 (29%), Positives = 195/428 (45%), Gaps = 44/428 (10%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K ++ +G+G+GKT L +  + W + TRP   VI  A +  QL   LWAE+SKWLS     
Sbjct: 44  KVSVRSGQGVGKTGLESIAITWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLS----- 98

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
                +S       W    ++ + G + + ++T  RT    RP+   G H  Y M  + D
Sbjct: 99  -----KSKVDKLLRWTKTKIYMN-GFEERWWAT-ARTAV--RPENMQGFHEDY-MLFVVD 148

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           EASG  D I   ILG LT    N+  ++  NP + SG FY+  N+  D +K  ++ +   
Sbjct: 149 EASGVADPIMEAILGTLTGYE-NKL-LLCGNPTKTSGTFYDSHNRDRDTYKSHKVSSMDS 206

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
                   E +  +YG DSDV RV V G FP+ + DS I L + E+A            L
Sbjct: 207 PRTSKENIEMLKKKYGADSDVFRVRVLGDFPKGEADSLISLEVTEQAAETVVDISNAYTL 266

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD-------A 371
            +G DIA  G D T++  R G  +  L  +SK D   T   I   V++ +          
Sbjct: 267 NIGADIARFGDDKTIIAPRIGNRVLDLQQYSKKDTMETAGNILRTVDRLKTQHLQINKIV 326

Query: 372 IIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           I ID +  G    D L      + LGY +  +    +A D E   N+  E+   + + L+
Sbjct: 327 IKIDDDGLGGGVTDRLREINRQQSLGYIIVPIKNGSKADDPEHYYNKAAEMWDNIRELLD 386

Query: 426 ---FASLINHSGLIQNLK--------SLKSFIVPNTGELAIESK---RVKGAKSTDYSDG 471
                 L    G+IQ  K        S + + V + G + +ESK   + +  +S D +D 
Sbjct: 387 ENLSKFLQGEPGVIQLPKDDILIKQLSNRKYKVDSKGRIELESKDEMKRRIGESPDRADA 446

Query: 472 LMYTFAEN 479
           ++Y+FA +
Sbjct: 447 VIYSFASD 454


>gi|153810665|ref|ZP_01963333.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
 gi|149833061|gb|EDM88143.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
          Length = 469

 Score =  144 bits (363), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 142/284 (50%), Gaps = 17/284 (5%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           ++ +G GIGK+ + AW V+W M T P   + C A ++ QL   LWAE+SKW     N   
Sbjct: 44  SVRSGHGIGKSAVEAWSVIWFMCTHPYPKIPCTAPTQHQLFDILWAEISKWKR---NNKT 100

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
            + + +      W  + L+  +   ++ +  + RT S   PD   G H  + + II DEA
Sbjct: 101 LDSELI------WTKEKLY--MKGHAEEWFAVARTAST--PDALQGFHAEHMLYII-DEA 149

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           SG  D I   +LG L+   A    +M  NP +LSG FY+  NK  + +  F ID R    
Sbjct: 150 SGVEDKIFEPVLGALSTPGAK--LLMCGNPTQLSGFFYDSHNKNREQYSTFHIDGRNSTR 207

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI- 319
           +   F + II  YG DSDV RV V G FP  + D +IPL ++E+++  E  P  +  +I 
Sbjct: 208 VSQEFVQTIINMYGEDSDVFRVRVAGDFPLAEDDIYIPLPLVEKSIATEYFPRRHPQIIH 267

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL 363
           +GCD+A  G D TV+  R    ++        D   T + I  L
Sbjct: 268 IGCDVARFGTDKTVIGYRTDEKVQFFKKRVGQDTMKTADDIVSL 311


>gi|228950291|ref|ZP_04112468.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228809453|gb|EEM55897.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 495

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 200/470 (42%), Gaps = 73/470 (15%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ E +  +  H   SV             +G+G+GKT + +W+ +W +  RP   +
Sbjct: 41  PDPWQKEVLNDIANHSHVSVR------------SGQGVGKTAMESWICIWFLCCRPYPKI 88

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           IC A ++ QL   LWAE++KWL+    K   +          W    ++   G + + ++
Sbjct: 89  ICTAPTKQQLYDVLWAEIAKWLNSSQVKDLLK----------WTKTKIYMK-GFEDRWFA 137

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
           T     +  RP+   G H  Y M  I DEASG  D I   ILG L+      F  M  NP
Sbjct: 138 T---AKTATRPENMQGFHEDY-MLFIADEASGIADDIMEAILGTLSGSENKLF--MCGNP 191

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
            + SG F++  NK    +K  ++ +           E +  +YG  SDV RV V G+FP+
Sbjct: 192 TKTSGVFFDSHNKDRALYKSHKVSSADSPRTSKKNIEMLKKKYGEGSDVYRVRVEGEFPR 251

Query: 291 QDIDSFIPLNIIEEALNREP------------------CPDPYAPLIMGCDIAEEGGDNT 332
            + D+FI L   E A  RE                    PD  A + +GCD+A  G D T
Sbjct: 252 GEADAFISLETAEAARMREVYKVEVIENEEEESTVKEIIPDT-AVVEIGCDVARFGSDET 310

Query: 333 VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY--------RPDAIIIDANNTGARTC 384
           ++  RRG  +  L    + D    +  +    +KY        +   I ID    G    
Sbjct: 311 IIATRRGWKVLPLQVHHQRDTMYVSGLLVQEAKKYFSWCERTGKRIPIRIDDTGVGGGVT 370

Query: 385 DYL-EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA--------DWLEFASLINHSGL 435
           D L E++  + Y +      + + F      E    ++        + LEF +L +   L
Sbjct: 371 DRLKEVVAENDYPI----DVIPINFASKGNAEYACIVSVMYGHFKDNCLEFVALPDDEDL 426

Query: 436 IQNLKSLKSFIVPNTGELAIESKRV---KGAKSTDYSDGLMYTFAENPPR 482
           I  L S++ + + + G + IE K+    +G KS D ++ ++  FA   P+
Sbjct: 427 IAQL-SVRKYQINSDGRIKIEPKKAMKDRGLKSPDRAEAVVMAFAPFYPK 475


>gi|257883493|ref|ZP_05663146.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294614775|ref|ZP_06694675.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|294622490|ref|ZP_06701512.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|257819151|gb|EEV46479.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291592387|gb|EFF23996.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|291598037|gb|EFF29147.1| conserved hypothetical protein [Enterococcus faecium U0317]
          Length = 471

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 218/478 (45%), Gaps = 49/478 (10%)

Query: 34  HFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT 92
            F P+ + G+ ++ +   P ++  + + +       +V N   E  K ++ +G+G+GKT 
Sbjct: 4   EFIPFADIGSAIDYYYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTA 63

Query: 93  LNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP 152
           L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+           SL  +   
Sbjct: 64  LEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLN----------DSLIKNLLK 113

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL 212
           W    ++  +G DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   IL
Sbjct: 114 WTKTKIYM-VG-DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAIL 168

Query: 213 GFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR 272
           G L+    +   +M  NP  + G FY+  N   D ++  ++ +   +  +    E I+ +
Sbjct: 169 GTLS--GFDNKLLMCGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKK 226

Query: 273 YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---PCPDPYAPLIMGCDIAEEGG 329
           YG +SDV RV + G+FP+  +DSFI L  +E A  ++      +      +G D+A  G 
Sbjct: 227 YGKESDVARVRIFGEFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGD 286

Query: 330 DNTVVVLRRGPVIEHLFDWSK-TDLRTTN---NKISGLVEKY-RPDAIIIDANNT--GAR 382
           D+T++  R          +SK + + TT    N    L+ +Y   D ++I  ++T  G  
Sbjct: 287 DSTILFPRIATRALEYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGG 346

Query: 383 TCDYLEML---GYHVYRVLGQKRAVDLE--FCRNRRTELHVKMADWLE------------ 425
             D LE L    ++ + V G       E  F  N  T+L   + + LE            
Sbjct: 347 VTDRLEELIEDKHYPFEVFGVNNGSTSEDDFYDNLGTQLWGNIKEMLEENMTANLNGEQP 406

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
              L + S LI+ L S + F + +   + +ESK   + +   S D +D L   F E P
Sbjct: 407 VIELPSDSSLIKEL-STRKFKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPP 463


>gi|282598712|ref|YP_003358792.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300860603|ref|ZP_07106690.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307292389|ref|ZP_07572245.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|258598082|gb|ACV83339.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300849642|gb|EFK77392.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306496518|gb|EFM66079.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|315146097|gb|EFT90113.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
          Length = 484

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 123/431 (28%), Positives = 198/431 (45%), Gaps = 50/431 (11%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K ++ +G+G+GKT L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+     
Sbjct: 50  KVSVRSGQGVGKTALEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLN----- 104

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
                 SL      W    ++  +G DS+ +    RT +  +P+   G H  + M I+ D
Sbjct: 105 -----NSLIKDLLKWTKTKIYM-VG-DSERWFATARTAT--KPENMQGFHEDH-MLIVVD 154

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           EASG  D I   ILG L+    +   +M  NP  + G FY+  N   D ++  ++ +   
Sbjct: 155 EASGVADPIMEAILGTLS--GFDNKLLMCGNPNNIEGVFYDSHNTDRDKYRTHKVSSYDS 212

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
           +  +    + +I +YG +SDV RV + G+FP+  +DSFI L I+E A +          +
Sbjct: 213 KRTNKENIQMLIDKYGENSDVARVRIYGEFPKGALDSFISLEIVEFAKDINISDSELKHV 272

Query: 319 I---MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA---- 371
               +G D+A  G D+T+V  R G        +SK D   T  ++    ++   D     
Sbjct: 273 REGHIGVDVARFGDDSTIVFPRIGAKALPFEKYSKQDTMQTTGRVLKAAKRMMDDYPTIK 332

Query: 372 ---IIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
              I +D    G    D L      E L Y V  V   + + D ++  N+ T++   + +
Sbjct: 333 KVFIKVDDTGVGGGVTDRLKEVISDEKLPYEVIPVNNGESSTD-DYYANKGTQIWGDVKE 391

Query: 423 WLE--FASLINHSG----------LIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTD 467
            LE   ++ IN  G          LI+ L S + F + + G++ +ESK   + +   S D
Sbjct: 392 LLEQNISNSINGQGPTIELPDNANLIKEL-STRKFKMTSNGKIRLESKEDMKKRNVGSPD 450

Query: 468 YSDGLMYTFAE 478
            +D L   F E
Sbjct: 451 IADALTLAFYE 461


>gi|261208032|ref|ZP_05922709.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289567088|ref|ZP_06447483.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260077749|gb|EEW65463.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161103|gb|EFD09008.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 471

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 217/478 (45%), Gaps = 49/478 (10%)

Query: 34  HFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT 92
            F P+ + G  ++ +   P ++  + + +       +V N   E  K ++ +G+G+GKT 
Sbjct: 4   EFIPFADIGAAIDYYYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTA 63

Query: 93  LNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP 152
           L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+           SL  +   
Sbjct: 64  LEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLN----------DSLIKNLLK 113

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL 212
           W    ++  +G DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   IL
Sbjct: 114 WTKTKIYM-VG-DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAIL 168

Query: 213 GFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR 272
           G L+    +   +M  NP  + G FY+  N   D ++  ++ +   +  +    E I+ +
Sbjct: 169 GTLS--GFDNKLLMCGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKK 226

Query: 273 YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---PCPDPYAPLIMGCDIAEEGG 329
           YG +SDV RV + G+FP+  +DSFI L  +E A  ++      +      +G D+A  G 
Sbjct: 227 YGKESDVARVRIFGEFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGD 286

Query: 330 DNTVVVLRRGPVIEHLFDWSK-TDLRTTN---NKISGLVEKY-RPDAIIIDANNT--GAR 382
           D+T++  R          +SK + + TT    N    L+ +Y   D ++I  ++T  G  
Sbjct: 287 DSTILFPRIATRALEYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGG 346

Query: 383 TCDYLEML---GYHVYRVLGQKRAVDLE--FCRNRRTELHVKMADWLE------------ 425
             D LE L    ++ + V G       E  F  N  T+L   + + LE            
Sbjct: 347 VTDRLEELIEDKHYPFEVFGVNNGSTSEDDFYDNLGTQLWGNIKEMLEENMTANLNGEQP 406

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
              L + S LI+ L S + F + +   + +ESK   + +   S D +D L   F E P
Sbjct: 407 VIELPSDSSLIKEL-STRKFKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPP 463


>gi|289578588|ref|YP_003477215.1| hypothetical protein Thit_1395 [Thermoanaerobacter italicus Ab9]
 gi|289528301|gb|ADD02653.1| conserved hypothetical protein [Thermoanaerobacter italicus Ab9]
          Length = 460

 Score =  137 bits (346), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 183/416 (43%), Gaps = 45/416 (10%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           A+ A  G+GKT + AW+ LW + T     VI  A +  Q++  LW E+            
Sbjct: 49  AVRACHGVGKTKVAAWVALWFLYTHHNSKVITTAPTWHQVENLLWREIH----------- 97

Query: 141 FEMQSLSLHPA---PWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                 + H A   P    VL   + +  + ++    T   ++P+ F G H  + + I+ 
Sbjct: 98  ------AAHAASRIPLGGKVLQTQIELGEQWFALGLST---DKPERFQGFHAEHILLIV- 147

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI---D 254
           DEASG          GFLT   A    ++  NP +LSG+FY  F  PL  + +  I   D
Sbjct: 148 DEASGVEQYTFDAAEGFLTSIGAK--LLLIGNPTQLSGEFYNAFRSPL--YHKIHISAFD 203

Query: 255 TRTVEG--------IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
           +  ++         + P + E    ++G DS +    V G+FP+Q  D+ IPL  IE A 
Sbjct: 204 SPNLKAGKIVRPYLVTPEWVEDKRLKWGEDSPLWYSRVLGEFPEQGNDTLIPLAWIEAAQ 263

Query: 307 NREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEK 366
            R    +   P+ +G D+A  G D TV++LRRG   E ++     D      K+    +K
Sbjct: 264 QRWHMTEAGEPVEIGADVARYGTDTTVIMLRRGDKAEIVYQLRGQDTMEVTGKVIDAFKK 323

Query: 367 YRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF 426
              + I ID    GA   D L+  GY V  +   + A D     N+R E +  + +  + 
Sbjct: 324 TGANVIKIDVVGIGAGVVDRLKEQGYPVQGLNVGESATDKGRFVNKRAEWYWALRERFQE 383

Query: 427 ASLI--NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
            ++       L   L SLK +   + G + IESK   R +G  S D +D LM  F+
Sbjct: 384 GTIAIPPDDELASQLASLK-YKFDSRGRIQIESKEELRRRGLPSPDKADALMLAFS 438


>gi|323486060|ref|ZP_08091391.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
 gi|323400627|gb|EGA92994.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
          Length = 476

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 125/430 (29%), Positives = 188/430 (43%), Gaps = 58/430 (13%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K AI +G+G+GKT + A  +LW +   P   ++  A ++ QL   LW+EVSKW+S     
Sbjct: 52  KVAIKSGQGVGKTGMEAVALLWFLCCYPYPRIVATAPTKQQLHDVLWSEVSKWMS----- 106

Query: 139 HWFEMQSLSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
                       +P  SD+L     +  +  + K +  + RT +  +P+   G H    M
Sbjct: 107 -----------KSPLLSDILKWTKTYIYMVGNEKRWFAVARTAT--KPENMQGFHED-NM 152

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             I DEASG  D I   ILG L+   AN   +M  NP R SG FY+ FN     ++   +
Sbjct: 153 LFIVDEASGVADPIMEAILGTLS--GANNKLLMCGNPTRTSGTFYDAFNVDRSIYRCHTV 210

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE-PCP 312
            +   +  +    E +I +YG DS+V  V V G+FP+Q+ D FI L+I+E     + P  
Sbjct: 211 SSADSKRTNKQNIESLIRKYGKDSNVVLVRVFGEFPKQEDDVFIALSIVEHCCMLDLPDD 270

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE------- 365
            P   +  G D+A  G D TV+    G  I     +    L TT  KI  L         
Sbjct: 271 VPIKRISFGVDVARYGSDETVIAKNVGGRITLPVSFRGQSLMTTVGKIVQLYRQAITEFP 330

Query: 366 KYRPDAII-IDANNTGARTCDYLEML-----------------GYHVYRVLGQKRAVDLE 407
           +YR    I ID    G    D LE +                 G      LG  +    +
Sbjct: 331 RYRGKIYINIDDCGLGGGVTDRLEEVKQEEKLTRMVIVPVNAAGKVPEETLGDGKQKACD 390

Query: 408 FCRNRRTEL--HVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKG 462
              N  T L   VK A  +E  SL N + L+    + + + + + G++ +ESK   + +G
Sbjct: 391 IYDNMTTYLWGTVKDALMMEEVSLENDNELVAQF-TCRKYRLTSRGKMLLESKEEMKKRG 449

Query: 463 AKSTDYSDGL 472
             S D +D +
Sbjct: 450 IDSPDRADAV 459


>gi|319956916|ref|YP_004168179.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
 gi|319419320|gb|ADV46430.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
          Length = 462

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 121/426 (28%), Positives = 197/426 (46%), Gaps = 39/426 (9%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K +I +G G GKTTL AW+VLW    R    +   A +  QL   L  E+ KW   +P +
Sbjct: 45  KISIRSGHGTGKTTLLAWIVLWWGLGREDAKIPMTAPTGHQLYDLLMPEIRKWREKMPVQ 104

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           +  E++            V    +   + +++ + RT  +++P+   G H T  +A I D
Sbjct: 105 YQNEVE------------VKTEKIDFANGNFA-VPRTARKDQPEALQGFHAT-NLAFIID 150

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           EASG P VI     G +T    +   IM +NP R  G FY+  +K    W+ FQ +    
Sbjct: 151 EASGIPQVIFEVAEGAMT--GESTLVIMAANPTRTEGYFYDSHHKNRWQWECFQFNAEES 208

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
           E +   + E    +YG DSDV RV + G+FP+Q  ++   L  +++A  RE   D  A  
Sbjct: 209 ENVSKEWIEEKKRQYGEDSDVYRVRIKGEFPRQSSNAVFSLQEVDDATTREIVDDSGAE- 267

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY-----RPDAII 373
           + G D+A+ G D +V+  R+G   +H  + +     T  +    L+ +Y     +P  I 
Sbjct: 268 VWGLDVADFGDDKSVLAKRKG---KHFHEITARSGLTLPDLAGWLIYEYNQAKRKPAVIF 324

Query: 374 IDANNTGARTCDYLEMLGYH-VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH 432
           +DA   G+         G   V  V G   A + E   N+R E +  + D LE   + + 
Sbjct: 325 VDAIGIGSSLPAVCFEKGLDIVIGVKGSNSASNSEKYHNKRAEWYYNLKDLLEDGKIPDD 384

Query: 433 SGLIQNLKSLKSFIVPNTGELA-IESKRVKG--AKSTDYSDG-------LMYTFAENP-- 480
             L+  L + K + + +TG++  +E K +K    +S D +D        ++Y   EN   
Sbjct: 385 DELVGELMAQK-YQISSTGKIQLVEKKEIKKELGRSPDKADACALTCERMIYVEEENDDI 443

Query: 481 PRSDMD 486
           P +DM+
Sbjct: 444 PEADME 449


>gi|160940775|ref|ZP_02088117.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436295|gb|EDP14062.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
          Length = 484

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 133/265 (50%), Gaps = 39/265 (14%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL-------- 132
           ++ +G GIGK+ + AW V+W M TRP   + C A +E QL   LWAE+SKW+        
Sbjct: 44  SVRSGHGIGKSAVEAWSVIWYMCTRPFPKIPCTAPTEHQLMDVLWAEISKWMRNNPALRD 103

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
            L+  K    MQ    HP  W++                + RT +   P+   G H  + 
Sbjct: 104 DLIWTKEKLYMQG---HPEEWFA----------------VPRTATN--PEALQGFHAEHV 142

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
           + II DEASG  D +   +LG +T  +A    +M  NP RL+G FY+  ++  + +    
Sbjct: 143 LYII-DEASGVSDKVFEPVLGAMTGEDAK--LLMMGNPTRLAGFFYDSHHRNREQYSAIH 199

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
           +D R  + +  +F + II  +G DSDV RV V GQFP+   DS I +   EEA N +   
Sbjct: 200 VDGRDSQHVSRTFVQKIIDMFGEDSDVFRVRVAGQFPKSTPDSLIAMEWCEEAANLQ--- 256

Query: 313 DPYAP---LIMGCDIAEEGGDNTVV 334
             YAP   + +G D+A  G D++ +
Sbjct: 257 -VYAPGGQIDIGVDVARYGDDSSAL 280


>gi|266623290|ref|ZP_06116225.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
 gi|288864932|gb|EFC97230.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
          Length = 484

 Score =  126 bits (317), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 137/270 (50%), Gaps = 31/270 (11%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKH- 139
           ++ +G G+GK+ + +W V+W + TRP   + C A ++ QL   LWAE+SKWL   P    
Sbjct: 44  SVRSGHGVGKSAVESWSVIWFLCTRPFPKIPCTAPTQHQLYDILWAEISKWLRNNPELKN 103

Query: 140 ---WFEMQS-LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
              W + +  ++ +P  W++                + RT +   P+   G H  + + I
Sbjct: 104 DIIWTQQRVYMNGYPEEWFA----------------VPRTATN--PEALQGFHAEHVLYI 145

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
           I DEASG  D +   +LG +T  +A    +M  NP RLSG F++  +K   ++    ID 
Sbjct: 146 I-DEASGVSDKVFEPVLGAMTGEDAK--LLMMGNPTRLSGFFFDSHHKSRSEYSAMHIDG 202

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
           R  + ++  F + II  +G+DSDV RV V GQFP+   DS I ++  E A   +P     
Sbjct: 203 RDSQHVNQKFVQKIINMFGMDSDVFRVRVAGQFPKSTPDSLIMMDWCEAATQLKP-ETVR 261

Query: 316 APLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
             + +G D+A  G D++ +     PVI+ +
Sbjct: 262 NRVDIGVDVARYGDDSSALY----PVIDKV 287


>gi|308069786|ref|YP_003871391.1| hypothetical protein PPE_03030 [Paenibacillus polymyxa E681]
 gi|305859065|gb|ADM70853.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 452

 Score =  122 bits (307), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 134/463 (28%), Positives = 202/463 (43%), Gaps = 72/463 (15%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ   +       ++  NNP     + ++ +G+G+GKT L A   LW +S  P   V
Sbjct: 6   PDDWQASTL-------MDLANNP-----RVSVRSGQGVGKTGLEAATALWFLSCFPYPKV 53

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           IC A +  QL   LWAE++KW S  P         +      W    ++     + + ++
Sbjct: 54  ICTAPTRQQLHDVLWAEINKWQSKSP---------VLKRILKWTKTKIYMK-NYEERWFA 103

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
           T  RT +  +P+   G H  Y M  I DEASG  D I   ILG L+    N+  +M  NP
Sbjct: 104 T-ARTAT--KPENMQGLHEDY-MLFIVDEASGVADPIMEAILGTLSGE-FNKI-LMCGNP 157

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID-PSFHEGIIA----RYGLDSDVTRVEVC 285
            + SG FY+  NK   D+K     TR V  +D P   +  IA    +YG  SDV RV V 
Sbjct: 158 TKTSGVFYDSHNKDRADYK-----TRKVSCLDSPRTSKDNIAMLKRKYGEGSDVWRVRVE 212

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVI 342
           G+FP+   D+FI L + E A   +  EP  D    L +G D+A  G D T +    GP I
Sbjct: 213 GEFPRGGSDTFISLEVAEFAAKEVKLEPTGD---MLTIGVDVARFGDDETSMFAGIGPRI 269

Query: 343 EHLFDWSKTDLRTTNNKISGLVEKYRPD-------AIIIDANNTGARTCDYL------EM 389
                  K     T   +  L ++ +          I +D +  G    D L      E 
Sbjct: 270 VGEHHHFKKGTMVTAGWVINLAKELQVAHPYLNRIRIRVDDSGVGGGVTDRLSEIVAEEG 329

Query: 390 LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE--FASLINHSGLIQNLK------- 440
           L Y +  +     ++D E   N  TE+   + + LE   ++ +N    I  L        
Sbjct: 330 LPYEIIPINNGSSSLD-EHYGNLVTEMWASIKEQLEQNMSNFMNGDSSILQLPDDDVLIT 388

Query: 441 --SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
             + + + + + G++ +ESK   + +G KS D +D  + TF E
Sbjct: 389 QLTARKWNMTSKGKMLLESKKDMKKRGLKSPDRADAFVLTFGE 431


>gi|255282256|ref|ZP_05346811.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267204|gb|EET60409.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 506

 Score =  119 bits (298), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 124/257 (48%), Gaps = 19/257 (7%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           A+ +G+G+GKT + A  VLW +S      V+  A +  QL   LW+E++KW    P    
Sbjct: 68  AVKSGQGVGKTGIEAVAVLWFLSCFRYARVVATAPTRQQLHDVLWSEIAKWQERSP---- 123

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
                L      W    ++   G + K +  + RT +  +P+   G H    M  I DEA
Sbjct: 124 -----LLKAILRWTKTYVYVK-GYE-KRWFAVARTAT--KPENMQGFHED-NMLFIVDEA 173

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           SG  D I   +LG L+    N   +M  NP R +G FY+ F K    +    + +     
Sbjct: 174 SGVADPIMEAVLGTLS--GGNNKLLMCGNPTRTTGTFYDAFTKDRSIFACHTVSSLDSSR 231

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---PCPDPYAP 317
            D +  + +I +YG DS++ RV V G FP+QD D FI   +I++  +R+   P     A 
Sbjct: 232 TDKNNIDALIRKYGEDSNLVRVRVKGLFPKQDDDVFISQELIDQCTSRQYELPESRGMAQ 291

Query: 318 LIMGCDIAEEGGDNTVV 334
           +I+G D+A  G D TV+
Sbjct: 292 VILGVDVARYGNDETVI 308


>gi|307308936|ref|ZP_07588619.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
 gi|306900570|gb|EFN31183.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 114/427 (26%), Positives = 188/427 (44%), Gaps = 46/427 (10%)

Query: 76  EVFKG----AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
           E FK      +    G GKT ++A  + W +     + V   A SE+ +K+ +W E    
Sbjct: 42  EAFKNNQTITVKGSSGWGKTFISAISLWWSLIVFDPVKVTIFAPSESTIKSGIWNE---- 97

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL-GIDSKHYSTMC----RTYSEERPDTFVG 186
                      +Q L  + AP + ++   S   I  K     C    R  S++      G
Sbjct: 98  -----------LQVLYSNMAPLFRELFEVSATKIFRKSRGETCWAEYRLVSKDNIAAARG 146

Query: 187 HHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP-- 244
            H+   + +I DEASG  DVI  G L  +         ++ SNP + SG F++ +  P  
Sbjct: 147 FHSKNNI-VIADEASGIEDVIFTGALLNVLNDGPGAKVVLVSNPDKASGFFFKTWRDPEL 205

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
             DW +     R      P   E     YG + S      V G+FP  D+D  I    ++
Sbjct: 206 SKDWIKVHGSIRDKPNYTPGEEERFARLYGGVTSRDYLTLVEGEFPLSDVDGLISREFLD 265

Query: 304 EAL-NREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           EA+ N++  P+P AP+I G D A  G D +V+ +R   V+    +W+  +      ++  
Sbjct: 266 EAVTNKDAIPNPKAPIIWGLDPAGAGKDKSVLAIRHDNVLRGFEEWAGLEPVALALRVKE 325

Query: 363 LV----EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQ---KRAVDLEFCRNRRTE 415
           L     +K RP  I +D N  GA   D L+     VY+ +     KR  D  + R  R +
Sbjct: 326 LYLKTSKKDRPAVIAVDGNGLGAGVYDALKHFKIPVYKCMFAEVPKRNPD-RYTR-VRDQ 383

Query: 416 LHVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPNTGELAIESKRV---KGAKSTDYSD 470
           +  +M +W+     S+ NH  LI++L ++ ++   ++ ++ IE K+    +  +S DY+D
Sbjct: 384 IWFEMREWIHTGDVSIPNHKKLIEDL-AIPTY--EDSPKIKIEDKKSLKKRLGRSPDYAD 440

Query: 471 GLMYTFA 477
            L  TF+
Sbjct: 441 ALALTFS 447


>gi|253578914|ref|ZP_04856185.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849857|gb|EES77816.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 473

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 134/264 (50%), Gaps = 22/264 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
           NP+V   +I +G+G+GKT L A + LW ++  P   ++  A ++ QL   LW+E+SKW+S
Sbjct: 32  NPKV---SIKSGQGVGKTGLEAAVFLWFVTCFPHPRIVATAPTKQQLHDVLWSEISKWMS 88

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
                   E+ S+ L     Y  ++      + K +  + RT +  +P+   G H    M
Sbjct: 89  K------SELLSILLKWTKTYVYMVG-----EEKRWFGVARTAT--KPENMQGFHED-NM 134

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             I DEASG  D I   ILG L+   AN   ++  NP + SG FY+   +    +K   +
Sbjct: 135 LFIVDEASGVADPIMEAILGTLS--GANNKLLLCGNPTKTSGTFYDSHTRDRALYKCHTV 192

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR---EP 310
            +      +    + ++ +YG DS+V RV V G+FP Q+ D FIPL++IE+  ++     
Sbjct: 193 SSMDSTRTNKENIDSLVRKYGWDSNVVRVRVRGEFPNQEDDVFIPLSLIEQCSSKLLELD 252

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVV 334
             D    + +G D+A  G D T++
Sbjct: 253 DADGMQFVSLGVDVARFGDDETII 276


>gi|167767949|ref|ZP_02440002.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|167710278|gb|EDS20857.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|291560988|emb|CBL39788.1| hypothetical protein CL2_30180 [butyrate-producing bacterium SSC/2]
          Length = 473

 Score =  113 bits (283), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 95/319 (29%), Positives = 141/319 (44%), Gaps = 24/319 (7%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K  I +G+G+GKT   A  +LW +S      V+  A +  QL   LWAEVSKW S  P  
Sbjct: 49  KVTIKSGQGVGKTGFEAATLLWFLSCFENARVVATAPTLHQLNDVLWAEVSKWQSKSP-- 106

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
                    L     ++      +G   + Y+ + RT +   P+   G H    M  I D
Sbjct: 107 --------LLKEILQWTKTKISMIGSKERWYA-VARTAT--TPENMQGFHED-NMLFIVD 154

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           EASG  D I   ILG LT   +N   ++  NP + SG FY+        +    +++   
Sbjct: 155 EASGVADPIMEAILGTLT--GSNNKLLLCGNPTKASGTFYDSHTSDRKLYYCITVNSAES 212

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
           +  +    + +I +YG +S+V RV V G FP+QD D ++PL ++E ++  E  P P    
Sbjct: 213 KRTNKDNIDSLIRKYGEESNVVRVRVKGLFPKQDDDVYMPLEMLEASIILEEIP-PADIC 271

Query: 319 IMGCDIAEEGGDNTVVVLRRG-----PVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDA 371
            +G D+A  G D+TV+            I H  D  KT  D+      I    +  +   
Sbjct: 272 TLGVDVARFGDDDTVIARNMNNKITLEKIRHGQDLMKTVGDVVVECRNIKEKFKYKKTIY 331

Query: 372 IIIDANNTGARTCDYLEML 390
           +IID    G    D L  L
Sbjct: 332 VIIDDTGLGGGVTDRLNEL 350


>gi|332980681|ref|YP_004462122.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
 gi|332698359|gb|AEE95300.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
          Length = 486

 Score =  106 bits (265), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 113/442 (25%), Positives = 178/442 (40%), Gaps = 64/442 (14%)

Query: 79  KGAISAGRGIGKTTLNAWLVLW-LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN 137
           + A+ +  G GK+ +   ++LW L S  P I V+  A +  Q++  +W EV         
Sbjct: 46  RTAVRSCHGAGKSFIAGQVILWFLYSFYPSI-VLSTAPTWRQVEKLIWKEVRA------- 97

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  S      P   ++L     I            S   PD F G H    + ++ 
Sbjct: 98  -------SYRRSKVPLGGNLLPKRPEIQIIQDEWYAVGLSTNEPDRFQGFHEE-NILVVV 149

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
           DEA+G P+ I   I G LT  +A    ++  NP  + G FY  F  P   W+   I   T
Sbjct: 150 DEAAGVPEEIFEAIEGVLTSEHAR--LLLLGNPTSVGGTFYNAFRTP--GWENISISAFT 205

Query: 258 VEG-----------------------------IDPSFHEGIIARYGLDSDVTRVEVCGQF 288
                                           I P++      R+G +S   +  V GQF
Sbjct: 206 TPNFTAFGITEDDIINKTWESKITNSLPNPKLITPAWVADKYRRWGPNSPAYQARVLGQF 265

Query: 289 PQQDIDSFIPLNIIEEALNR-EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
           P +  D+ IPL  IE A+ R E  P+   P+ +G D+A  G D TV+  RRG  +  L  
Sbjct: 266 PSEGEDTLIPLAWIEAAMARWEDTPE-GEPIEIGVDVARFGSDKTVIAARRGQKVLPLNV 324

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE 407
           ++K D   T   I  +  K       +D    GA   D L+  G+ V  +   + A D E
Sbjct: 325 YAKQDTMETVGCIIMVHRKIGASKTKVDVIGVGAGVVDRLKEQGHPVIGINVAEAATDTE 384

Query: 408 FCRNRRTELHVKMADWLEFASLIN--------HSGLIQNLKSLKSFIVPNTGELAIESK- 458
              N R+EL   M + L+    +N           L+ +L  +K + + + G + +ESK 
Sbjct: 385 KFANLRSELWWNMRELLDPNQRLNPEPIALPPDDELLADLSGVK-YKIDSRGRIQVESKE 443

Query: 459 --RVKGAKSTDYSDGLMYTFAE 478
             + +  +S D +D ++  FA+
Sbjct: 444 DMKKRLGRSPDRADAVVLAFAK 465


>gi|315122636|ref|YP_004063125.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496038|gb|ADR52637.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 301

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 90/170 (52%), Gaps = 8/170 (4%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQ----L 56
           M+     N E +  L   + S  I  +   F  + + WGE+GTPL     PR+WQ    L
Sbjct: 1   MNATFQPNIEYDTALLQNVLSPAIAGNPLAFTKYMYRWGEEGTPLANCKGPRAWQTEVFL 60

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E  E ++ +          +VFK AI++ RGIGKT L AW+  W +STR G +V+  ANS
Sbjct: 61  ELAEFIEKNKEAKRLGKPLQVFKLAIASARGIGKTALVAWITYWFLSTRIGCTVVISANS 120

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQS----LSLHPAPWYSDVLHCSL 162
           + Q KTT +AE+ +W SL  N H+FE       L+   +PW ++ +  +L
Sbjct: 121 DDQCKTTSFAEIRRWHSLAKNAHFFEANIAEALLAGGCSPWQAEPVAKTL 170


>gi|83593922|ref|YP_427674.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
 gi|83576836|gb|ABC23387.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
          Length = 505

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 121/468 (25%), Positives = 183/468 (39%), Gaps = 72/468 (15%)

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
           P   K  + AG G+GKTT  A  + W +         C A + +QL+  LW+E+++    
Sbjct: 34  PAGAKVTVRAGHGVGKTTATAAAIWWHLECFDYSKTPCTAPTASQLEQILWSELAR---- 89

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGI------DSKHYSTMCRTYSEERPDTFVGHH 188
           L  +     Q   L PA    + L    G         + +  + RT   ++PD   G H
Sbjct: 90  LRRRADARAQGTGL-PAALRLEALFAVSGRAIADRGTPREWFVVARTARRDQPDALQGFH 148

Query: 189 ----------------NTYGMAI--INDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
                            + G A+  + +EASG PD +     G L+   A    +M  NP
Sbjct: 149 ASDIDLEAGAGPRLSAKSGGAALMFVIEEASGVPDAVFEVAEGALSSPGAR--LLMVGNP 206

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
            R +G F     +    +   ++       +DP +  G++ +YG +S+V RV   G FP+
Sbjct: 207 TRNTGFFARSHKRDRASFTALRLRCADSPLVDPGYRAGLVRKYGAESNVVRVRADGAFPR 266

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAP---LIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
           QD D  I L   E AL R P P   A      +G D+A  G D TV +LR GPV+  +  
Sbjct: 267 QDDDVLIALETAEAALAR-PLPARMATEDERRLGVDVARFGDDRTVFLLRIGPVVGAIEV 325

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG----YHVYRVLGQKRA 403
            +  D      +   L E +R   I +D    GA   D L   G             +RA
Sbjct: 326 TAGRDTMAVAGRARRLAEIWRAGRIYVDEIGVGAGVVDRLREDGAPVVAVNVAASAPERA 385

Query: 404 VDLEFCRNRRTELHVKMADWLE-----------------FASLINHSG----------LI 436
              E  R  R  L + +  WL                   A L++  G          L 
Sbjct: 386 AGEERGRLLRDHLWLMVRGWLRDEAPVFAGPGGGPASGSAAGLLSGMGSCLVPGVDADLA 445

Query: 437 QNLK---SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
           Q+L    +   +    +G + +ESK   + +G +S D +D L  TF E
Sbjct: 446 QDLAGELATPRYAFDGSGRVVVESKDAMKRRGLRSPDLADALALTFHE 493


>gi|262316909|emb|CBA18135.1| putative terminase B [Paenibacillus phage phiBP]
          Length = 248

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 96/208 (46%), Gaps = 16/208 (7%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           ++ +G+G+GKT L A + LW +   P   V+C A +  QL   LWAE+SKW S  P    
Sbjct: 57  SVRSGQGVGKTALEAAISLWFLCCFPFPRVVCTAPTRQQLNDVLWAEISKWQSQSP---- 112

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
                +      W    ++     + + ++T  RT +  +P+   G H  Y M  I DEA
Sbjct: 113 -----ILKRILKWTKTKIYMK-NYEERWFAT-ARTAT--KPENMQGFHEDY-MLFIVDEA 162

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           SG  D I   I G L+      F  M  NP + SG F++  N+    ++  ++       
Sbjct: 163 SGVDDRIMAAIFGTLSGDYNKLF--MCGNPTKTSGFFFDSHNRDRAIYRTHRVSCLDSPR 220

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQF 288
                 E + A+YG  SDV RV V G+F
Sbjct: 221 TSKENIEMLKAKYGEGSDVWRVRVLGEF 248


>gi|48697461|ref|YP_024846.1| Pas60 [Actinoplanes phage phiAsp2]
 gi|47679679|gb|AAT36808.1| Pas60 [Actinoplanes phage phiAsp2]
          Length = 492

 Score = 87.4 bits (215), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 149/361 (41%), Gaps = 37/361 (10%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
           +P +W  + ++V  A     + +  P   + A+    G+GK+   A LV W  +TR  + 
Sbjct: 22  SPTAWAADCLDVRLAGYQGEILDAVPRERRVAVRGPHGLGKSFSGAILVNWFATTRDLMG 81

Query: 110 ----VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
               +I  A++   L+  LW E+ KW           +  ++L  AP+        L + 
Sbjct: 82  KDWKIITTASAWRHLEVYLWPEIHKWAG--------RINFVALGRAPYNPRTELLDLRLK 133

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA----N 221
             H +      +  +P+   G H    + ++ DEA   P      I G  +        N
Sbjct: 134 LTHGAATA--VASNQPERIEGAHAEELLYLL-DEAKIVPPATWDSIEGAFSNAGVDVADN 190

Query: 222 RFWIMTSNPRRLSGKFYEIFNKP--LDDW--KRFQIDTRTVEG-IDPSFHEGIIARYGLD 276
            +    S P   SG+FY+I  +    +DW  +   ++     G I  ++ +   +++G D
Sbjct: 191 AYAFAMSTPGAPSGRFYDIHRRAPGYEDWWTRHVTLEEAIASGRISRAWADQRRSQWGSD 250

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEAL------NREPCPDPYAPLIMGCDIAEEGGD 330
           S V    V G+F   D DS IPL  +E A+      +R+  P P  PL  G D+   GGD
Sbjct: 251 SAVFHNRVLGEFHASDEDSVIPLAWLEAAIERWHEWDRQGRPSPGGPLWTGVDVG-RGGD 309

Query: 331 NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
            TV+  R G  +       +T+ R       GL++  R    IID    GA   D L  L
Sbjct: 310 ETVLAARDGWAVT-----LETNRRRDTMATVGLIQA-REGRAIIDVIGLGAGVFDRLREL 363

Query: 391 G 391
           G
Sbjct: 364 G 364


>gi|228924410|ref|ZP_04087639.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228835241|gb|EEM80653.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 293

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 125/280 (44%), Gaps = 32/280 (11%)

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
           +  NP R SG FY+  N+  D +K  ++ +           E +  +YG  SDV RV V 
Sbjct: 3   LCGNPTRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVL 62

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
           G+FP+ + D+FIPL I+E+A + +  P     L +G D+A  G D TV+  R G  +  L
Sbjct: 63  GEFPKAEADAFIPLEIVEQAASCKVEPTGET-LDLGVDVARFGDDETVIAPRIGNKVFKL 121

Query: 346 FDWSKTDLRTTNNKISGLVEKY--------RPDAIIIDANNTGARTCDYL------EMLG 391
            +  K D   T   +  L ++Y        R D I +D +  G    D L      E L 
Sbjct: 122 LNHYKQDTMETAGHVLKLAKEYMAKYKQLKRVD-IKVDDSGVGGGVTDRLKEVIKSERLP 180

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE------------FASLINHSGLIQNL 439
           + VY V+   + +D E   N   E    + D LE               + N   +I   
Sbjct: 181 FKVYPVVNNGKPLDDEHYDNAGAEGWAVVRDLLEENMKAFIQGEEPTMEIPNDEKMISQF 240

Query: 440 KSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
            S K + + + G++A+E K   + +G +S D +D ++  F
Sbjct: 241 SSRK-YRITSRGKIALERKEEMKKRGLQSPDRADAIVLAF 279


>gi|292670767|ref|ZP_06604193.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292647388|gb|EFF65360.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 442

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 94/202 (46%), Gaps = 5/202 (2%)

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--APLIMGCDIAEEGGDNTVVVLRR 338
           R E+   F     D  IP++++  A NR    D     P+I+G D+A  G D TV+ +R+
Sbjct: 214 RQELLCDFTASASDVVIPIDLVTAAANRLLKDDDVLGQPVILGVDVARFGDDRTVLCVRQ 273

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
           G  ++ +  ++      T +++   + ++ P A  IDA   GA   D L  L Y V  V 
Sbjct: 274 GLWLKEVRTFTGLSTMETASRVIDCINQHHPHATFIDAGAMGAGVIDRLRQLRYQVSEVN 333

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK 458
             + A+D     N R E++ K   WLE    I  +  ++   S   +    TG + +E K
Sbjct: 334 FGEMAMDAARYANIRAEMYFKCRAWLEAGGAIPQNAELKTELSTVEYKFNPTGRIILEPK 393

Query: 459 ---RVKGAKSTDYSDGLMYTFA 477
              + +  KS D +DG + TFA
Sbjct: 394 DKLKERTGKSPDLADGFVLTFA 415


>gi|315649222|ref|ZP_07902312.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
 gi|315275441|gb|EFU38799.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
          Length = 189

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 99/223 (44%), Gaps = 45/223 (20%)

Query: 15  LFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPN 74
           L DL W D +  +F+  ++ F               P  WQ + M       ++    P 
Sbjct: 11  LLDLYWDDPV--AFAEDMMGF--------------DPDDWQCDVM-------MDVTQFP- 46

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
               + ++ +G+G+GKT L A LV+W +  RP   V+C A ++ QL   LW EVSKWL  
Sbjct: 47  ----RTSVRSGQGVGKTGLEAALVIWFLCCRPNPKVVCTAPTKQQLHDVLWTEVSKWLE- 101

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                     S+  +   W    ++  +G + + ++T     +  +P+   G H  Y M 
Sbjct: 102 ---------NSMVKNLLKWTKTKVY-MIGHEQRWFAT---ARTANKPENMQGFHEDY-ML 147

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
            I DEASG  D I   ILG L+   A    +M  NP R SG F
Sbjct: 148 FIVDEASGVSDPIMEAILGTLS--GAENKLLMCGNPTRTSGVF 188


>gi|257459276|ref|ZP_05624390.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
 gi|257443289|gb|EEV18418.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
          Length = 431

 Score = 77.0 bits (188), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 113/256 (44%), Gaps = 10/256 (3%)

Query: 236 KFYEIFNKPLDD---WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQ 291
           KF+++  + + +   W+ FQ  +     +     + ++A  G  DSDV R E+ G+F   
Sbjct: 161 KFFDLAQRGMRNEKGWRNFQFSSYDNPLLQKEEIDRLVAELGGADSDVARQEIFGEFLDT 220

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT 351
             +S   L  IE A  ++   D  AP+I   D+A EG D +V+  R+G  +E L  +   
Sbjct: 221 TSNSVFSLAAIEAAFRKQRYFDAGAPVIWALDVAREGDDESVLCKRQGDSVEPLKPYRIA 280

Query: 352 DLRTTNNKISGLVEK--YRPDAIIIDANNTGARTCDYLEMLGYH--VYRVLGQKRAVDLE 407
                  +I G  E+   +P AI ID    GA   D L  LG    V    G  +A D  
Sbjct: 281 STSELAREIYGEYERTDLKPHAIYIDTIGVGAGVFDTLCDLGLRGIVREAKGSFKASDER 340

Query: 408 FCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKG--AKS 465
              N+R E++  + + L   ++     L + L+++  +       L +  + +K    +S
Sbjct: 341 KYANKRAEMYFNLREKLPLLAIAPDEELKRQLQTIAFYFDKKERYLLMPKEGIKKEYGRS 400

Query: 466 TDYSDGLMYTFAENPP 481
            D +D L  +F +  P
Sbjct: 401 PDRADALAMSFFDLCP 416


>gi|226940459|ref|YP_002795533.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715386|gb|ACO74524.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 272

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 248 WKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN 307
           W   QID+RTVEG +          YG +SD  +V V G FP      FI    +  A  
Sbjct: 14  WVARQIDSRTVEGTNKEQIAKWAEDYGEESDFFKVRVRGMFPSMSARQFISETDVSAAYG 73

Query: 308 REPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           R   P+   YAP I+  D A EG D  V+ LR+G     L   +K D      ++    E
Sbjct: 74  RALRPEQYQYAPKILTVDPAWEGDDEFVIGLRQGLSFRVLHTMAKNDNDLVAAQVIARYE 133

Query: 366 KYR-PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL 424
                DA+ +DA   G       + +G     V     ++D   C N+R E+     DWL
Sbjct: 134 DEEGADAVFVDA-GFGTGIVSAGKSMGRDWTLVWFAGNSMDAG-CLNKRAEMWRDARDWL 191

Query: 425 EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
           +    I    ++++       +    G++ IESK   + +G  S + +D L+ +FA    
Sbjct: 192 KSGGAIPDDPVLRDELQAPEIVPRLDGKIQIESKKEMKARGVPSPNRADALILSFAYPVT 251

Query: 482 RSD 484
           R D
Sbjct: 252 RRD 254


>gi|154175204|ref|YP_001409090.1| Ppx/GppA family phosphatase [Campylobacter curvus 525.92]
 gi|112803006|gb|EAU00350.1| phosphatase, Ppx/GppA family [Campylobacter curvus 525.92]
          Length = 433

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 121/258 (46%), Gaps = 24/258 (9%)

Query: 236 KFYEIFNKPL---DDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQ 291
           +F+++ ++ +    DW  FQI +     +     + +IA  G +DSDV + E+ G+F   
Sbjct: 161 RFFDLASRGMRNEKDWVNFQISSFENPLLRKEEIDELIAELGGVDSDVVKQEIYGEFLDT 220

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--- 348
             ++  PL+ IE A  +    +P A  I G D+A +G D +V+ +R G  +++L  +   
Sbjct: 221 TTNALFPLSQIEAAFGKVRAYEPNAVQIWGLDVARDGDDESVLCVREGYHVKNLEGFRIA 280

Query: 349 SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL-EM-LGYHVYRVLGQKRAVDL 406
           S T+L     +   + EK +P+AI ID+   GA T D L E  LG          +A + 
Sbjct: 281 STTELAREIYRRYEMSEK-KPEAIFIDSVGVGAGTFDRLCEFGLGAICREAKASYKATNE 339

Query: 407 EFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSL--------KSFIVPNTGELAIESK 458
               N+R E++  + +     ++  H  L + L+ +        +  I+P       E K
Sbjct: 340 AKFANKRAEMYFALKEKFHLLTMNAHEKLKKQLQMIEFQYDRKERYLILPKD-----ELK 394

Query: 459 RVKGAKSTDYSDGLMYTF 476
           +  G  S DY+D L  TF
Sbjct: 395 KEYGT-SPDYADALALTF 411


>gi|119386463|ref|YP_917518.1| PBSX family phage terminase large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377058|gb|ABL71822.1| phage terminase, large subunit, PBSX family [Paracoccus
           denitrificans PD1222]
          Length = 441

 Score = 75.1 bits (183), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 92/206 (44%), Gaps = 19/206 (9%)

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG------ 339
           G +  +    FI   ++ EA+ R+P       L++G D+A  G D +V+  RRG      
Sbjct: 214 GDYEAESDMQFIGGGLVREAMARQPFSQIGDELVLGVDVARFGDDRSVIWARRGRDAQTE 273

Query: 340 -PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV- 397
            P+I         D      ++   +++  PD + ID    G    D    +GY V  V 
Sbjct: 274 LPIIMK-----GADTMAVAARVMAEIDRLHPDGVFIDEGGVGGGVIDRCRQMGYSVVGVN 328

Query: 398 LGQK--RAVD-LEFCRNRRTELHVKMADWLEFASLINHS-GLIQNLKS-LKSFIVPNTGE 452
            G K  RA++ +  CRN+R ++   M +WL     I  S  L  +L   L SF V N  E
Sbjct: 329 FGGKADRAIEGVPKCRNKRAQMWATMREWLRSGGCIPDSRDLEMDLTGPLYSFDVNNAIE 388

Query: 453 LAIESK-RVKGAKSTDYSDGLMYTFA 477
           +  +S  + +G  S D +D L  TFA
Sbjct: 389 IEKKSDMKKRGVSSPDEADALALTFA 414


>gi|56266666|gb|AAV84947.1| DNA pacase B subunit [Enterobacteria phage D6]
          Length = 502

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/345 (25%), Positives = 144/345 (41%), Gaps = 44/345 (12%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +    +
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           H +      L    +Y        GI    +  +C+ Y     +   G H  + + +I D
Sbjct: 116 HGWLQTYFVLSDTMFYE---RSRKGI----WEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-------NKPLDDWKRF 251
           EASG  D     + G LTE + NR  +M S P R SG FY+         + P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEED-NRM-LMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            +++     + P F +  +  Y G DS    V+V GQFP++     +  +  + A  R+ 
Sbjct: 226 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRAARRKV 285

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI---SGLV--- 364
             +     +   D+   G D +V+ + +  V  H     +   R  N K+   SG +   
Sbjct: 286 LLEKNWGWVATADVG-NGRDKSVLNICK--VSGH-----RDKRRVVNFKVMEMSGTMDPL 337

Query: 365 ------------EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
                       EKY    I +DA+  G+ TC  L   G +  R+
Sbjct: 338 AFADFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRI 382


>gi|303257560|ref|ZP_07343572.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
 gi|302859530|gb|EFL82609.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
          Length = 330

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 90/202 (44%), Gaps = 6/202 (2%)

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--APLIMGCDIAEEGGDNTVVVLRR 338
           R E    F     +  IP++ I  A N+      Y  APLI G D+A  G D +V+  RR
Sbjct: 95  RQEFLCDFSAAQDNGLIPIDDIRAAANKFYRESEYMGAPLIYGIDVARFGSDASVIFKRR 154

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
           G V        K D     ++I+  + K +PDA+ ID +  G    D L  + + V  V 
Sbjct: 155 GLVAFEPIVIRKFDNMALADRIAVEMAKEKPDAVFID-SGAGQGVIDRLRQMRFDVVEVP 213

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK 458
              +A+D E   NRR E+   MA W++    I    ++Q      ++     G   +E+K
Sbjct: 214 FGAQAIDKEQFANRRMEMWWHMAQWIKQGGAIPPDPVLQGDLGAPTYGYTPKGPKILEAK 273

Query: 459 ---RVKGAKSTDYSDGLMYTFA 477
              + +  +S D +D L  TFA
Sbjct: 274 DKLKERIGRSPDLADALALTFA 295


>gi|216906085|ref|YP_002333619.1| terminase [Abalone shriveling syndrome-associated virus]
 gi|216263178|gb|ACJ72002.1| terminase [Abalone shriveling syndrome-associated virus]
          Length = 507

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 109/450 (24%), Positives = 182/450 (40%), Gaps = 46/450 (10%)

Query: 54  WQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICL 113
           WQLE ++ + A      ++    V   A+S G G GKT L+  L +W     PG     L
Sbjct: 51  WQLEIVDYI-AKFFRKNSDEKHFVCAIAVSGGNGTGKTKLSKALNIWRFCCHPGSRQFIL 109

Query: 114 ANSETQLK----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
            NSE Q K    T L   +SK LS +       ++S + + +P  +D        D    
Sbjct: 110 TNSERQTKRTGFTMLVRRISKLLSCIA-----ALESSAYYYSPAVADKPEVRTN-DMWDV 163

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
           + + ++ +E       G H+   M    DE++   D +   +    T+     F   T N
Sbjct: 164 TYLLQSSTEA---ALSGLHHPM-MTFSFDESTYFNDHVWQALENMWTQGQVLCF--CTGN 217

Query: 230 PRRLSGKFY-EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR-------YGLDSDVTR 281
           P   +  ++  +FNK L       + TR V  ++        AR       YG       
Sbjct: 218 PSHDNNNYFARLFNKSLHKKDSLWL-TRCVSLLELPLKYRNDARARYIEEHYGKTHPRYI 276

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREPCPD-PYAPLIMGCD--IAEEGGDNTVVVLRR 338
             V GQFP+++  +   +  I EA+ RE   +  + P+IMG D  I+   G  + + +R 
Sbjct: 277 ASVLGQFPKKNTCNPFDITAISEAMEREVREEFIHHPVIMGIDVSISANNGSASAICVRE 336

Query: 339 GPVIEHLFDW--SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL-----EMLG 391
           G  +  L ++    T+ R    K+  L+++ +P  +++DAN  G    + L     E   
Sbjct: 337 GTAVRVLREYRCHYTEFRI---KLLELLQEIKPTIVVVDANGVGFGLYEELHRTLPETSN 393

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASLINHSGLIQNLKSLKSFIVPN 449
             VY V     A       ++ +EL  K ++W   E  S+  +   +  L SL       
Sbjct: 394 VRVYGVRAHAEAFLKSEYADKMSELAKKSSEWFNNELVSIPKNYQFLNALTSLS--FADA 451

Query: 450 TGELAIESKRVKGAK---STDYSDGLMYTF 476
           +G++ +  K     K   S D +D    TF
Sbjct: 452 SGKIKLIGKTDAKKKVDLSMDMADAFFLTF 481


>gi|323179619|gb|EFZ65182.1| terminase B protein [Escherichia coli 1180]
          Length = 453

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 142/345 (41%), Gaps = 44/345 (12%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +    +
Sbjct: 7   RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 66

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           H +      L    +Y        GI    +  +C+ Y     +   G H  + + +I D
Sbjct: 67  HGWLQTYFVLSDTMFYE---RSRKGI----WEVLCKGYRLGNEEALAGEHAAH-LLLILD 118

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-------NKPLDDWKRF 251
           EASG  D     + G LTE + NR  +M S P R SG FY+         + P   W   
Sbjct: 119 EASGISDKAIGVMTGALTEED-NRM-LMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 176

Query: 252 QIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            +++     + P F +  +  Y G DS    V+V GQFP++     +  +  + A  R+ 
Sbjct: 177 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRAARRKV 236

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL------- 363
             +     +   D+   G D +V+ + +  V  H     +   R  N K+  +       
Sbjct: 237 LLEKNWGWVATADVG-NGRDKSVLNICK--VSGH-----RDKRRVVNFKVMEMPGTMDPL 288

Query: 364 -----------VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
                       EKY    I +DA+  G+ TC  L   G +  R+
Sbjct: 289 AFADFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRI 333


>gi|323948959|gb|EGB44853.1| terminase B protein [Escherichia coli H252]
          Length = 502

 Score = 73.6 bits (179), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 18/221 (8%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +    +
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           H +      L    +Y        GI    +  +C+ Y     +   G H  + + +I D
Sbjct: 116 HGWLQTYFVLSDTMFYE---RSRKGI----WEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-------NKPLDDWKRF 251
           EASG  D     + G LTE + NR  +M S P R SG FY+         + P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEED-NRM-LMLSQPTRPSGYFYDSHHSRAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDPSF-HEGIIARYGLDSDVTRVEVCGQFPQQ 291
            +++     + P F  E ++   G DS    V+V GQFP++
Sbjct: 226 VLNSEESPFVTPQFIKEKLLEYGGRDSIEYMVKVLGQFPRE 266


>gi|322656964|gb|EFY53248.1| DNA packaging protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
          Length = 411

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 18/221 (8%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +    +
Sbjct: 56  RTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWANAVKR 115

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
           H +      L    +Y        GI    +  +C+ Y     +   G H  + + +I D
Sbjct: 116 HGWLQTYFVLSDTMFYE---RSRKGI----WEVLCKGYRLGNEEALAGEHAAH-LLLILD 167

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-------NKPLDDWKRF 251
           EASG  D     + G LTE + NR  +M S P R SG FY+         + P   W   
Sbjct: 168 EASGISDKAIGVMTGALTEED-NRM-LMLSQPTRPSGYFYDSHHSQAKTPDNPKGIWTAI 225

Query: 252 QIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQ 291
            +++     + P F +  +  Y G DS    V+V GQFP++
Sbjct: 226 VLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPRE 266


>gi|269119479|ref|YP_003307656.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
 gi|268613357|gb|ACZ07725.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
          Length = 499

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 107/476 (22%), Positives = 189/476 (39%), Gaps = 81/476 (17%)

Query: 58  FMEVVDAHCLNSVNNPNPEVF----KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICL 113
           F ++++ H L+       + F    + ++ AG   GK++L   L  + + TRP   VI  
Sbjct: 22  FKDILNFHFLSEDQTRVLQAFNEYRRLSVPAGHSTGKSSLAGGLTTYWLITRPKSRVIVT 81

Query: 114 ANSETQLKTTLWAEVSK--------WLSLLP-------------NKHWFEMQSLSLHPAP 152
           A +  QLKT  WAEV+K         L+L                + WF +   +  P  
Sbjct: 82  APTYRQLKTIYWAEVNKIYNRSKLKQLNLFEINDKIMRINDKDLKREWFALPVTASTPEG 141

Query: 153 WYS---------DVLHCSLGI----DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
                       + +   LGI    D +    + +    E+    +   +   + ++ DE
Sbjct: 142 MQGQHGDKTEVIEQIMKHLGIEEIGDDETIEIVSQILRGEKQIEGLTKEDKEKLLVMVDE 201

Query: 200 ASGTPDVI----------NLGILGFLTERNANRFWIMTSNPRRLSGKFYEI----FNKPL 245
           +SG  + I           L + G +T +N   F+    NP+    KFY++    +N P 
Sbjct: 202 SSGVKNEIFEVLEGTDYDKLVLFGNMT-KNTGYFYESVYNPK---SKFYKVTMSSYNSPF 257

Query: 246 DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
              K+ QI            H+ +   YG DS+V RV + G+ P  + +S    N I+ A
Sbjct: 258 --MKKEQI------------HD-LEETYGPDSNVVRVRLKGEAPDGNENSIFSSNKIDSA 302

Query: 306 LNREPCPDPYAPLIMGCDIAE-EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV 364
             R      Y  + +G D+ +  GGD++ +  ++   +    D     L     +I    
Sbjct: 303 FQRSLSLSEYETIKLGVDVGKGSGGDSSTIYEKKDNRVRKKLDRKDFTLPDVKREIIQYC 362

Query: 365 EKYRPDAIIIDANNTGART-----CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
            K R   II + + TG  T      +  E+    V  +    +A + +   N+RTE++ +
Sbjct: 363 YKNRDKLIIANIDGTGLGTGLVQELEEGEIENLVVNDIQFAGKAKNKKEFNNKRTEMYFE 422

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK-RVKG--AKSTDYSDGL 472
           ++  L+   L     L + L  ++ +   N G   + SK ++K     S D SD L
Sbjct: 423 LSRNLDKLDLEEDQELKREL-LIQIYEFDNNGRFKLISKDKIKEMLGHSPDKSDAL 477


>gi|153951273|ref|YP_001397540.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|153951467|ref|YP_001398214.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938719|gb|ABS43460.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938913|gb|ABS43654.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 430

 Score = 71.2 bits (173), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 107/256 (41%), Gaps = 20/256 (7%)

Query: 237 FYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARY-----GLDSDVTRVEVCGQFP 289
           FYE+  K L D  WK FQ  +      +P   E  I        G  SDV R E+ G+F 
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYD----NPFLKEEQIKELIEEVGGESSDVVRQEIYGEFI 219

Query: 290 QQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
                    L+ IE A+++            I G D+A  G D +V+  R+G VI+ L  
Sbjct: 220 DSSSAELFSLSGIENAMSKNSFSTQKMQGENIWGLDVARYGDDKSVLAKRKGFVIDELKK 279

Query: 348 WSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
           +S+       NKI    ++   +P  I ID    G    D L   G  V+       A  
Sbjct: 280 YSQLGTIELANKILAEYKQSEEKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATS 339

Query: 406 LEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKG 462
            ++  N+R +++   A  L+   L+    L  +++ ++ +   + G L I SK   +   
Sbjct: 340 NQYL-NKRAQMYFTFAKNLKHMELVKDEELKNDMRRIE-YEYSDKGLLKIVSKEQLKKNY 397

Query: 463 AKSTDYSDGLMYTFAE 478
            KS D SD +  TF E
Sbjct: 398 GKSPDLSDAVALTFFE 413


>gi|304399103|ref|ZP_07380971.1| DNA packaging protein [Pantoea sp. aB]
 gi|304353343|gb|EFM17722.1| DNA packaging protein [Pantoea sp. aB]
          Length = 503

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 115/275 (41%), Gaps = 37/275 (13%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
           +E F    +WQ E         +NSV     +     +++G G GK++L A ++L  M  
Sbjct: 32  VELFGMIPTWQQE-------EIMNSVQETGSQT---TVTSGHGTGKSSLTAMMLLIYMIM 81

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
            P   VI +AN   Q+KT ++  V  + +    +H +     +L    +Y        GI
Sbjct: 82  YPDARVIIVANKIGQVKTGVFKYVKTYWANAARRHPWLQNYFTLTDTMFYE---KSRKGI 138

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
               +  +C+ Y     +   G H  + + I+ DEASG  D     + G LTE + NR  
Sbjct: 139 ----WEVLCKGYRLGNEEALAGEHAAHILLIL-DEASGISDKAIAIMRGALTEED-NRM- 191

Query: 225 IMTSNPRRLSGKFYEIF-------NKPLDDWKRFQIDTRTVEGIDPSF-HEGIIARYGLD 276
           +M S P R SG FY+         + P   W    +++     +   F  E ++   G D
Sbjct: 192 LMMSQPTRPSGYFYDSHHSLARHPDNPNGFWNAIVLNSEEAPHVTLKFIREKLVEYGGRD 251

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           S    V+V G+FP+         N+    L R+ C
Sbjct: 252 SLEYMVKVLGRFPR---------NVSGYLLGRDEC 277


>gi|283956317|ref|ZP_06373797.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792037|gb|EFC30826.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 430

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 107/256 (41%), Gaps = 20/256 (7%)

Query: 237 FYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARY-----GLDSDVTRVEVCGQFP 289
           FYE+  K L D  WK FQ  +      +P   E  I        G DS+V + E+ G+F 
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYD----NPFLKEEQIKELIEEVGGEDSEVVKQEIYGEFI 219

Query: 290 QQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
                    L  IE A+++            I G D+A  G D +V+  R+G +++ +  
Sbjct: 220 DSSSAELFALTEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSVLAKRKGFIVDEIKK 279

Query: 348 WSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
           +S+       N+I     +   +P  I ID    G    D L   G  V+       A  
Sbjct: 280 YSQLGTMELANRILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATS 339

Query: 406 LEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKG 462
            E+  N+R +++   A  L+   L+    L ++++ ++ +   + G L I SK   +   
Sbjct: 340 NEYL-NKRAQMYFTFAKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVSKEQLKKNY 397

Query: 463 AKSTDYSDGLMYTFAE 478
            KS D SD +  TF E
Sbjct: 398 GKSPDVSDAVALTFFE 413


>gi|212703250|ref|ZP_03311378.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
 gi|212673294|gb|EEB33777.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
          Length = 330

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 94/216 (43%), Gaps = 12/216 (5%)

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--PLIMGCDIAEEGG 329
           R  L  +  R E+   F     D  IPL  + EA  R+   D     P+I+G D+A  G 
Sbjct: 79  RRELSDNAFRQEMLCDFTASSDDILIPLPDVLEAEARQLAWDDVGGMPVILGVDVARFGA 138

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           D++V+V R+G  ++        D     ++++  + + RP A+ IDA   G    D L  
Sbjct: 139 DSSVIVRRQGLKVDGPVVMRGLDNMQLADRVAAAIMENRPHAVFIDAGQ-GQGVIDRLRQ 197

Query: 390 LGYHVYRV-LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSG----LIQNLKSLKS 444
           LG+ V  V  G K   +  F  NRR+E+   +  WL+    +   G     ++   S   
Sbjct: 198 LGHEVIEVPFGGKPLQEGRFA-NRRSEMWYGLRQWLKSGGKLPDEGDDVPRLRAELSAPL 256

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           +     G + +E K   + +   S D +D L  TFA
Sbjct: 257 YWYDAAGRMVLEPKDKIKERLGASPDIADALALTFA 292


>gi|315929403|gb|EFV08605.1| phosphatase, Ppx/GppA family [Campylobacter jejuni subsp. jejuni
           305]
          Length = 430

 Score = 63.9 bits (154), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 104/256 (40%), Gaps = 20/256 (7%)

Query: 237 FYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARY-----GLDSDVTRVEVCGQFP 289
           FYE+  K L D  WK FQ  +      +P   E  I        G  S+V + E+ G+F 
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYD----NPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFI 219

Query: 290 QQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
                    L+ IE A+++            I G D+A  G D + +  R+G VI  +  
Sbjct: 220 DSSSAELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKK 279

Query: 348 WSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
           +S+       NKI     +   +P  I ID    G    D L   G  V+       A  
Sbjct: 280 YSQLGTIELANKILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATS 339

Query: 406 LEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKG 462
            E+  N+R +++   A  L+   L     L ++++ ++ +   + G L I SK   +   
Sbjct: 340 NEYL-NKRAQMYFTFAKNLKHMELFKDEELKKDMRMIE-YEYSDKGLLKIVSKEYLKKNY 397

Query: 463 AKSTDYSDGLMYTFAE 478
            KS D SD +  TF E
Sbjct: 398 GKSPDVSDAVALTFFE 413


>gi|57237579|ref|YP_178593.1| terminase B protein, putative [Campylobacter jejuni RM1221]
 gi|57166383|gb|AAW35162.1| terminase B protein, putative [Campylobacter jejuni RM1221]
          Length = 430

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 105/252 (41%), Gaps = 12/252 (4%)

Query: 237 FYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYGLD-SDVTRVEVCGQFPQQDI 293
           FYE+  K L D  WK FQ  +     +     + +I   G + S+V + E+ G+F     
Sbjct: 164 FYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFIDSSS 223

Query: 294 DSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT 351
                L+ IE A+++            I G D+A  G D + +  R+G VI  +  +S+ 
Sbjct: 224 AELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKKYSQL 283

Query: 352 DLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
                 NKI     +   +P  I ID    G    D L   G  V+       A   E+ 
Sbjct: 284 GTIELANKILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSNEYL 343

Query: 410 RNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
            N+R +++      L+   L+    L ++++ ++ +   + G L I SK   +    KS 
Sbjct: 344 -NKRAQMYFTFTKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVSKEQLKKNYGKSP 401

Query: 467 DYSDGLMYTFAE 478
           D SD +  TF E
Sbjct: 402 DVSDAVALTFFE 413


>gi|168467778|ref|ZP_02701615.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|195629119|gb|EDX48493.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
          Length = 494

 Score = 61.2 bits (147), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 88/381 (23%), Positives = 154/381 (40%), Gaps = 59/381 (15%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F    +WQ +         + SV  P     K ++S+G G GK+ + + +++  +   PG
Sbjct: 30  FGKTPTWQQD-------QIIESVQEPGS---KTSVSSGHGTGKSDMTSIMIMLFIIMFPG 79

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
              I +AN   Q+ T ++    K+L +    +W    S +    PW ++    +   D+ 
Sbjct: 80  ARAIIVANKIQQVMTGIF----KYLKI----NW----STATSRFPWLAEYFVLT---DTS 124

Query: 168 HYSTMCRTYSEERPDTF--------VGHHNTYGMAIINDEASGTPDVINLGILGFLTERN 219
            Y    +      P  F         G H  + + II DEASG  D     + G LT ++
Sbjct: 125 FYEITSKGVWTVVPKGFRLGNEEALAGEHADHLLYII-DEASGVSDKAFGIMTGALTGKD 183

Query: 220 ANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDPSFHEGIIAR 272
            NR  ++ S P R SG FY+  +K       P   +    +++     + P F +  +A 
Sbjct: 184 -NRI-LLLSQPTRPSGYFYDTHHKLAKRPGNPNGIYTAITLNSEESPLVTPEFIKMKLAE 241

Query: 273 Y-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIA-EEGGD 330
           Y G DS +  ++V G FP+      +  + +E A  R+         I   D+A   G D
Sbjct: 242 YGGRDSPMYLIKVRGLFPKTQDGFLLGRDEVERASRRKVKIAKGWGWIACVDVAGGTGRD 301

Query: 331 NTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDAIIIDANNTG 380
            +V+ +        +R  +   + ++S         KI+     ++Y    I+ID +  G
Sbjct: 302 KSVINIMMVSGERNKRRIIGYRIIEYSDVTETQLAAKINAECSPDRYPNITIVIDGDGLG 361

Query: 381 ARTCDYLEMLGYHVYRVLGQK 401
             T D L    Y  Y +  Q+
Sbjct: 362 KSTADLL----YDNYGITAQR 378


>gi|282598783|ref|YP_003359102.1| putative large subunit terminase [Clavibacter phage CMP1]
 gi|262212571|gb|ACY35907.1| putative large subunit terminase [Clavibacter phage CMP1]
          Length = 872

 Score = 60.8 bits (146), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 132/339 (38%), Gaps = 49/339 (14%)

Query: 183 TFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           +F G H+ + +A++ DEA G P+ + +G     T  +A    I   NP + +  F+E F 
Sbjct: 511 SFQGIHDGH-VAVVLDEAGGLPEDLYIGANAVTTNFHARILAI--GNPDKRNTPFHERFT 567

Query: 243 --KPLDDWKRFQI---DTRTVEGI----DPSFHE-----------GIIARYGLDSDVTRV 282
             +    W RF I   DT    G     DP+  E            +  R      V   
Sbjct: 568 DTEKFSSWNRFTIGAEDTPNFTGEKIYEDPAKDEDVKKHLVQVSWAVEMRKSARPSVVAA 627

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVI 342
           +V G FP+ D  +F   ++I    + E  P+      MG DI+ +G D +V  +  G  I
Sbjct: 628 KVDGNFPESDDTTFFDQSVINRGYSTEIEPESTDFKYMGVDISYQGEDQSVAYINHGGQI 687

Query: 343 EHLFDWSKTD--------LRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--- 391
               +W++ D        +R  N      V++ R     ID   TGA     L+ML    
Sbjct: 688 RIADEWNRFDGAEHIESAIRIHNKACQEGVQEVR-----IDMAGTGAGVYSNLKMLDQFK 742

Query: 392 ---YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKSF 445
              Y +  V G  R  +     N R   + +    L    +   I    L + ++ L+  
Sbjct: 743 DKPYVLIGVNGANRTPNSNRWLNARAWHYDQFRTGLITGKIDITITDVDLKKEME-LQPS 801

Query: 446 IVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
              N G+L I  K   R  G  S D+ D  +Y+  +  P
Sbjct: 802 TFTNRGQLQITRKDDMRKMGISSPDHLDAAIYSAIDTTP 840


>gi|148653111|ref|YP_001280204.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
 gi|148572195|gb|ABQ94254.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
          Length = 520

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 94/445 (21%), Positives = 178/445 (40%), Gaps = 60/445 (13%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           + ++++G G GK+     + LW +   P   ++  A    QL+T +W E++  L  L N 
Sbjct: 57  RTSVASGHGTGKSRSAGIIALWHLLFYPESVMLFTAPQIGQLRTVVWKEINICLQRLRNN 116

Query: 139 HWFEMQSLSLHPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGM 193
                         W +D V+  +  I  K +        +T  + +P    G H  + M
Sbjct: 117 ----------KALGWLADYVVVLAEKIYIKGFKDTWFVFAKTAPKHQPTNIAGQHGDHYM 166

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL----DDWK 249
            +  DEA G  D +    +G LT  N NR  ++TS P + +G FY+  +K        W 
Sbjct: 167 -VWADEACGIDDAVMEVAIGALTHEN-NRA-VLTSQPAKNTGFFYDTHHKLSHHNGGKWT 223

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
             + +      +        + +YG  +S    + + G+FP+     ++      E + +
Sbjct: 224 ALEFNGEMSPIVSKDKLIEALYQYGSRNSPGYLIRIRGKFPELK-GEYLLTRTDYENMKQ 282

Query: 309 EPC----PDPYAPLIMGCDIAEEGGDNTVVV--------LRRGPVIEH-------LFDWS 349
           +PC     D +  +I+  D+  + G ++ V+        + +G +  H       LF  +
Sbjct: 283 QPCVIEEGDKWG-IIVAVDVGGDVGRDSSVISVMQVVDKMIKGRIERHVHLLDIPLFS-N 340

Query: 350 KTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
           + ++ T   KI+ ++  Y    ++ID    G      L+  G +   V       +    
Sbjct: 341 RANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQSLKADGVYFDEVHWGSPCFNNTLK 400

Query: 410 R---NRRTELHVKMADWLE---FASLINHSGLIQNLKSLKS------FIVPNTGELAIES 457
           R   N+R+  +V MA  +E   F+       + Q + +L+       +         + S
Sbjct: 401 RYYMNKRSHAYVSMAKAVEKGYFSVSDKVKKMYQVMTNLEEQMTRLPYYFDEKARWCMMS 460

Query: 458 KR---VKGAKSTDYSDGLMYTFAEN 479
           K+    KG KS D +D + + F EN
Sbjct: 461 KKDMLKKGIKSPDIADTIAFGFMEN 485


>gi|226227228|ref|YP_002761334.1| hypothetical protein GAU_1822 [Gemmatimonas aurantiaca T-27]
 gi|226090419|dbj|BAH38864.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 549

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 107/462 (23%), Positives = 179/462 (38%), Gaps = 67/462 (14%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK-WLSLLPNKH 139
           A+++G G GKT L A L+LW ++  P      +A    Q +  +W EV++ W        
Sbjct: 71  AVASGTGTGKTFLEAVLLLWWIAVEPDSIATTVATKADQQEKGIWREVARHWPRFQACFP 130

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
             E+ +L +   PW  D    + GI      T      EE      G H    + I+ DE
Sbjct: 131 EAELTTLRIRMEPWRGDAWG-AWGI------TAAPKAGEESSSAVQGLHAKR-LLILVDE 182

Query: 200 ASGTPDVINLGILGFLT-ERNANRFWIMTSNPRRLS---GKFYEIFNKPLDDWKRFQID- 254
             G P  +   ++   T E N    +    NP   +   G+F E   K +   +   +D 
Sbjct: 183 TPGVPQPVMTALVNTATGEENVIAAF---GNPDYQADPLGQFAE--TKRVTAIRISALDH 237

Query: 255 ---TRTVEGIDPSFHEGIIA----RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN 307
                 VE I  +     IA    +YG++S V +  V G  P+Q   + I L     A +
Sbjct: 238 PNVVLGVERIPGAATRLSIATREDKYGVESGVYQSRVRGIAPEQSASALIHLAWCVAAAD 297

Query: 308 REPCPDPYA----PLIMGCDIAE-EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           R       A    P  +G D+A+ E GD   V + +G  +  +   +  +      ++  
Sbjct: 298 RAESVQHAALALGPKALGVDVAQSENGDKAAVAMGQGARLLSVIAKACPNATKLGAEVWQ 357

Query: 363 LV--EKYRPDAIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVD--------- 405
           L+  E   P+ + +D    GA T ++L      E  G  V R  G  +A++         
Sbjct: 358 LMRDEGIVPEYVGVDPIGVGAATVNHLDGECEKENAGRSVVRCSGGAKAMEASSRAADGS 417

Query: 406 -LEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNT-------GELAIES 457
            +E+  +     +++   W +    + + GLI   +  + F    T       G + +ES
Sbjct: 418 AMEWLADANKFKNLRAQMWWQLREDLRN-GLIALPRDRELFRELTTVQFDEDGGIVTLES 476

Query: 458 K---RVKGAKSTDYSDGLMY-------TFAENPPRSDMDFGR 489
           K   R +  +S D +D ++Y       T    PP    D  R
Sbjct: 477 KDDIRKRLGRSPDRADAVVYWNWVRPRTRVNQPPPEGFDVAR 518


>gi|299769795|ref|YP_003731821.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
 gi|298699883|gb|ADI90448.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
          Length = 668

 Score = 58.5 bits (140), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 101/432 (23%), Positives = 163/432 (37%), Gaps = 61/432 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     E    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSKQSLEEQRQKYGSRDDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            I+  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YIITVDVGGGVGRDDSVIVISKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA-D 422
           + +Y    +++D N  G     YL+  G     V    +     F  + R E   K +  
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQC----FSNDNRKEFTNKRSLA 552

Query: 423 WLEFASLINHSGLIQNLKSLKSFI--------VPNTGE-------LAIESKRVKGAKSTD 467
           ++ FA  +  SG  + +K+ K ++        +P   +       L+ +  R  G KS D
Sbjct: 553 YVGFARAVA-SGRFK-MKTKKHYVKIKDQLIHIPYRFDDFARYKILSKDEMRRMGIKSPD 610

Query: 468 YSDGLMYTFAEN 479
             D   + F EN
Sbjct: 611 LGDAFAFLFLEN 622


>gi|323516996|gb|ADX91377.1| hypothetical protein ABTW07_0941 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|323518424|gb|ADX92805.1| hypothetical protein ABTW07_2381 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 663

 Score = 56.6 bits (135), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 125/328 (38%), Gaps = 39/328 (11%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     E    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSKQSLEEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            ++  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YVITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
           + +Y    +++D N  G     YL+  G
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQG 524


>gi|256392042|ref|YP_003113606.1| hypothetical protein Caci_2856 [Catenulispora acidiphila DSM 44928]
 gi|256358268|gb|ACU71765.1| conserved hypothetical protein [Catenulispora acidiphila DSM 44928]
          Length = 484

 Score = 56.6 bits (135), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 93/443 (20%), Positives = 161/443 (36%), Gaps = 77/443 (17%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRP--GISVICLANSETQLKTTLWAEVSKWLSL---- 134
           A+ +  G GK+ + + L  W + T P     V+  A +  Q+K  LWAE++K  +     
Sbjct: 58  AVQSCHGTGKSFVASRLTAWWLDTHPPGEAFVVTTAPTGDQVKAILWAEINKAFAKAEAR 117

Query: 135 ---LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
              LP +         ++   W  D    + G          R  S+  P  F G H  Y
Sbjct: 118 GTPLPGR---------INETDWKYDKFLVAFG----------RKPSDYNPHAFQGIHAKY 158

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF 251
            + I+ DEA G         L   T  +     I   NP      F ++     D W   
Sbjct: 159 VLVIL-DEACGISKQFWTAALAIATGVHCRILAI--GNPDDPGSHFAQVCKS--DRWNMI 213

Query: 252 QIDTR-----TVEGIDPSFHEGIIAR---------YGLDSDVTRVEVCGQFPQQDIDSFI 297
           +I  R     T E +     + ++++         +G +S +   +V  +FP    D  +
Sbjct: 214 KIAARDTPNFTGEEVPDDLADMLVSQAYVLDMAEEFGPESPIYLSKVDAEFPSDASDGVV 273

Query: 298 PLNIIEEALNREP----CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL 353
            L+ +  A  REP     PD   P+ +G D+   GGD T +  RRG      +   + D 
Sbjct: 274 RLSKL-MACTREPVHPYAPDRLVPVELGVDLG-AGGDETCIRERRGIAAGREWRNREKDS 331

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM---LGYHVYRVLGQKRAVDLEFCR 410
               + I   + +     + +D+   G      L+     G H   V+G   +   E   
Sbjct: 332 EKVVDHIVRAIRETGATKVKVDSIGIGWGIVGSLQARRKQGLHTAEVVGVNVS---EAST 388

Query: 411 NRRTELHVKMADWLEFASLINHSG--------------LIQNLKSLKSFIVPNTGELAIE 456
                  ++   W E    ++  G              L+  L + K + +  +G + +E
Sbjct: 389 QPEKYARLRSQIWWEVGRKLSEDGGWDLSQLDTTDRDRLVSQLTAPK-YDLDASGRIVVE 447

Query: 457 SK---RVKGAKSTDYSDGLMYTF 476
            K   + +  +S D +D L+  F
Sbjct: 448 KKEETKKRIGRSPDNADALLLAF 470


>gi|312964323|ref|ZP_07778627.1| terminase B protein [Escherichia coli 2362-75]
 gi|331655801|ref|ZP_08356790.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
 gi|312291036|gb|EFR18910.1| terminase B protein [Escherichia coli 2362-75]
 gi|323186470|gb|EFZ71817.1| terminase B protein [Escherichia coli 1357]
 gi|323969205|gb|EGB64507.1| terminase B protein [Escherichia coli TA007]
 gi|325495624|gb|EGC93488.1| DNA pacase B subunit [Escherichia fergusonii ECD227]
 gi|331046575|gb|EGI18664.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
          Length = 494

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 139/340 (40%), Gaps = 32/340 (9%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPN 137
           K ++S+G G GK+ + + +++  +   PG   I +AN   Q+ T ++  +   W +    
Sbjct: 51  KTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSR 110

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
             W       L    +Y         +  K +    R  SEE      G H  + + II 
Sbjct: 111 FPWLA-DYFVLTETAFYEVTGKGVWTVVPKGF----RLGSEE---ALAGEHADHLLYII- 161

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKR 250
           DEASG  D     I G LT ++ NR  ++ S P R SG FY+  +K       P   +  
Sbjct: 162 DEASGVSDRAFGIITGALTGQD-NRI-LLLSQPTRPSGYFYDTHHKLAKRPGNPDGVYTA 219

Query: 251 FQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +++     + P+F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+
Sbjct: 220 ITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRK 279

Query: 310 PCPDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKI 360
                    +   D+A   G D +V+ +        +R  +   + +++         KI
Sbjct: 280 VKIAKGWGWLACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKI 339

Query: 361 SGLV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRV 397
                 E++    I ID +  G  T D + E  G  V R+
Sbjct: 340 FAECNPERFPNITIAIDGDGLGKATADLMYEYYGITVQRI 379


>gi|332974843|gb|EGK11758.1| hypothetical protein HMPREF9373_1714 [Psychrobacter sp. 1501(2011)]
          Length = 520

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/466 (20%), Positives = 183/466 (39%), Gaps = 67/466 (14%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           + ++++G G GK+     + LW +   P   ++  A    QL+T +W E++  L  L N 
Sbjct: 57  RTSVASGHGTGKSRSAGIIALWHLLFYPESVMLFTAPQIGQLRTVVWKEINICLQRLRNN 116

Query: 139 HWFEMQSLSLHPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGM 193
                         W +D V+  +  I  K +        +T  + +P    G H  + M
Sbjct: 117 ----------KALGWLADYVVVLAEKIYIKGFKDTWFVFAKTAPKHQPTNIAGQHGDHYM 166

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL----DDWK 249
            +  DEA G  D +    +G LT  N NR  ++TS P + +G FY+  +K        W 
Sbjct: 167 -VWADEACGIDDAVMEVAIGALTHEN-NRA-VLTSQPAKNTGFFYDTHHKLSHYNGGKWI 223

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
             + +      +        + +YG  +S    + + G+FP+     ++      E +  
Sbjct: 224 ALEFNGEMSPIVSKEKLIEALYQYGSRNSPGYLIRIRGKFPELK-GEYLLTRTDYENMKA 282

Query: 309 EPC----PDPYAPLIMGCDIAEEGGDNTVVV--------LRRGPVIEH-------LFDWS 349
            PC     D +  +I+  D+  + G ++ V+        + +G +  H       LF  +
Sbjct: 283 HPCVIKEGDKWG-IIVTVDVGGDVGRDSSVISVLQVVDKMVKGRIERHVHLLDIPLFS-N 340

Query: 350 KTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
           + ++ T   KI+ ++  Y    ++ID    G      ++  G +   V       +    
Sbjct: 341 RANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQSVKADGVYFDEVHWGSPCFNNTLK 400

Query: 410 R---NRRTELHVKMADWLE---FASLINHSGLIQNLKSLKS------FIVPNTGELAIES 457
           R   N+R+  +V MA  +E   F+       + Q + +L+       +         + S
Sbjct: 401 RYYMNKRSHAYVSMAKAVEKGYFSVSDKIKKMYQVITNLEEQMTRLPYYFDEKARWCMMS 460

Query: 458 KR---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDL 500
           K+    KG KS D +D + + F EN           P+  YE +++
Sbjct: 461 KKDMLKKGIKSPDIADTIAFGFMEN-------ISYAPAESYEDLNI 499


>gi|260871239|ref|YP_003238019.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
 gi|257767818|dbj|BAI39311.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
          Length = 494

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 140/338 (41%), Gaps = 32/338 (9%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKH 139
           ++++G G GK+ + + + +  +   PG  VI +AN   Q+   ++  + S W + +    
Sbjct: 53  SVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFP 112

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
           W   +   L    ++         I  K     CR+ +EE      G H  + + II DE
Sbjct: 113 WLS-KYFILTETSFFEVTGKGVWTILIKS----CRSGNEE---ALAGEHADHLLYII-DE 163

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQ 252
           ASG  D     I G LT ++ NR  ++ S P R SG FY+  ++       P   +    
Sbjct: 164 ASGVSDKAFSVITGALTGKD-NRI-LLLSQPTRPSGYFYDSHHRLAIRPGNPDGLFTAII 221

Query: 253 IDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           +++     +D  F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+  
Sbjct: 222 LNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVK 281

Query: 312 PDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISG 362
                  +   D+A   G D +V+ +        +R  +   + +++         KI  
Sbjct: 282 IAKGWGWVACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFA 341

Query: 363 LV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRV 397
               E++    I ID +  G  T D + E  G  V R+
Sbjct: 342 ECNPERFPNITIAIDGDGLGKSTADLMYERYGITVQRI 379


>gi|56266643|gb|AAV84926.1| DNA pacase B subunit [Enterobacteria phage phiW39]
          Length = 494

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 139/340 (40%), Gaps = 32/340 (9%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPN 137
           K ++S+G G GK+ + + +++  +   PG   I +AN   Q+ T ++  +   W +    
Sbjct: 51  KTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSR 110

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
             W       L    +Y         +  K +    R  SEE      G H  + + II 
Sbjct: 111 FPWLA-DYFVLTETAFYEITGKGVWTVVPKGF----RLGSEE---ALAGEHADHLLYII- 161

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKR 250
           DEASG  D     I G LT ++ NR  ++ S P R SG FY+  +K       P   +  
Sbjct: 162 DEASGVSDRAFGIITGALTGQD-NRI-LLLSQPTRPSGYFYDTHHKLAKRPGNPDGVYTA 219

Query: 251 FQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +++     + P+F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+
Sbjct: 220 ITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRK 279

Query: 310 PCPDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKI 360
                    +   D+A   G D +V+ +        +R  +   + +++         KI
Sbjct: 280 VKIAKGWGWLACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKI 339

Query: 361 SGLV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRV 397
                 E++    I ID +  G  T D + E  G  V R+
Sbjct: 340 FAECNPERFPNITIAIDGDGLGKATADLMYEYYGITVQRI 379


>gi|324111095|gb|EGC05081.1| terminase B protein [Escherichia fergusonii B253]
          Length = 494

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 139/340 (40%), Gaps = 32/340 (9%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPN 137
           K ++S+G G GK+ + + +++  +   PG   I +AN   Q+ T ++  +   W +    
Sbjct: 51  KTSVSSGHGTGKSDMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSR 110

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
             W       L    +Y         +  K +    R  SEE      G H  + + II 
Sbjct: 111 FPWLA-DYFVLTETAFYEVTGKGVWTVVPKGF----RLGSEE---ALAGEHADHLLYII- 161

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKR 250
           DEASG  D     I G LT ++ NR  ++ S P R SG FY+  +K       P   +  
Sbjct: 162 DEASGVSDRAFGIITGALTGQD-NRI-LLLSQPTRPSGYFYDTHHKLAKRPGNPDGVYTA 219

Query: 251 FQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +++     + P+F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+
Sbjct: 220 ITLNSEESPLVTPAFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRK 279

Query: 310 PCPDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKI 360
                    +   D+A   G D +V+ +        +R  +   + +++         KI
Sbjct: 280 VKIAKGWGWLACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRILEYTDVTETQLAAKI 339

Query: 361 SGLV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRV 397
                 E++    I ID +  G  T D + E  G  V R+
Sbjct: 340 FAECNPERFPNITIAIDGDGLGKATADLMYEYYGITVQRI 379


>gi|213156231|ref|YP_002318651.1| phage terminase [Acinetobacter baumannii AB0057]
 gi|301346399|ref|ZP_07227140.1| phage terminase [Acinetobacter baumannii AB056]
 gi|301594275|ref|ZP_07239283.1| phage terminase [Acinetobacter baumannii AB059]
 gi|213055391|gb|ACJ40293.1| phage terminase [Acinetobacter baumannii AB0057]
          Length = 663

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 125/328 (38%), Gaps = 39/328 (11%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     +    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            ++  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
           + +Y    +++D N  G     YL+  G
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQG 524


>gi|260551382|ref|ZP_05825582.1| phage terminase [Acinetobacter sp. RUH2624]
 gi|260405545|gb|EEW99037.1| phage terminase [Acinetobacter sp. RUH2624]
          Length = 663

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 125/328 (38%), Gaps = 39/328 (11%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     +    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            ++  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
           + +Y    +++D N  G     YL+  G
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQG 524


>gi|332852816|ref|ZP_08434408.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332871045|ref|ZP_08439658.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
 gi|332729027|gb|EGJ60377.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332731805|gb|EGJ63085.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
          Length = 663

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 125/328 (38%), Gaps = 39/328 (11%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     +    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            ++  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
           + +Y    +++D N  G     YL+  G
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQG 524


>gi|226940437|ref|YP_002795511.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715364|gb|ACO74502.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 133

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 53/126 (42%), Gaps = 23/126 (18%)

Query: 114 ANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL------HPAPWYSDVLHCSLGIDSK 167
           AN++TQL+T    EV KW  L    HWF+ QS S+      H   W +D +         
Sbjct: 4   ANTDTQLRTKTSPEVGKWQRLSITSHWFDPQSASIAARDKEHAKTWRADFV--------- 54

Query: 168 HYSTMCRTYSEERPDTFVGHHNT-YGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
                   +SE   + F G HN    + +I DEAS   D +     G LT+      WI 
Sbjct: 55  -------PWSEHNTEAFAGLHNKGKRIVLIFDEASAIADKVWEVAEGALTDEETEIIWIA 107

Query: 227 TSNPRR 232
             NP R
Sbjct: 108 FGNPTR 113


>gi|184158505|ref|YP_001846844.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
 gi|183210099|gb|ACC57497.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
          Length = 663

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 125/328 (38%), Gaps = 39/328 (11%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKT     + LW +       ++  A    QLK  +W E+S             +  L  
Sbjct: 211 GKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLARLKQ 259

Query: 149 HPAPWYSD-VLHCSLGIDSKHYS----TMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            P  W +D V + S  +  K Y        +T  + +P    G+H    M  + DEASG 
Sbjct: 260 GPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGV 318

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVE 259
            D +     G LT  + NR  +MTS P R +G FYE  +K        W     +     
Sbjct: 319 DDAVLDVAFGALTHED-NRA-VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESP 376

Query: 260 GIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-P 317
            +     +    +YG   D   ++ V G+FP    +  I     EE        D +   
Sbjct: 377 LVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFG 436

Query: 318 LIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
            ++  D+    G D++V+V+             RR  V++     ++ D+     KI+ L
Sbjct: 437 YVITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKINEL 496

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
           + +Y    +++D N  G     YL+  G
Sbjct: 497 LLQYPNANLVVDDNGAGKGLGQYLKKQG 524


>gi|46401730|ref|YP_006576.1| PacB [Enterobacteria phage P1]
 gi|301646767|ref|ZP_07246623.1| putative terminase B protein [Escherichia coli MS 146-1]
 gi|129547|sp|P27753|TERL_BPP1 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|68597607|sp|Q5XLR0|TERL_BPP7 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|33323612|gb|AAQ07582.1|AF503408_106 PacB [Enterobacteria phage P7]
 gi|215636|gb|AAA21724.1| pacB [Enterobacteria phage P1]
 gi|33338757|gb|AAQ14080.1| PacB [Enterobacteria phage P1]
 gi|33338866|gb|AAQ14188.1| PacB [Enterobacteria phage P1]
 gi|54112354|gb|AAV28854.1| PacB [Enterobacteria phage P7]
 gi|301075042|gb|EFK89848.1| putative terminase B protein [Escherichia coli MS 146-1]
          Length = 494

 Score = 54.7 bits (130), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 141/343 (41%), Gaps = 32/343 (9%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKH 139
           ++++G G GK+ + + + +  +   PG  VI +AN   Q+   ++  + S W + +    
Sbjct: 53  SVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFP 112

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
           W   +   L    ++         I  K     CR  +EE      G H  + + II DE
Sbjct: 113 WLS-KYFILTETSFFEVTGKGVWTILIKS----CRPGNEE---ALAGEHADHLLYII-DE 163

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQ 252
           ASG  D     I G LT ++ NR  ++ S P R SG FY+  ++       P   +    
Sbjct: 164 ASGVSDKAFSVITGALTGKD-NRI-LLLSQPTRPSGYFYDSHHRLAIRPGNPDGLFTAII 221

Query: 253 IDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           +++     +D  F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+  
Sbjct: 222 LNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVK 281

Query: 312 PDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISG 362
                  +   D+A   G D +V+ +        +R  +   + +++         KI  
Sbjct: 282 IAKGWGWVACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFA 341

Query: 363 LV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRVLGQKR 402
               E++    I ID +  G  T D + E  G  V R+   K+
Sbjct: 342 ECNPERFPNITIAIDGDGLGKSTADLMYERYGITVQRIRWGKK 384


>gi|225155389|ref|ZP_03723881.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
 gi|224803845|gb|EEG22076.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
          Length = 479

 Score = 53.9 bits (128), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 94/227 (41%), Gaps = 13/227 (5%)

Query: 176 YSEERPDTFVGHHNTYG--MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
           ++ +R   F G H   G  + II DEA    D I +       +R      +  S+   L
Sbjct: 129 FATDRGGRFEGFHAYPGRPLLIILDEAKSIADDIFVA-----ADRCQPTMLLYISSWGGL 183

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
            G+F++ F++  D + +FQ        I P F E + A+YG DSD+ R  + GQ P+ + 
Sbjct: 184 FGRFHDAFSQ--DRFAQFQAGIADCPHITPEFIEAMRAQYGEDSDIYRSMILGQRPKGNE 241

Query: 294 DSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW-SKTD 352
             F+   +  E     P         + CD AE   D  V+  R G  +  +  W    +
Sbjct: 242 TGFVVPFVDYERCESNPPVWQEGTKQVFCDFAET-SDECVIAKRDGNRLSIVDAWIPDGN 300

Query: 353 LRTTNNKISGLVEKYRPDAIII--DANNTGARTCDYLEMLGYHVYRV 397
                ++  G + + + +  +I  DA+ TG      L + G  +  V
Sbjct: 301 TAGITDRFEGHLRRLQNEGFVIRGDADGTGHGYITALSLRGIKISGV 347


>gi|331649955|ref|ZP_08351031.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
 gi|331041212|gb|EGI13366.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
          Length = 494

 Score = 53.1 bits (126), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 139/338 (41%), Gaps = 32/338 (9%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKH 139
           ++++G G GK+ + + + +  +   PG  VI +AN   Q+   ++  + S W + +    
Sbjct: 53  SVTSGHGTGKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFP 112

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
           W   +   L    ++         I  K     CR  +EE      G H  + + II DE
Sbjct: 113 WLS-KYFILTETSFFEVTGKGVWTILIKS----CRPGNEE---ALAGEHADHLLYII-DE 163

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQ 252
           ASG  D     I G LT ++ NR  ++ S P R SG FY+  ++       P   +    
Sbjct: 164 ASGVSDKAFSVITGALTGKD-NRI-LLLSQPTRPSGYFYDSHHRLAIRPGNPDGLFTAII 221

Query: 253 IDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           +++     +D  F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+  
Sbjct: 222 LNSEESPLVDAKFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVK 281

Query: 312 PDPYAPLIMGCDIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISG 362
                  +   D+A   G D +V+ +        +R  +   + +++         KI  
Sbjct: 282 IAKGWGWVACVDVAGGTGRDKSVINIMMVSGQRNKRRVINYRMQEYTDVTETQLAAKIFA 341

Query: 363 LV--EKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRV 397
               E++    I ID +  G  T D + E  G  V R+
Sbjct: 342 ECNPERFPNITIAIDGDGLGKSTADLMYERYGITVQRI 379


>gi|261381054|ref|ZP_05985627.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
 gi|284796087|gb|EFC51434.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
          Length = 450

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 89/194 (45%), Gaps = 35/194 (18%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           I+G D+A+EG D +  +LR G V+  + +W   D+  + +K+    ++ + D I+ D+  
Sbjct: 241 ILGFDVADEGDDASATILRHGSVVIDMDEWRGQDVIYSADKVYLYGQEAKADKIVYDSIG 300

Query: 379 TGA-------RTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW-------- 423
            GA       R    ++ +G++    + +  A   +  +N+    ++K   W        
Sbjct: 301 VGAGVKAQFRRKTGKVQTIGFNAGGSVFKPEARYTDDKKNKDMFSNIKAQAWWMVRERFY 360

Query: 424 -----LEFA------SLINHSGLIQNLKSLKSFI------VPNTGELAIESKR---VKGA 463
                +EF        LI+ SG +++L+ LK+ +        N G + +ESK+    +G 
Sbjct: 361 KTWRAIEFGDTYPIDELISISGSLKDLEYLKAELSRPRVDYDNNGRVKVESKKDMAKRGI 420

Query: 464 KSTDYSDGLMYTFA 477
            S + +D L+  FA
Sbjct: 421 PSPNRADALIMAFA 434


>gi|320103661|ref|YP_004179252.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
 gi|319750943|gb|ADV62703.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
          Length = 553

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 128/349 (36%), Gaps = 39/349 (11%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           ++ G  +GK+ L A L LW + T PG  V+  A S+  L T L+ E+ K L+    +   
Sbjct: 68  VATGNAVGKSYLAAGLTLWWLYTHPGSLVVATAPSQGLLGTVLFRELQKALA-ASRRRGL 126

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
            +  + +         L    G         C   +    +   G H+   M ++ DEAS
Sbjct: 127 GLPGMVVGSDRGTPFSLRVGPGRRLAAEGWGCLGIATRGVERLAGRHHADLMVVV-DEAS 185

Query: 202 GT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID------ 254
           G  P+         LT  N  + ++   NP      F+++  + L +     I       
Sbjct: 186 GVQPEAWE-----ALTSLNPRKLFV-CGNPLTPGTVFHKLHQRGLTEASDPSIPDHARGV 239

Query: 255 --------------TRTVEGI-DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
                          R+  G+ D  F      ++G  S +    V G FP   + + I  
Sbjct: 240 ALTIPSTASPDINLERSPRGLADRGFIREAERQWGRGSPLWLSHVEGVFPTVAVHALIEP 299

Query: 300 NIIEEALNREPCP---DPYAPLIMGCDIAEE-GGDNTVVVLRRGPVIEHLFDWSKTDLRT 355
             +++A + E      +P    ++GCD+A   G D T +V+R    I  L    +     
Sbjct: 300 GWLDQAASLERSQTYENPPGQPVLGCDLAAGVGADRTAIVVRDEGGIRELIASDRLAPDE 359

Query: 356 TNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLG---YHVYRVLG 399
               I+ L  K+   P+ I+ D    GA     L   G    H   + G
Sbjct: 360 AATLIASLARKHLIAPERILYDGAGLGAELTTRLARQGPGFVHARAIFG 408


>gi|298387330|ref|ZP_06996883.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259999|gb|EFI02870.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 500

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 93/222 (41%), Gaps = 25/222 (11%)

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP---LIMGCDIAEEGGDNTV 333
           +D+ R++V G FP+   D  IP   IE A  R     PY P     +G D+A  G DN+V
Sbjct: 264 NDLFRIKVRGMFPKVAEDVLIPYEWIEIANKRWQENHPYRPRKSCKLGVDVAGMGRDNSV 323

Query: 334 VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR---PDAIIIDANNTGARTCDYLEML 390
              R G  +   FD  ++  + ++  + G    Y+    D I ID    GA     L   
Sbjct: 324 FCPRYGNYVSQ-FDVFQSAGKASHMHVVGKALSYKRTDRDIIFIDTIGEGAGVYSRLVEQ 382

Query: 391 G----YHVYRVLGQKRAVDL--EFC-RNRRTELHVKMADWLE----FASLINHSGLIQNL 439
           G    + V    G K   D+  E+   N R  L+  + DWL+    F  ++         
Sbjct: 383 GIRNIFSVKNSQGAKGLHDITGEYSFANMRAYLYWALRDWLDPKNNFFPMLPPCDQFTEE 442

Query: 440 KSLKSFIVPNTGELAIE-----SKRVKGAKSTDYSDGLMYTF 476
            +   +   + G++ IE      KR+K  +S DY D L  TF
Sbjct: 443 ATETKWKFRSDGKILIEPKEEIKKRIK--RSPDYMDALSETF 482


>gi|186682890|ref|YP_001866086.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
 gi|186465342|gb|ACC81143.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
          Length = 543

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 143/374 (38%), Gaps = 85/374 (22%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           + A  G GK+ + + LV++ +    G++ I  A SE Q+K  LWAE+ K   L   K   
Sbjct: 64  VKAAHGTGKSFIASLLVIYFLFCVGGVA-ITTAPSEDQVKWILWAELRKIHGLHKTKLGG 122

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
               + L     +S+ ++ + GI S+ YS           ++F G H    + +I DEA 
Sbjct: 123 RCDIMQL----LFSETVY-AFGITSRDYSE----------NSFQGQHRQKQL-LIEDEAD 166

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI------------FNKPLDDWK 249
           G    I+ G +  LT   ++   +   NP     +F +             F+ P   W 
Sbjct: 167 GITPQIDNGFIACLT--GSDNRGLRIGNPVDPQSQFAKTCKLDKRCLTVSAFSHPNVSWA 224

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYG--------------------LDSD-VTRV------ 282
            +++    V  + P   E II   G                    +  D + RV      
Sbjct: 225 -YELCADGVYRLKPEVAEHIINEDGEIKPQQEWPPEFPRDRIPGAISIDWIERVRREKFE 283

Query: 283 -------EVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY-------APLIMGCDIAEEG 328
                   V G++ +   D  I L ++++A +       Y        P  +G D+  +G
Sbjct: 284 TSAYWKGRVMGEYAEDAADGIILLTLLKQARSLYDQNPQYWDAIAKRYPWRLGLDVG-DG 342

Query: 329 GDNTVVVLRRGPVI-EHLFDWSKTDLRTTN-------NKISGLVEKYRPDAIIIDANNTG 380
           GD   + L RGPV+ E     +K DL  T        ++I  L   Y   +I +D    G
Sbjct: 343 GDPHALALLRGPVLYEVQIHPTKGDLLDTERAADIAASQIKLLGTGY---SIAVDNTGVG 399

Query: 381 ARTCDYLEMLGYHV 394
           A T   L+  GY  
Sbjct: 400 AGTLAKLKKTGYQA 413


>gi|320091491|gb|ADW08983.1| terminase-like protein [Clavibacter phage CN77]
          Length = 414

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 91/236 (38%), Gaps = 47/236 (19%)

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP--LDDWKRFQI-- 253
           DEA G P  +  G    +T +++    +   NP     +F+ IF  P  +D+W  F I  
Sbjct: 51  DEAGGVPPELFTGAEAVMTGQDSK--IVAIGNPDSRGTEFHRIFTVPALMDEWNTFTISA 108

Query: 254 -DTRTVEG--------------------IDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQ 291
            D  TV G                    +D   H+  + + G   D     +V G+FP +
Sbjct: 109 YDLPTVTGEVVYPDHPEKQERMLKGLTSLDWIQHKERVWKVGGKPDGRFLAKVLGEFPGE 168

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD---- 347
             ++F P   I+   N      P   +IMG D+A  G D++VV   +G  +  LF     
Sbjct: 169 TDNAFFPQEAIDRG-NDTTIDKPEKGIIMGVDLARMGDDDSVVYTNQGGRV-RLFKGQVR 226

Query: 348 -------------WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
                        WSK +   +  ++  +  +     + +D++  G    D LE L
Sbjct: 227 YSDREGTKTTTGVWSKENTVASARRVHAIAMQIGAKQVRLDSSGIGGAVFDELEQL 282


>gi|134287454|ref|YP_001109621.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
 gi|134131876|gb|ABO60570.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
          Length = 509

 Score = 50.1 bits (118), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 147/363 (40%), Gaps = 54/363 (14%)

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
           H +   ++ + +  + ++S+G G GKT+  A + LW +      + I  A   + +   +
Sbjct: 40  HQIQMFDSVSKQGSRTSVSSGHGTGKTSGFAIIALWHLLCYYLSNTILTAPKISTVSDGV 99

Query: 125 WAEVSKWLSLLPNK------HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
           W E +   + + N        +F ++S  ++   +              ++  + ++   
Sbjct: 100 WKEFADLSTKISNGPQSWIWEYFVIESERVYVRGY------------KLNWFVIAKSAPR 147

Query: 179 ERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL-GFLTERNANRFWIMTSNPRRLSGKF 237
             P+   G H  + +  + DEASG PD  N G++ G LT+   NR   + S P R SG F
Sbjct: 148 GSPENLAGAHRDW-LLWLADEASGIPD-DNFGVITGSLTDER-NRM-CLASQPTRSSGFF 203

Query: 238 YEIFN----KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLD--SDVTRVEVCGQFPQQ 291
           YE  +         W     ++       P      IA   L    +  +++V G+FP+ 
Sbjct: 204 YETHHALSRAEGGPWNNLVFNSE----FSPIVSAKFIAEKKLQYTEEEYQIKVQGRFPEN 259

Query: 292 DIDSFIPLNIIEEALNREPC-PDPYAPLIMGCDIAEEG-GDNTVV----VLRRGPVIEHL 345
                +    IE  + R    PD +   ++  D+   G  D TV+    V+ RG   E+ 
Sbjct: 260 SSKYLVGPQAIEACVGRTVIKPDEHWGWLLPVDVGGGGWRDETVMPALHVIGRG---EYG 316

Query: 346 FDWSKTDLRTT--------NNKISGLV---EKYRPDAI-IIDANNTGARTCDYLEMLGYH 393
            D  +  L +           ++ G++    + R +A  +IDA   G   C  L++ G+ 
Sbjct: 317 MDARRAQLISVPLHSNTQDPAQLHGVIVHAARERSNATAMIDAGGMGLIVCKQLDLDGFS 376

Query: 394 VYR 396
            YR
Sbjct: 377 QYR 379


>gi|284162607|ref|YP_003401230.1| hypothetical protein Arcpr_1511 [Archaeoglobus profundus DSM 5631]
 gi|284012604|gb|ADB58557.1| protein of unknown function DUF264 [Archaeoglobus profundus DSM
           5631]
          Length = 435

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 135/347 (38%), Gaps = 53/347 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           + AGR  GKT   A   ++   T PG     +A S  Q    ++ ++ ++LS    K   
Sbjct: 44  VVAGRRFGKTECMAVSAIYYALTNPGSIQFVIAPSYDQ-SNIMFGQIVQFLS----KSIL 98

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 ++  P++    H     DS     +    S  +P+   GH       II DEA+
Sbjct: 99  GCMIRRIYKTPFH----HIIFKNDS-----VIHARSASKPEFLRGHK---AHRIILDEAA 146

Query: 202 GTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGK--FYEIFNK----PLDDWKRFQID 254
             P DVI+  I   L + N +  WI    P    GK  FY+ + K       D+  ++  
Sbjct: 147 FIPDDVISNIIEPMLADYNGS--WIKIGTP---FGKNHFYDTYLKGQSPDFPDYSSYRFP 201

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP------------QQDIDSFIPLNII 302
           +     I   F E     YG +S + R E   +F             Q+++D+ I L   
Sbjct: 202 STVNPHISHEFIEKKKREYGENSIIFRTEYLAEFVEDQNAVFRWADIQKNVDNSIELIDS 261

Query: 303 EEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
            E ++++         ++GCD+A+      +VVL        L  + + + R     I  
Sbjct: 262 AENVSKQ--------YVIGCDLAKYQDYTVIVVLDVTEKPYKLVHFERFNRRPYAEVIMR 313

Query: 363 LVEKYRP---DAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
           L E YR      ++ID+   G    + L+ +G   Y V   K  V L
Sbjct: 314 LKELYRRFNYAKVLIDSTGVGDPVLEDLQDVGAEGY-VFTPKSKVQL 359


>gi|159897183|ref|YP_001543430.1| hypothetical protein Haur_0654 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890222|gb|ABX03302.1| conserved hypothetical protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 472

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 145/394 (36%), Gaps = 82/394 (20%)

Query: 78  FKGAISAGRGIGKTTLNAWLV-LWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLP 136
           ++  + A   +GKT L   LV  W  S  PG+ V+  A ++ Q++  LW EV   +    
Sbjct: 36  YRTLVKACHKVGKTHLGGGLVNWWYDSFDPGL-VLTTAPTDRQVRDLLWKEVR--MQRRG 92

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
              +   +S  L   P               H++     ++ +  D+F GHH+ + + I 
Sbjct: 93  RAGFTGPKSPRLESTP--------------DHFA---HGFTAKDGDSFQGHHSPHTLFIF 135

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNP---------RRLSGKFYEI------- 240
            DEA G   V          E  A   W+   NP           LSG ++ I       
Sbjct: 136 -DEAVGVASVFWETAESMFNEGGA---WLAIFNPTDTSSQAYAEELSGGWHVISMSVLEH 191

Query: 241 ---------FNKPLDDWKRF-QIDT------RTVEGIDPSFHEGIIAR--YGLDSDVTRV 282
                       P     R  ++DT      R +   +P     I  R  +     +   
Sbjct: 192 PNILAELQGLPPPFPSAIRLSRVDTLLKKWCRALSPEEPKRATDIHWRDAWYRPGPIAEA 251

Query: 283 EVCGQFPQQ---DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
            + G++P Q   ++ S     + E  L     P    P  +GCD+A  G D T + +RRG
Sbjct: 252 RLLGRWPSQATNNVWSDGAFQVAESLL----LPASDEPCELGCDVARYGDDFTEIHVRRG 307

Query: 340 P---VIEHLFDWSKTDLRTTNNKISGLVEKY--------RPDAIIIDANNTGARTCDYLE 388
                 E    WS  +   T  ++  L  +Y        R  A+ ID +  G    D  +
Sbjct: 308 GHSLYHEAANGWSTVE---TAGRLKQLANEYGRRCGVDGRAVAVKIDDDGIGGGVVDLAD 364

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
             GY    V G + A D E   NRR+EL   +A+
Sbjct: 365 --GYTFLGVSGARTAYDPEKYPNRRSELWFSVAE 396


>gi|241763591|ref|ZP_04761642.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
 gi|241367184|gb|EER61538.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
          Length = 521

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 88/209 (42%), Gaps = 21/209 (10%)

Query: 295 SFIPLNIIEEALNR-EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS---K 350
             IP   ++ A  R +P  D     ++G D A  G D T V  R     + L        
Sbjct: 290 QLIPTEWVKAAQARWQPRQDKGPMTVLGLDPARGGTDKTSVARRHDCWFDVLISEPGIVT 349

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC- 409
            D  TT    + LV    P  I +DA   G+   D+++ LG  VY V+G +R+  ++   
Sbjct: 350 KDGPTTAAFTAPLVRNGAP--IAVDAIGIGSSALDFIQGLGLLVYAVVGSERSDHMDKAG 407

Query: 410 ----RNRRTELHVKMADWLEFA-----SLINHSGLIQNLKSLKSFIVPNTGELAIESK-- 458
               RNRR E++ ++ + L+       +L     L+ +L +++  +V      AI+ +  
Sbjct: 408 TMRFRNRRAEMYWRLREALDPTAEQPIALPPDQELLGDLTAVRYKVVTMGQGAAIQIRDK 467

Query: 459 ---RVKGAKSTDYSDGLMYTFAENPPRSD 484
              R    +S D  D +  TF E  P  D
Sbjct: 468 DEIREALGRSPDKGDSVAMTFCEGIPLLD 496


>gi|161789175|ref|YP_001595730.1| PacB [Vibrio sp. 0908]
 gi|161761461|gb|ABX77106.1| PacB [Vibrio sp. 0908]
          Length = 572

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
           +  +N   P   + ++++G G GK+ L A L L  + T P    +  ANS  Q+   +++
Sbjct: 50  IEVINALTPVGARVSVASGHGTGKSHLTAALCLHFIITHPESLCMLTANSLDQVTNVVFS 109

Query: 127 EVSK-WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            + + W+ +   + W E Q   +    +Y+       G+    +    +T S+   +   
Sbjct: 110 YIKRCWVKICQRQPWLE-QYFVITAKSFYAKGYK---GV----WQIFGKTCSKGNEEGLA 161

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           G H    M ++ DEASG  D     + G LTE N N+  ++ S   R +G F
Sbjct: 162 GQHRRDYMVVV-DEASGVSDRAFEVLRGALTEDN-NKM-LLISQFTRPTGHF 210


>gi|260580755|ref|ZP_05848581.1| phage terminase large subunit [Haemophilus influenzae RdAW]
 gi|260092572|gb|EEW76509.1| phage terminase large subunit [Haemophilus influenzae RdAW]
          Length = 447

 Score = 47.8 bits (112), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 87/203 (42%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GA-------RTCDYLEMLGYHV---------YRVLGQK--------RAVDLEFCRNR--R 413
           GA       R    L++ G++            + G+K        +A      R+R  +
Sbjct: 305 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYK 364

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 365 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 424

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 425 SPNMADALVMCYAPTKPKSLLDL 447


>gi|16273317|ref|NP_439561.1| terminase large subunit-like protein [Haemophilus influenzae Rd
           KW20]
 gi|1175785|sp|P44184|Y1410_HAEIN RecName: Full=Uncharacterized protein HI_1410
 gi|1574247|gb|AAC23058.1| predicted coding region HI1410 [Haemophilus influenzae Rd KW20]
          Length = 394

 Score = 47.4 bits (111), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 87/203 (42%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 192 VGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 251

Query: 380 GA-------RTCDYLEMLGYHV---------YRVLGQK--------RAVDLEFCRNR--R 413
           GA       R    L++ G++            + G+K        +A      R+R  +
Sbjct: 252 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYK 311

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 312 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 371

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 372 SPNMADALVMCYAPTKPKSLLDL 394


>gi|85058727|ref|YP_454429.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779247|dbj|BAE74024.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 456

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%)

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI 372
           +P     +G D+A+EG D+  ++L  G V+ HL  W+K D+  + +++    E    D I
Sbjct: 234 EPAGKKRIGFDVADEGEDSNALILSHGSVVMHLETWNKGDVIQSADRVKNYAESVIADEI 293

Query: 373 IIDANNTGA 381
           I D+   GA
Sbjct: 294 IFDSIGVGA 302


>gi|282880015|ref|ZP_06288737.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
 gi|281306129|gb|EFA98167.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
          Length = 459

 Score = 46.2 bits (108), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 100/230 (43%), Gaps = 33/230 (14%)

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR-------EPCPDPYAPLIMGCDIAEEGG 329
           +D+ R++V G FP+   D+ IP   +E A +R       +  P  YA +  G D+A  G 
Sbjct: 221 NDLFRIKVLGLFPKASEDTLIPFEWLELAHDRWKKLNAEDFVPRKYARV--GIDVAGMGR 278

Query: 330 DNTVVVLRRG---PVIEHLFDWSKTD-LRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           D++  VLR G   P I+      K D ++     +  LVEK     ++ID    GA    
Sbjct: 279 DSSCFVLRYGNYVPEIKIHQSGGKADHMKVAGEAVQWLVEK--NTKVMIDTIGEGAGVYS 336

Query: 386 YLEMLGY-HVYRVL---GQKRAVDL----EFCRNRRTELHVKMADWLEFASLINHS---- 433
            L  LGY + Y      G K   D+    EF  N R   +  + DWL   +  N +    
Sbjct: 337 RLLELGYDNAYSCKFSEGTKGLHDITGQYEFA-NMRAYCYWAVRDWLNPKNGFNPALPPC 395

Query: 434 -GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
             L   L  +  +   ++G + IE K   + +  +S D +D L+ TF  N
Sbjct: 396 DELDAELTEVH-WSFQSSGSIIIEPKENIKSRLKRSPDRADALISTFYPN 444


>gi|68250076|ref|YP_249188.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058275|gb|AAX88528.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 447

 Score = 45.8 bits (107), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 87/203 (42%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADSNDNAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GA-------RTCDYLEMLGYHV---------YRVLGQK--------RAVDLEFCRNR--R 413
           GA       R    L++ G++            + G+K        +A      R+R  +
Sbjct: 305 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYK 364

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 365 TYRAVKHGDVYPDDELISLSSNIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 424

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 425 SPNMADALVMCYATTKPKSLLDL 447


>gi|319776448|ref|YP_004138936.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319897217|ref|YP_004135412.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|329123931|ref|ZP_08252483.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|317432721|emb|CBY81084.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317451039|emb|CBY87270.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
 gi|327468126|gb|EGF13613.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 447

 Score = 45.8 bits (107), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 85/203 (41%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GA-------RTCDYLEMLGYHV--------YRVLGQKRAVDLE---------FCRNR--R 413
           GA       R    L++ G++            +  K+  D+            R+R  +
Sbjct: 305 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYK 364

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 365 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 424

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 425 SPNMADALVMCYAPTKPKSLLDL 447


>gi|145629503|ref|ZP_01785301.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145641440|ref|ZP_01797019.1| predicted phage terminase large subunit [Haemophilus influenzae
           R3021]
 gi|144978346|gb|EDJ88110.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145273983|gb|EDK13850.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.4-21]
 gi|309750959|gb|ADO80943.1| Probable bacteriophage terminase, large subunit [Haemophilus
           influenzae R2866]
          Length = 447

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 85/203 (41%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GA-------RTCDYLEMLGYHV--------YRVLGQKRAVDLE---------FCRNR--R 413
           GA       R    L++ G++            +  K+  D+            R+R  +
Sbjct: 305 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYK 364

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 365 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 424

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 425 SPNMADALVMCYAPTKPKSLLDL 447


>gi|145638997|ref|ZP_01794605.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
 gi|145271969|gb|EDK11878.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
          Length = 379

 Score = 45.4 bits (106), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 85/203 (41%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 177 VGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 236

Query: 380 GA-------RTCDYLEMLGYHV--------YRVLGQKRAVDLE---------FCRNR--R 413
           GA       R    L++ G++            +  K+  D+            R+R  +
Sbjct: 237 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYK 296

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 297 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 356

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 357 SPNMADALVMCYAPTKPKSLLDL 379


>gi|189460514|ref|ZP_03009299.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
 gi|189432758|gb|EDV01743.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
          Length = 556

 Score = 44.7 bits (104), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 89/235 (37%), Gaps = 43/235 (18%)

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL-----IMGCDIAEEGGDNT 332
           D+ R +V G FP+ D D+ IP   +EEA  R        PL     I+G D+A  G D T
Sbjct: 309 DLFRKKVLGLFPKVDEDTLIPRQWLEEAHERWKQAKGREPLRADLNILGVDVAGMGRDAT 368

Query: 333 VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI----IIDANNTGAR------ 382
             VLRR   +   FD   +     + K++G +   R   I     ID    GA       
Sbjct: 369 CYVLRRDNWVAS-FDTHNSGGVADHMKVAGKIMVARRQNIGLYVSIDTIGEGAGVYSRCV 427

Query: 383 ----------TCDYLEML----GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL---- 424
                     +C Y E      G  +  + GQ +        N R  L   + DWL    
Sbjct: 428 ELEDEPHYILSCKYSESAKTPNGRELSDITGQNKFF------NMRAYLFWAVRDWLNPRN 481

Query: 425 EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              +++          +   F V + G+L IE K   + +  +S D  D L  TF
Sbjct: 482 NTGAMLPPDDKFDEEATEIKFSVKSNGKLYIEPKEDIKERLGRSPDKFDALANTF 536


>gi|53793591|ref|YP_112491.1| terminase large subunit [Flavobacterium phage 11b]
 gi|53748181|emb|CAH56642.1| terminase large subunit [Flavobacterium phage 11b]
          Length = 432

 Score = 44.3 bits (103), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 84/176 (47%), Gaps = 21/176 (11%)

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP--DA 371
           P+  + +  DIA  G D  V+ +  G  +  +F  +K+ +      + GL  K++     
Sbjct: 248 PFGEMYISADIARFGSDKMVICVWSGFRVVEIFSMAKSSITEIAEAVRGLSIKHKVPLSN 307

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE----FCRNRRTELHVKMADWLEFA 427
           +I D +  G    D L   G+     +   RA++++      +N +T+ + K+A+ ++  
Sbjct: 308 VICDEDGVGGGVVDVLGCTGF-----INNSRAMEVDNQVVQYQNLKTQCYYKLAEVIQSN 362

Query: 428 SLINHS-------GLIQNLKSLKSFIVPNTGELAIESK-RVKGA--KSTDYSDGLM 473
           +L  HS        + + L+ +K   + + G+L + SK +VK A  +S DYSD LM
Sbjct: 363 NLYIHSEDATVNDEITKELEQVKRDKIDSDGKLQLISKDKVKQAIGRSPDYSDALM 418


>gi|301170180|emb|CBW29784.1| predicted phage terminase large subunit [Haemophilus influenzae
           10810]
          Length = 447

 Score = 44.3 bits (103), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 35/203 (17%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D+       G V+  +  W    +  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADSNANAFVHGSVVLDIEVWKNGYVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GA-------RTCDYLEMLGYHV---------YRVLGQK--------RAVDLEFCRNR--R 413
           GA       R    L++ G++            + G+K        +A      R+R  +
Sbjct: 305 GAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYK 364

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFI------VPNTGELAIESK---RVKGAK 464
           T   VK  D      LI+ S  I+ L+ LK+ +        N G + +ESK   + +G  
Sbjct: 365 TYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIP 424

Query: 465 STDYSDGLMYTFAENPPRSDMDF 487
           S + +D L+  +A   P+S +D 
Sbjct: 425 SPNMADALVMCYAPTKPKSLLDL 447


>gi|329119006|ref|ZP_08247700.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464879|gb|EGF11170.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 449

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           I+G D+A+EG D    VLR G V+  +  W   D+  + +K+    ++   D I+ D   
Sbjct: 240 ILGFDVADEGDDANATVLRHGSVVTDMQQWRGQDVIYSADKVYLYAQEQNVDRIVYDNIG 299

Query: 379 TGA-------RTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            GA       R    ++ LG++    + +  A   +  +NR    ++K   W
Sbjct: 300 VGAGVKAQFRRKNGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFANIKAQAW 351


>gi|254781186|ref|YP_003065599.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040863|gb|ACT57659.1| hypothetical protein CLIBASIA_05465 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 45

 Score = 42.4 bits (98), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAV 404
           +  +Y PDAI++ AN  GA T +YLE L Y  + ++LGQ+ +V
Sbjct: 1   MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43


>gi|153806881|ref|ZP_01959549.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
 gi|149131558|gb|EDM22764.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
          Length = 513

 Score = 42.0 bits (97), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 98/234 (41%), Gaps = 47/234 (20%)

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR---EPCPDPYAP---LIMGCDIAEEGGD 330
           +D+ RV+V G FP+   D  IP   IE A NR   E     + P     +G D+A  G D
Sbjct: 275 NDLFRVKVLGMFPKVSEDVLIPYEWIEIA-NRNWQELQASGFIPAKSCKLGVDVAGMGRD 333

Query: 331 NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP--------DAI---------I 373
           N+V+  R G  +   FD  ++  R  +  + G+   Y          D I         +
Sbjct: 334 NSVLCPRYGNYVPQ-FDVHQSAGRADHMHVVGMTIPYLKKKGAKAFIDTIGEGAGVYSRL 392

Query: 374 IDANNTGARTCDYLEML-GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-----FA 427
           ++   T A +C Y E   G H   + G+      EF  N R  L+  + DWL       A
Sbjct: 393 LEEEFTNAFSCKYSEGTDGLH--DITGE-----YEFA-NMRAYLYWALRDWLNPKNGFGA 444

Query: 428 SLINHSGLIQNLKSLKSFIVPNTGELAIE-----SKRVKGAKSTDYSDGLMYTF 476
           +L     L++     K   + N G++ IE      KR+K  +S DY D L  TF
Sbjct: 445 ALPPCDQLMEEATETKWKFLSN-GKVIIEPKEDVKKRIK--RSPDYMDALANTF 495


>gi|309379923|emb|CBX21334.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 449

 Score = 42.0 bits (97), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           I+G D+A+EG D    VLR G V+  +  W   D+  + +K+    ++   D I+ D   
Sbjct: 240 ILGFDVADEGDDANATVLRHGSVVTDMRQWRGQDVIYSADKVYLYAQEQDIDRIVYDNIG 299

Query: 379 TGA-------RTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            GA       R    ++ LG++    + +  A   +  +NR    ++K   W
Sbjct: 300 VGAGVKAQFRRKRGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFANIKAQAW 351


>gi|303243859|ref|ZP_07330199.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
 gi|302485795|gb|EFL48719.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
          Length = 445

 Score = 40.0 bits (92), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 126/328 (38%), Gaps = 45/328 (13%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           ++AGR  GK+ L A+L+++L ST+       +A      +  ++ E+ K++      +  
Sbjct: 56  VAAGRRFGKSKLMAFLLIFLCSTQKNKKYAVIAPFYANAR-IIFRELKKYIE---KSNVL 111

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 +  +P+ +        ID +         S + P +  G   +Y + I+++ A 
Sbjct: 112 SRLVKRMVESPYMAIEFKTGCTIDFR---------SADNPTSIRGE--SYHLVILDEAAF 160

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR---FQIDTRTV 258
              DV+   I   L + +A    I T N       FYE F    +   R   F+  T T 
Sbjct: 161 IKDDVVKYVIKPLLLDYDAPLIEISTPNGH---NHFYESFLMGKNKQNRHISFRFPTWTN 217

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQF------------PQQDIDSFIPLNIIEEAL 306
             +  +  E I    G DS V + E C +F             QQ ID  I L    E+ 
Sbjct: 218 PFLPKNAIEEIKQEVGEDSPVWKQEYCAEFIDNNEAVFNWEYIQQCIDGTIKLLKSGESG 277

Query: 307 NREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL---RTTNNKISGL 363
           ++          +MG D+A+      + VL        L  + + +L       +K+  L
Sbjct: 278 HQ---------YVMGVDLAKFEDYTVITVLDVSVKPYKLVYFERFNLMPYSFVADKVKEL 328

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLG 391
            + +    + +DA   GA   + +E L 
Sbjct: 329 YQLFNKPQVCMDATGPGAAVVEQVESLN 356


>gi|310641214|ref|YP_003945972.1| malate dehydrogenase, nad-dependent [Paenibacillus polymyxa SC2]
 gi|309246164|gb|ADO55731.1| malate dehydrogenase, NAD-dependent [Paenibacillus polymyxa SC2]
          Length = 313

 Score = 40.0 bits (92), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV----EKYRPDAIII 374
           IMG    E+  D+ +V++  G  I      S+ DL  TN  I   V    +KY PD+I+I
Sbjct: 64  IMGTSNYEDAADSDIVIITAG--IARKPGMSRDDLVNTNAGIVKSVCENVKKYAPDSIVI 121

Query: 375 DANN-TGARTCDYLEMLGYHVYRVLGQKRAVD-LEFCRNRRTELHVKMADWLEF 426
             +N   A T    + L +   RV+GQ   +D   +C     EL+V + D   F
Sbjct: 122 ILSNPVDAMTYTAYQTLDFPKNRVIGQSGVLDTARYCTFIAQELNVSVEDVRGF 175


>gi|226940436|ref|YP_002795510.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715363|gb|ACO74501.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 93

 Score = 39.7 bits (91), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 31 FVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIG 89
          + LH + WG     LEG + PR+WQ E M  +  H        NP     A  AGRG+G
Sbjct: 22 WALHAYDWGRG--ELEGVTGPRAWQREVMSDIGNHL------KNPATRFSAFDAGRGLG 72


>gi|325295250|ref|YP_004281764.1| mutual gliding protein A [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065698|gb|ADY73705.1| mutual gliding protein A [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 193

 Score = 39.7 bits (91), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 273 YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNT 332
           YG+D  +  + +  Q+ ++D+ + +P+ I+++ LNR  CPD  A  I G  + E   + T
Sbjct: 127 YGID--IKEIPLVFQYNKRDLPNVLPIEILKKDLNRWKCPDFEAIAIKGIGVLETFKEIT 184

Query: 333 VVVLRR 338
             VLR+
Sbjct: 185 KQVLRK 190


>gi|308068360|ref|YP_003869965.1| Malate dehydrogenase (Vegetative protein 69) [Paenibacillus
           polymyxa E681]
 gi|305857639|gb|ADM69427.1| Malate dehydrogenase (Vegetative protein 69) [Paenibacillus
           polymyxa E681]
          Length = 313

 Score = 38.9 bits (89), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV----EKYRPDAIII 374
           I G    E+  ++ +V++  G  I      S+ DL  TN  I   V    +KY PD+I+I
Sbjct: 64  ITGTSNYEDAANSDIVIITAG--IARKPGMSRDDLVNTNAGIVKSVCENVKKYAPDSIVI 121

Query: 375 DANN-TGARTCDYLEMLGYHVYRVLGQKRAVD-LEFCRNRRTELHVKMADWLEF 426
             +N   A T    + LG+   RV+GQ   +D   +C     EL+V + D   F
Sbjct: 122 ILSNPVDAMTYTAYQTLGFPKNRVIGQSGVLDTARYCTFIAQELNVSVEDVRGF 175


>gi|22074007|gb|AAL05293.1| replication-associated protein [Tomato yellow leaf curl virus -
           Gezira]
          Length = 359

 Score = 38.5 bits (88), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 61/150 (40%), Gaps = 23/150 (15%)

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEA 305
           DW +FQID R+  G   S ++   A     S    + V  +  P+  I  F  LN   + 
Sbjct: 112 DWGQFQIDGRSARGGQQSANDAYAAAINSGSKAEALRVLRELAPRDYILQFHNLNSNLDR 171

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           + +EP P PY+   +     +              V E L  W       + N +S    
Sbjct: 172 IFQEP-PAPYSSPFLSSSFNQ--------------VPEELEVW------VSENVMSSAAR 210

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
            +RP++III+ ++   +T  +   LG H Y
Sbjct: 211 PWRPNSIIIEGDSRTGKTM-WARSLGPHNY 239


>gi|148826888|ref|YP_001291641.1| phage terminase large subunit [Haemophilus influenzae PittGG]
 gi|148718130|gb|ABQ99257.1| predicted phage terminase large subunit [Haemophilus influenzae
           PittGG]
          Length = 366

 Score = 38.1 bits (87), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%)

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   
Sbjct: 245 VGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGV 304

Query: 380 GARTCDYLEML 390
           GA    + + L
Sbjct: 305 GAGVKAHFKRL 315


>gi|2497856|sp|Q59202|MDH_BACIS RecName: Full=Malate dehydrogenase
 gi|963019|emb|CAA62129.1| malate dehydrogenase [Bacillus israeli]
          Length = 312

 Score = 37.7 bits (86), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI----SGLVEKYRPDAIII 374
           I+G    EE  D+ +VV+  G  I      S+ DL  TN K+    +  V KY P++III
Sbjct: 64  IIGTSNYEETADSDIVVITAG--IARKPGMSRDDLVQTNQKVMKSVTKEVVKYSPNSIII 121

Query: 375 DANN-TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRN-RRTELHVKMADWLEF 426
              N   A T    +  G+  +RV+GQ   +D    R     EL++ + D   F
Sbjct: 122 VLTNPVDAMTYTVYKESGFPKHRVIGQSGVLDTARFRTFVAQELNLSVKDITGF 175


>gi|40737892|gb|AAR89439.1| replication associated protein C1 [Tomato yellow leaf curl Mali
           virus]
          Length = 359

 Score = 37.7 bits (86), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 59/150 (39%), Gaps = 23/150 (15%)

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEA 305
           DW  FQID R+  G   S ++   A     S    + V  +  P+  +  F  LN   + 
Sbjct: 112 DWGEFQIDGRSARGGQQSANDAYAAALNSGSKSEALRVIKELAPKDYVLQFHNLNSNLDR 171

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           + +EP P PY    +     +              V E L  W       + N +S    
Sbjct: 172 IFQEP-PAPYISPFLSSSFNQ--------------VPEELEVW------VSENVMSSAAR 210

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
            +RPD+I+I+ ++   +T  +   LG H Y
Sbjct: 211 PWRPDSIVIEGDSRTGKTM-WARSLGPHNY 239


>gi|219965987|emb|CAR82110.1| replication associated protein (Rep) [Tomato yellow leaf curl Mali
           virus]
          Length = 359

 Score = 37.7 bits (86), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 59/150 (39%), Gaps = 23/150 (15%)

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEA 305
           DW  FQID R+  G   S ++   A     S    + V  +  P+  +  F  LN   + 
Sbjct: 112 DWGEFQIDGRSARGGQQSANDAYAAAINAGSKSEALRVIRELAPKDYVLQFHNLNSNLDR 171

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           + +EP P PY    +     +              V E L  W       + N +S    
Sbjct: 172 IFQEP-PAPYISPFLSSSFNQ--------------VPEELEIW------VSENVMSSAAR 210

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
            +RPD+I+I+ ++   +T  +   LG H Y
Sbjct: 211 PWRPDSIVIEGDSRTGKTM-WARSLGPHNY 239


>gi|219965994|emb|CAR82116.1| replication associated protein (Rep) [Tomato yellow leaf curl Mali
           virus]
          Length = 359

 Score = 37.4 bits (85), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 59/150 (39%), Gaps = 23/150 (15%)

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEA 305
           DW  FQID R+  G   S ++   A     S    + V  +  P+  +  F  LN   + 
Sbjct: 112 DWGEFQIDGRSARGGQQSANDAYAAAINAGSKSEALRVIRELAPKDYVLQFHNLNSNLDR 171

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           + +EP P PY    +     +              V E L  W       + N +S    
Sbjct: 172 IFQEP-PAPYISPFLSSSFNQ--------------VPEELEIW------VSENVMSSAAR 210

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
            +RPD+I+I+ ++   +T  +   LG H Y
Sbjct: 211 PWRPDSIVIEGDSRTGKTM-WARSLGPHNY 239


>gi|260945527|ref|XP_002617061.1| hypothetical protein CLUG_02505 [Clavispora lusitaniae ATCC 42720]
 gi|238848915|gb|EEQ38379.1| hypothetical protein CLUG_02505 [Clavispora lusitaniae ATCC 42720]
          Length = 348

 Score = 37.4 bits (85), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 382 RTCDYLEMLGYHVYRVLGQKRA---VDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           RT +YLE  G  V       RA   V   FCR            W E A++++HS  +  
Sbjct: 190 RTMEYLETQGVLVSTFNDDGRANIEVPSFFCRESGVRSPYSFTSWKEIAAVVHHSNNLMQ 249

Query: 439 LKSLKSFIVPNTGELAIESKRVKG 462
           L+S     +P   E+A+ S+ + G
Sbjct: 250 LQSGNLLCIPPPAEIALSSELMSG 273


Searching..................................................done


Results from round 2




>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1]
 gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 511

 Score =  727 bits (1876), Expect = 0.0,   Method: Composition-based stats.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI
Sbjct: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM
Sbjct: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP
Sbjct: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511
           PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
Sbjct: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511


>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  647 bits (1669), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/508 (73%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDP+FHE IIARYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPNFHENIIARYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPL+MGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLVMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNVSSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHPEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ +HSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPHHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  644 bits (1662), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/508 (74%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDPSFHEGII+RYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPLIMGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHAEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ NHSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPNHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2]
 gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 516

 Score =  621 bits (1601), Expect = e-176,   Method: Composition-based stats.
 Identities = 392/507 (77%), Positives = 414/507 (81%), Gaps = 9/507 (1%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP  
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPQQ 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            I EAL R   PDPYAPLIMGCDIA EG D TVVVLRRG +IE +FDWS   +  TN KI
Sbjct: 301 YIVEALERVAIPDPYAPLIMGCDIAGEGEDKTVVVLRRGNIIERIFDWSGELIEVTNRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGY-HVYRVLGQKRAVDLEFCRNRRTELHVK 419
           S L+ +Y PDAI+ID N  G     YL  + +  V  +LGQ+R+ + E   N R EL+  
Sbjct: 361 SSLINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRSTEPEQYHNLRAELYDL 420

Query: 420 MADWLEFASLINHS--GLIQNLKSLKSFIVPNTGELAIESKRVK----GAKSTDYSDGLM 473
           M   +     +      LI  LKS+KS I    G L IE KR      G +S D+ D L 
Sbjct: 421 MRSAITGGLQLPDDCPDLINELKSIKS-ISDTLGRLLIEKKRQGRSEFGVRSPDFVDALC 479

Query: 474 YTFAENPPRSDMDFGRCPS-YQYEGVD 499
           YTFA +PPR D    +     +YE +D
Sbjct: 480 YTFAVDPPRKDNPLYQGQDISEYEALD 506


>gi|227355862|ref|ZP_03840255.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
 gi|227164181|gb|EEI49078.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
          Length = 494

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 138/495 (27%), Positives = 217/495 (43%), Gaps = 25/495 (5%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MS  L  +PE EQ + D+       L    +  + FPWGE G  LE ++ PR WQ E + 
Sbjct: 1   MSEALQKSPE-EQLIEDIASFTHDPL---GYAYYAFPWGEAGGELEEYNGPRQWQAEALN 56

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            +  H  N      P +   A ++G GIGK+   + ++ W M T     V+  AN+E QL
Sbjct: 57  EIGEHLRNPKTRHQPLLL--ARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQL 114

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           +T  W E++KW  L    +WF     +++                +  +      +SE  
Sbjct: 115 RTKTWPEIAKWQRLSLTNNWFTCTKTAIYSND----------PNHANAWRADAVPWSENN 164

Query: 181 PDTFVGHHNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
            + F G HN    + ++ DEAS   D++     G LT+      WI   NP R +G+F E
Sbjct: 165 TEAFAGLHNKGKRIILVFDEASNIADLVWEVAEGALTDEGTEIIWIAFGNPTRNTGRFRE 224

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
            F K    W   QID+RTVEG +    +     YG DSD  +V V G FP      FIP 
Sbjct: 225 CFRKFKHRWNTKQIDSRTVEGSNKEQIKNWEEDYGEDSDFFKVRVRGVFPSASELQFIPT 284

Query: 300 NIIEEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD-WSKTDLRTT 356
            + +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +  TD    
Sbjct: 285 GLTDEAMKRIVTQAEVAHAPVIIGVDPAYSGIDDAVIYLRQGLFSKCLWTGFKTTDDVVM 344

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             +I+   ++Y+ DA+ ID    G          G     V     + D +   N+R E+
Sbjct: 345 AKRIADFEDQYKADAVHID-FGYGTGIHSIGTSWGRVWRLVKFGGASTDPQML-NKRGEM 402

Query: 417 HVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLM 473
           +  +  WL+    I+      +L   +  +     ++ +E K   + +  +S    D L 
Sbjct: 403 YNSVKTWLKIGGAIDDQETADDLSCGEYKVRVIDSKIVLEDKTEIKKRLGRSPGKGDALA 462

Query: 474 YTFAENPPRSDMDFG 488
            TFA    + D ++ 
Sbjct: 463 LTFAYPVTKIDRNYS 477


>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291315400|gb|EFE55853.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 493

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 147/486 (30%), Positives = 226/486 (46%), Gaps = 26/486 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       LS   + L+ FPWGE GT LE  + PR WQ E +  +  H  
Sbjct: 6   SPE-EQLINDIGMFTHDPLS---YALYAFPWGEAGTELENANGPRQWQAEALNEIGEHLR 61

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P   + A ++G GIGK+   + ++ W M T     V+  AN+E QL+T  W E
Sbjct: 62  NPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTWPE 119

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           ++KW  L   K WF     +++                +  +      +SE   + F G 
Sbjct: 120 IAKWQRLSITKDWFTYTKTAIYSND----------PNHANAWRADAVPWSENNTEAFAGL 169

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + +I DEAS   D++     G LT+ N    WI   NP R +G+F E F K   
Sbjct: 170 HNQGKRIILIFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKFKH 229

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    E  I  YG+D D  +V V G FP      FIP  + + A+
Sbjct: 230 RWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDAAM 289

Query: 307 NREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT-DLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  SKT D      +I+  
Sbjct: 290 KRTVTQAEVSHAPIIIGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIADF 349

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y  DA+ ID    G          G +   V     + D +  RN+R E++  +  W
Sbjct: 350 EDQYGADAVHID-FGYGTGIQSVGMNWGRNWQLVQFNGASTDPQM-RNKRGEMYNNVKSW 407

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L+    I+   + ++L + + + V  +G++ +ESK   + +  +S    D L  TFA   
Sbjct: 408 LKIGGAIDDQEVAEDLSTPE-YKVELSGKILLESKDDIKKRIGRSPGKGDALALTFAYPV 466

Query: 481 PRSDMD 486
            + + +
Sbjct: 467 TKKERN 472


>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
 gi|212686517|gb|EEB46045.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
          Length = 493

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 144/492 (29%), Positives = 223/492 (45%), Gaps = 28/492 (5%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M   +      EQ + D+       LS   + L+ FPWGE GT LE  S PR WQ E + 
Sbjct: 1   MIETMSPE---EQLINDIGMFTHDPLS---YALYAFPWGEAGTELENASGPRQWQAEALN 54

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            +  H  N      P   + A ++G GIGK+   + ++ W M T     V+  AN+E QL
Sbjct: 55  EIGEHLRNPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQL 112

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           +T  W E++KW  L   K WF     +++                +  +      +SE  
Sbjct: 113 RTKTWPEIAKWQRLSITKDWFTCTKTAIYSND----------PNHANAWRADAVPWSENN 162

Query: 181 PDTFVGHHNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
            + F G HN    + ++ DEAS   D++     G LT+ N    WI   NP R +G+F E
Sbjct: 163 TEAFAGLHNQGKRIILVFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRE 222

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
            F K    WK  QID+RTVEG +    E  I  YG+D D  +V V G FP      FIP 
Sbjct: 223 CFRKFKHRWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPT 282

Query: 300 NIIEEALNREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT-DLRTT 356
            + + A+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  SKT D    
Sbjct: 283 GLTDAAMKRTVTQAEVSHAPIILGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIM 342

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             +I+   ++Y  DA+ ID    G          G +   V     + D +  +N+R E+
Sbjct: 343 AKRIADYEDQYGADAVHID-FGYGTGIQSVGMNWGRNWQLVSFNGASTDPQM-QNKRGEM 400

Query: 417 HVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLM 473
           +  +  WL+    I+   +  +L + + + V  +G++ +E K   + +  +S +  D L 
Sbjct: 401 YNNVKSWLKIGGAIDDQEVADDLSTPE-YKVQLSGKILLEKKEDIKKRIGRSPNKGDALA 459

Query: 474 YTFAENPPRSDM 485
            TFA    + + 
Sbjct: 460 LTFAYPVTKKER 471


>gi|323156136|gb|EFZ42295.1| terminase large subunit [Escherichia coli EPECa14]
          Length = 491

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A+++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRYQPLML--ALASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D          K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        YAP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAYAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRLPGQQNQQ 480


>gi|324008564|gb|EGB77783.1| hypothetical protein HMPREF9532_01752 [Escherichia coli MS 57-2]
          Length = 491

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 142/498 (28%), Positives = 226/498 (45%), Gaps = 27/498 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D          K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSYQYEGV 498
            +  ++     S Q   +
Sbjct: 468 SKR-INIPGQQSQQGRAI 484


>gi|327252187|gb|EGE63859.1| terminase large subunit [Escherichia coli STEC_7v]
          Length = 491

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|332344357|gb|AEE57691.1| terminase, large subunit [Escherichia coli UMNK88]
          Length = 491

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLVEDIASFTYDPL---GYALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRLPGQQNQQ 480


>gi|294491573|gb|ADE90329.1| putative phage terminase, large subunit [Escherichia coli IHE3034]
          Length = 491

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSTAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|330007152|ref|ZP_08305894.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
 gi|328535499|gb|EGF61959.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
          Length = 495

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 140/485 (28%), Positives = 218/485 (44%), Gaps = 25/485 (5%)

Query: 6   PTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAH 65
           P     EQ + D+       L    + L+ FPWGE GT L   S PR WQ +    +  H
Sbjct: 8   PEEQLKEQLIDDIASFTHDPL---GYALYAFPWGEDGTELAHASGPRQWQADAFREIGEH 64

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
             N      P +   + ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W
Sbjct: 65  LQNPATRHQPLM--ISRASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLRTKTW 122

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+ KW +L   K WF   + +++      D  H       K +      +SE   + F 
Sbjct: 123 PEIIKWSNLAITKEWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFA 172

Query: 186 GHHNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
           G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K 
Sbjct: 173 GLHNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKY 232

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
              WK  QID+RTVEG +    +  +  YG DSD  +V V G FP      FIP  + +E
Sbjct: 233 KHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLTDE 292

Query: 305 ALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKIS 361
           A+ R        +AP I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+
Sbjct: 293 AMKRVVTAAQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIA 352

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
              ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+     
Sbjct: 353 DFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASADPQML-NKRGEMFNACK 410

Query: 422 DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            WL+    ++      +L + + + V   G++ +E K   + +  +S    D L+ TFA 
Sbjct: 411 TWLKLGGALDDQETADDLSAAE-YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLLTFAY 469

Query: 479 NPPRS 483
              + 
Sbjct: 470 PVTKR 474


>gi|218700994|ref|YP_002408623.1| putative phage terminase, large subunit [Escherichia coli IAI39]
 gi|218370980|emb|CAR18807.1| putative phage terminase, large subunit [Escherichia coli IAI39]
          Length = 491

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 143/498 (28%), Positives = 227/498 (45%), Gaps = 27/498 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIDDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSYQYEGV 498
            +  ++     S Q   +
Sbjct: 468 SKR-INIPGQQSQQGRAI 484


>gi|309702815|emb|CBJ02146.1| putative terminase, large subunit [Escherichia coli ETEC H10407]
          Length = 493

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 137/498 (27%), Positives = 228/498 (45%), Gaps = 25/498 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLVEDIAGFTYDPL---GYALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRHQPIML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKEWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  +V V G FP    + FIP  + + A+
Sbjct: 231 RWKCAQIDSRTVEGTNKEQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPAV 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK-ISGL 363
            R   P    +A +++G D + +G D  V+ LR+G   + L +W +T       K I+  
Sbjct: 291 GRVITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRTTDDVLFAKVIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G +   ++      D E   N+R E++    D 
Sbjct: 351 EDQYQADAVFID-YGYGTGLKSVGDNWGRNWTLIMFGSGTADPEM-GNKRGEMYKSARDA 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L+  + ++   L   L + +  +        ++ K   +    +S + +D  + T+A   
Sbjct: 409 LKLGAQLDSQELADELSAPEYKVRLKDSRKILQDKDEVKELLGRSPNNADAYVLTYAAPV 468

Query: 481 PRSDMDFGRCPSYQYEGV 498
            +   ++G+  S Q + +
Sbjct: 469 TKKQFNYGQQQSQQGKAL 486


>gi|298381721|ref|ZP_06991320.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|301019339|ref|ZP_07183525.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|298279163|gb|EFI20677.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|299882256|gb|EFI90467.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|323948690|gb|EGB44595.1| hypothetical protein ERKG_04913 [Escherichia coli H252]
          Length = 491

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|300898423|ref|ZP_07116764.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300357890|gb|EFJ73760.1| conserved hypothetical protein [Escherichia coli MS 198-1]
          Length = 491

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRKWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|117624715|ref|YP_853628.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
 gi|115513839|gb|ABJ01914.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
          Length = 491

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 141/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        ++P+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHSPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|89152423|ref|YP_512256.1| putative terminase large subunit [Escherichia phage phiV10]
 gi|74055446|gb|AAZ95895.1| putative terminase large subunit [Escherichia phage phiV10]
          Length = 491

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 141/493 (28%), Positives = 223/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG  SD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEGSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSTAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|331648179|ref|ZP_08349269.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331043039|gb|EGI15179.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 491

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 224/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNACKIW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRIPGQQNQQ 480


>gi|30387381|ref|NP_848210.1| terminase large subunit [Enterobacteria phage epsilon15]
 gi|30266036|gb|AAO06065.1| terminase large subunit [Salmonella phage epsilon15]
          Length = 491

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 141/494 (28%), Positives = 223/494 (45%), Gaps = 26/494 (5%)

Query: 12  EQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVN 71
           EQ + D+       L    + L+ FPWGE GT L   + PR WQ +    +  H  N   
Sbjct: 10  EQLVEDIASFTYDPL---GYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNPAT 66

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
              P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ KW
Sbjct: 67  RHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKW 124

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
            +L   K WF   + +++      D  H       K +      +SE   + F G HN  
Sbjct: 125 SNLAITKEWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGLHNER 174

Query: 192 G-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR 250
             + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K    WK 
Sbjct: 175 KRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKC 234

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR-- 308
            QID+RTVEG +    +  +  YG +SD  +V V G FP      FIP  + +EA+ R  
Sbjct: 235 AQIDSRTVEGTNKQQLQKWVDDYGEESDFVKVRVRGIFPDASELQFIPTGLTDEAMKRVV 294

Query: 309 EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKY 367
                 +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+   ++Y
Sbjct: 295 TAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQY 354

Query: 368 RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFA 427
           + DA+ ID    G       +  G     +     + D +   N+R E+      WL+  
Sbjct: 355 QADAVFID-FGYGTGLKSIGDGWGRTWQLIPFGGGSTDPQML-NKRGEMFNSCKTWLKLG 412

Query: 428 SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSD 484
             ++      +L + + + V   G++ IE K   + +  +S    D L+ TFA    +  
Sbjct: 413 GALDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPVTKH- 470

Query: 485 MDFGRCPSYQYEGV 498
           +      S Q + V
Sbjct: 471 LRIPGQESQQGKAV 484


>gi|301046412|ref|ZP_07193572.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300301638|gb|EFJ58023.1| conserved hypothetical protein [Escherichia coli MS 185-1]
          Length = 491

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 223/493 (45%), Gaps = 26/493 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLVEDIASFTYDPL---GYALYAFPWGEDGTELAHATGPRQWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+
Sbjct: 231 RWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFNSCKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L    +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA   
Sbjct: 409 LRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPV 467

Query: 481 PRSDMDFGRCPSY 493
            +     G+    
Sbjct: 468 SKRLRLPGQQNQQ 480


>gi|215487825|ref|YP_002330256.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265897|emb|CAS10306.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 493

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 137/498 (27%), Positives = 226/498 (45%), Gaps = 25/498 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLVEDIASFTYDPL---GYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKEWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  +V V G FP    + FIP  + + A+
Sbjct: 231 RWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPAV 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK-ISGL 363
            R   P    +A +++G D + +G D  V+ LR+G   + L +W +T       K I+  
Sbjct: 291 GRVITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRTTDDVLFAKIIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y+ DA+ ID    G       +  G +   +       D E   N+R E++    D 
Sbjct: 351 EDQYQADAVFID-YGYGTGLKSVGDNWGRNWTLIQFGSGTADPEM-GNKRGEMYKSARDA 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L+  + ++   L   L + +  +        ++ K   +    +S + +D  + T+A   
Sbjct: 409 LKLGAQLDSQNLADELSAPEYKVRLKDSRKILQDKEEVKELLGRSPNDADAYVLTYAAPV 468

Query: 481 PRSDMDFGRCPSYQYEGV 498
            +   ++G+  S Q + +
Sbjct: 469 TKKQFNYGQQQSQQGKAL 486


>gi|262043569|ref|ZP_06016682.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039103|gb|EEW40261.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 491

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 141/483 (29%), Positives = 219/483 (45%), Gaps = 26/483 (5%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +PE EQ + D+       L    + L+ FPWGE GT L   + PR WQ +    +  H  
Sbjct: 7   SPE-EQLIDDIASFTHDPL---GYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQ 62

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
           N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E
Sbjct: 63  NPATRHQPLML--ARASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLRTKTWPE 120

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           + KW +L   K WF   + +++      D  H       K +      +SE   + F G 
Sbjct: 121 IIKWSNLAITKEWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGL 170

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K   
Sbjct: 171 HNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKH 230

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            WK  QID+RTVEG +    +  +  YG DSD  +V V G FP      FIP  + +EA+
Sbjct: 231 RWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLTDEAM 290

Query: 307 NR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
            R        +AP I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+  
Sbjct: 291 KRVVTAVQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADF 350

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            ++Y  DA+ ID    G       +  G     V     + D +   N+R E+      W
Sbjct: 351 EDQYLADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASADPQML-NKRGEMFNACKTW 408

Query: 424 LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
           L+    ++      +L + + + V   G++ +E K   + +  +S    D L+ TFA   
Sbjct: 409 LKLGGALDDQETADDLSAAE-YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLLTFAYPV 467

Query: 481 PRS 483
            + 
Sbjct: 468 TKR 470


>gi|320175050|gb|EFW50163.1| terminase B protein, putative [Shigella dysenteriae CDC 74-1112]
          Length = 480

 Score =  476 bits (1225), Expect = e-132,   Method: Composition-based stats.
 Identities = 138/486 (28%), Positives = 220/486 (45%), Gaps = 25/486 (5%)

Query: 15  LFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPN 74
           + D+       L    + L+ FPWGE+GT L   + PR WQ +    +  H  N      
Sbjct: 2   IEDIAGFTHDPL---GYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQ 58

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
           P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L
Sbjct: 59  PLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNL 116

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-M 193
              K WF   + +++      D  H       K +      +SE   + F G HN    +
Sbjct: 117 AITKDWFTCTATAMYSN----DPGH------DKRWRADAIPWSEHNTEAFAGLHNERKRI 166

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
            ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K    WK  QI
Sbjct: 167 IVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQI 226

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPC 311
           D+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+ R     
Sbjct: 227 DSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAA 286

Query: 312 PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPD 370
              +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ D
Sbjct: 287 QVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQAD 346

Query: 371 AIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI 430
           A+ ID    G       +  G     V     + D +   N+R E+ +    WL    ++
Sbjct: 347 AVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQML-NKRGEMFISCKTWLRLGGML 404

Query: 431 NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
           +      +L + + + V   G++ IE K   + +  +S    D L+ TFA    +     
Sbjct: 405 DDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPVSKRLRIP 463

Query: 488 GRCPSY 493
           G+    
Sbjct: 464 GQQNQQ 469


>gi|304398406|ref|ZP_07380280.1| terminase, large subunit [Pantoea sp. aB]
 gi|304354272|gb|EFM18645.1| terminase, large subunit [Pantoea sp. aB]
          Length = 490

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 135/485 (27%), Positives = 215/485 (44%), Gaps = 24/485 (4%)

Query: 13  QKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNN 72
           Q + D+            + L+ FPWGE+GT L     PR WQ +  + + AH  N    
Sbjct: 10  QLIEDIGAFTHDPF---GYALYAFPWGEEGTDLAYSKGPRQWQEDAFKQIGAHLQNPDTR 66

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
             P +   A  +G GIGK+   + LV W M T     V+  AN+E QL+T  W E++KW 
Sbjct: 67  HQPLMIGRA--SGHGIGKSAFISMLVKWGMDTCEDCKVVVTANTENQLRTKTWPEIAKWQ 124

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
            L   + WF   + +++                +K +      +SE   + F G HN   
Sbjct: 125 RLSITQDWFTCTATAIYSND----------PSHAKSWRADAIPWSENNTEAFAGLHNERK 174

Query: 193 -MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF 251
            + +I DEAS   D++     G LT+ N    W+   NP R +G+F E F K    WK  
Sbjct: 175 RIILIFDEASNIADLVWEVAEGALTDENTEIIWVAFGNPTRNTGRFRECFRKLRHRWKTA 234

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           QID+R+VEG +    +  +  YG DSD  +V V G FP      FIP  + + A+ R   
Sbjct: 235 QIDSRSVEGTNKEQIQKWVDDYGEDSDFVKVRVRGLFPSASEAQFIPTGLTDAAVGRVIT 294

Query: 312 PDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG-LVEKYR 368
           P    +A  ++G D A +GGD  V+ LR+G   + L ++ +T       KI     ++YR
Sbjct: 295 PGQVAHAATVIGVDPAHQGGDPAVIYLRQGLHTKKLGEYQRTTDDVLFAKIVASFEDEYR 354

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            DA+ ID    G       +  G +   +     + D +   N+R E++  +  WL+   
Sbjct: 355 ADAVFID-YGYGTGLKSVGDNWGRNWQLIQFGGGSTDPQM-ANKRGEMYNAVKTWLKDGG 412

Query: 429 LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDM 485
            ++   + + L + +  +      + +E K   + +  KS + +D L  TFA    +   
Sbjct: 413 QLDSQQVAEELSAAEYKVRLKDSRIVLEDKTSIKERLGKSPNDADALALTFAFPVVKKLH 472

Query: 486 DFGRC 490
             G  
Sbjct: 473 YVGSN 477


>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861389|gb|EFL84326.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
          Length = 500

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 144/465 (30%), Positives = 206/465 (44%), Gaps = 26/465 (5%)

Query: 28  FSNFVLHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGR 86
              FVL  FPWG  G  L  +   P  WQ E +  +      S       V + A+S+G 
Sbjct: 29  PLGFVLFAFPWG--GGALADYPDGPDVWQREILRGMGEQL--STGASAASVIREAVSSGH 84

Query: 87  GIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
           G+GK+ L AW++LW MST      +  AN+E QLK   WAE++KW  L    +WF+  + 
Sbjct: 85  GVGKSALVAWIILWAMSTFSDTRGVVTANTENQLKGKTWAELAKWHRLCLCGYWFDCTAT 144

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT-YGMAIINDEASGTPD 205
           +L                  K +      +SE   + F G HN    + +I DEAS  PD
Sbjct: 145 ALIST----------QAGHEKTWRVDMVAWSERNTEAFAGLHNKGRRVLLIFDEASAIPD 194

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF 265
            I     G LT+ +    W    NP R +G+F E F +    W   ++D+RT    D + 
Sbjct: 195 AIWEVSEGALTDADTEIIWCCFGNPTRNTGRFRECFGRYAHRWNTRRVDSRTAAMTDKNQ 254

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--APLIMGCD 323
               +  YG DSD  RV V G+FP+     FI  +I+ EA  R   PD Y  AP I+G D
Sbjct: 255 LAQWVEDYGEDSDFVRVRVRGEFPRAGDRQFISSDIVHEARGRSLKPDQYSFAPRILGVD 314

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           +A  G D +V+  R+G        +   D  T    ++    ++  D I +D    GA  
Sbjct: 315 VARSGSDQSVITRRQGLACLEQRKFRGLDTVTLAGIVAEECREWGADKIFVDGIGVGAGV 374

Query: 384 CDYLEM---LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS-GLIQNL 439
            D L     LG+ V   +    A+  E   NRR E+   M  WL     +     L + L
Sbjct: 375 VDALRQVYGLGHLVVDAVAGATALQPERFLNRRAEMWTAMRKWLAEGGAVPDDAELAEQL 434

Query: 440 KSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
             L+ + V  +G+L +ESK   + +G  S D +D L  TF    P
Sbjct: 435 CGLE-YAVTVSGKLKLESKDDMKARGLTSPDCADALALTFYAPVP 478


>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1]
 gi|166859242|gb|ABY97649.1| putative phage terminase, large subunit [Pseudomonas putida GB-1]
          Length = 499

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 143/491 (29%), Positives = 225/491 (45%), Gaps = 27/491 (5%)

Query: 8   NPETEQKLF-DLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHC 66
             + EQ+L  D+    +  L    +VL+ FPWGE G  L   + PR WQ E +E +    
Sbjct: 7   EIDYEQELANDIASFSDDPL---GYVLYAFPWGEAGGELANKTGPRKWQREVLESIGEQL 63

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
                +   EV + A+++G GIGK+ L +W++ W + T      +  AN+E+QL+T  W 
Sbjct: 64  RAGAKDRG-EVIREAVASGHGIGKSALVSWVIKWALDTEVDTRGVVTANTESQLRTKTWP 122

Query: 127 EVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
           EV+KW  L    HWF++   +L       D  H       K++      +S+   + F G
Sbjct: 123 EVAKWNRLSITAHWFKLTGTALIST----DPDH------EKNWRIDAVPWSDTNTEAFAG 172

Query: 187 HHNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL 245
            HN    + +I DEAS   D++     G LT+ +    W    NP R SG+F E F K  
Sbjct: 173 LHNEGKRILLIFDEASAIADLVWEVAEGALTDADTEIIWAAFGNPTRNSGRFRECFTKFK 232

Query: 246 DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
             W+  Q+D+RTV+G + +     IA YG DSD  R+ V G FP+      IP + + EA
Sbjct: 233 HRWRHRQVDSRTVDGTNKTQIAKWIADYGEDSDFVRIRVRGMFPRASDLQLIPTDWVAEA 292

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE--HLFDWSKTDLRTTN---NKI 360
           + R+        L+ G DIA  G DN V+  RRG   +         ++ R T     K+
Sbjct: 293 MRRDGVYGLDDALVCGIDIARGGMDNNVIRFRRGMDAKSIKPIKIPGSETRNTTPFIAKV 352

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEML--GYHVYRVLGQKRAVDLEFCRNRRTELHV 418
             LV ++RPDA+ +D+   G    D L  L  G  +  V    +A D     N RT +  
Sbjct: 353 CTLVVEHRPDAVFVDSTGVGGPVADQLRRLLPGVMIIDVNFASQAPD-RHYANMRTYIWW 411

Query: 419 KMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYT 475
           +M + ++    I     ++   +   +   ++ ++A+E K   + +   S D  D L  T
Sbjct: 412 RMREAIKLGLAIESDTELETELTSPEYDHNSSDQIALEKKKDIKKRLGISPDDGDALALT 471

Query: 476 FAENPPRSDMD 486
           F     ++   
Sbjct: 472 FTMPVMKAQYQ 482


>gi|228911519|ref|ZP_04075310.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
 gi|228848128|gb|EEM92991.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
          Length = 459

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 132/494 (26%), Positives = 216/494 (43%), Gaps = 75/494 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +  +F+  +L F+              P  WQ + +       ++   +P
Sbjct: 2   EIIDVYWDDPV--AFAEDMLGFY--------------PDEWQRKVL-------MDLAQSP 38

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 39  -----KVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++                 + +    RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVYMIG------------SEERWFATARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA-- 371
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 -GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 372 -----IIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                I +D +  G    D L      E L + VY V+   + +D E   N   E    +
Sbjct: 316 LKRVDIKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGAEGWAVV 375

Query: 421 ADWLE------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
            D LE               + N   +I    S K + + + G++A+E K   + +G +S
Sbjct: 376 RDLLEENMKAFIQGEEPTMEIPNDEKMISQFSSRK-YRITSRGKIALERKEEMKKRGLQS 434

Query: 466 TDYSDGLMYTFAEN 479
            D +D ++  F + 
Sbjct: 435 PDRADAIVLAFYKP 448


>gi|228968731|ref|ZP_04129698.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228790961|gb|EEM38595.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 459

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 133/494 (26%), Positives = 217/494 (43%), Gaps = 75/494 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +  +F+  +L F+              P  WQ + +       ++   +P
Sbjct: 2   EIIDVYWDDPV--AFAEDMLGFY--------------PDEWQRKVL-------MDLAQSP 38

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 39  -----KVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++                 + +    RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVYMIG------------SEERWFATARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA-- 371
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 -GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 372 -----IIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                I +D +  G    D L      E L + VY V+   + +D E   N  TE    +
Sbjct: 316 LKRVDIKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGTEGWAVV 375

Query: 421 ADWLE------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
            D LE               + N   +I    S K + + + G++A+E K   + +G +S
Sbjct: 376 RDLLEENMKAFIQGEEPTMEIPNDEKMISQFSSRK-YRITSRGKIALERKEEMKKRGLQS 434

Query: 466 TDYSDGLMYTFAEN 479
            D +D ++  F + 
Sbjct: 435 PDRADAIVLAFYKP 448


>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040864|gb|ACT57660.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 367

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 252/359 (70%), Positives = 299/359 (83%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ TN +
Sbjct: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359


>gi|150390341|ref|YP_001320390.1| hypothetical protein Amet_2579 [Alkaliphilus metalliredigens QYMF]
 gi|149950203|gb|ABR48731.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 469

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 131/494 (26%), Positives = 202/494 (40%), Gaps = 74/494 (14%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
            L D  W + +   F+  +L F+              P  WQ + +  +  H        
Sbjct: 7   ALLDNYWDNPVW--FAEDMLGFY--------------PDPWQAKVLMDLAQH-------- 42

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                K ++ +G+G+GKT L +  + W + TRP   VI  A +  QL   LWAE+SKWLS
Sbjct: 43  ----PKVSVRSGQGVGKTGLESIAITWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLS 98

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
                         ++   +             + +    RT    RP+   G H  Y M
Sbjct: 99  KSKVDKLLRWTKTKIYMNGF------------EERWWATARTAV--RPENMQGFHEDY-M 143

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG LT        ++  NP + SG FY+  N+  D +K  ++
Sbjct: 144 LFVVDEASGVADPIMEAILGTLTGY--ENKLLLCGNPTKTSGTFYDSHNRDRDTYKSHKV 201

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG DSDV RV V G FP+ + DS I L + E+A        
Sbjct: 202 SSMDSPRTSKENIEMLKKKYGADSDVFRVRVLGDFPKGEADSLISLEVTEQAAETVVDIS 261

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP---- 369
               L +G DIA  G D T++  R G  +  L  +SK D   T   I   V++ +     
Sbjct: 262 NAYTLNIGADIARFGDDKTIIAPRIGNRVLDLQQYSKKDTMETAGNILRTVDRLKTQHLQ 321

Query: 370 ---DAIIIDANNTGARTCDYLEM------LGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                I ID +  G    D L        LGY +  +    +A D E   N+  E+   +
Sbjct: 322 INKIVIKIDDDGLGGGVTDRLREINRQQSLGYIIVPIKNGSKADDPEHYYNKAAEMWDNI 381

Query: 421 ADWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
            + L+               L     LI+ L + K + V + G + +ESK   + +  +S
Sbjct: 382 RELLDENLSKFLQGEPGVIQLPKDDILIKQLSNRK-YKVDSKGRIELESKDEMKRRIGES 440

Query: 466 TDYSDGLMYTFAEN 479
            D +D ++Y+FA +
Sbjct: 441 PDRADAVIYSFASD 454


>gi|282848875|ref|ZP_06258265.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282581380|gb|EFB86773.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 483

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 134/483 (27%), Positives = 217/483 (44%), Gaps = 27/483 (5%)

Query: 10  ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNS 69
           + ++ +  L       L+F   V   +PWGE GTPLE    P  WQ++ ++ +       
Sbjct: 3   KHDELIEALGALTHDPLAF---VYFAYPWGEPGTPLENMEGPDEWQIQILKDIGEQLKKG 59

Query: 70  VNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS 129
            +       + A+++G GIGK+ L +WL+ + +ST      +  AN+E QL+T  W E+S
Sbjct: 60  KDLQT--AIQEAVASGHGIGKSALISWLIHFAISTHENTRGVVTANTEGQLRTKTWPELS 117

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           KW ++   K  F   + ++  +               K +      +S+  P++F G HN
Sbjct: 118 KWHNMFIAKDLFTYTATAIFSSD----------KDYEKTWRIDAIPWSKNSPESFAGLHN 167

Query: 190 TYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
               + ++ DEAS   DVI     G LT+ N    W    NP R SG+F E F K    W
Sbjct: 168 QGNRILVLFDEASAIDDVIWEVTEGALTDANTEIIWCAFGNPTRNSGRFRECFRKYRKFW 227

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
             +QID+RTV+  + +  E  +  YG DSD  +V V G FP      FI   I ++A  +
Sbjct: 228 NTYQIDSRTVKISNKTKIEEWLEAYGEDSDFFKVRVRGVFPSASDLQFISTEIADKAQKQ 287

Query: 309 EPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR-TTNNKISGLVE 365
              P    + P+I+G D A  G D+  +V+R+G  ++ L    K D        I+   +
Sbjct: 288 VYKPGQFEHLPVIIGVDPAWTGSDSLEIVMRQGYYMKSLASIPKNDDDWRMAQLIAQFED 347

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           +Y+ DA+ ID    G       + LG     +    ++ D     N R  +  +M +WL 
Sbjct: 348 EYKADAVFIDM-GYGTGIYSIGKQLGRKWRLIEFGGKSNDP-VYLNMRAYMWGQMKEWLR 405

Query: 426 FASLI--NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
               I  N   L  ++   ++ I+   G + +ESK   + +G  S +  D L  TFA   
Sbjct: 406 EGGSIPPNDQALYDDIVGPEA-IIDKNGRIQLESKKDMKDRGLPSPNKGDALALTFAARV 464

Query: 481 PRS 483
            + 
Sbjct: 465 VKK 467


>gi|150016512|ref|YP_001308766.1| hypothetical protein Cbei_1636 [Clostridium beijerinckii NCIMB
           8052]
 gi|149902977|gb|ABR33810.1| conserved hypothetical protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 470

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 129/462 (27%), Positives = 201/462 (43%), Gaps = 47/462 (10%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
            +  P  +  + M        + V     +  K ++ +G+G+GKT L + +V W + TRP
Sbjct: 12  YWDNPVWFAEDMMNFHADKWQSEVLMALAQSPKVSVRSGQGVGKTGLESIVVTWYLCTRP 71

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              VI  A +  QL   LWAE+SKWL+    ++  E     ++   +            S
Sbjct: 72  FPKVIATAPTRQQLYDVLWAEISKWLASSKIENLLEWTKTKIYMKGY------------S 119

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           + +    +T +  RP+   G H  Y M  + DEASG  D I   ILG LT        +M
Sbjct: 120 ERWWATAKTAT--RPENMQGFHEDY-MLFVVDEASGVADPIMEAILGTLTGY--ENKLLM 174

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP R SG FY+  N+  D +K F++ +           E +  +Y   SDV RV V G
Sbjct: 175 CGNPTRTSGTFYDSHNRDRDLYKTFKVSSLESPRTSKDNIEMLKRKYHEGSDVWRVRVEG 234

Query: 287 QFPQQDIDSFIPLNIIEEA-LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
           +FP+ + DS I L   E A + +         L +G DIA  G D +V+  R G  +  L
Sbjct: 235 EFPKGESDSLISLEYAETATITKINNIHNNFTLHIGADIARFGNDESVIAPRIGNKVFDL 294

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPD-------AIIIDANNTGARTCDYLEM------LGY 392
             ++K D   T   I    +K++ +        I +D +  G    D L        LGY
Sbjct: 295 LTYTKKDTMETTGNILRATDKFKNEYKHINKVKIRVDDDGLGGGVTDRLREVIRQEGLGY 354

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE------------FASLINHSGLIQNLK 440
            V  +    +A D E   ++  E+   M D LE               L N+  LI+ L 
Sbjct: 355 EVMPIKNGSKANDEEHYSDKSAEMWGNMRDILEENFTNFVQGKEPTIELPNNDKLIKQLS 414

Query: 441 SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
           + K F + + G + +E K   + +  +S D +D ++Y+FAEN
Sbjct: 415 NRK-FRIDSKGRIDLEKKEEMKKRIGESPDLADAVIYSFAEN 455


>gi|209901239|ref|YP_002290878.1| putative terminase B [Clostridium phage phiCD27]
 gi|199612120|gb|ACH91293.1| putative terminase B [Clostridium phage phiCD27]
          Length = 469

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 134/493 (27%), Positives = 210/493 (42%), Gaps = 74/493 (15%)

Query: 15  LFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPN 74
           L D  W + +   F+  +L+F                  WQ + +  +            
Sbjct: 8   LLDCYWDNPVW--FAEDMLNF--------------KADKWQSDVLMAL------------ 39

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
            +  K +I +G+G+GKT L +   +W +STRP   V+  A +  QL   LWAE++KWLS 
Sbjct: 40  AQTPKVSIRSGQGVGKTGLESIATVWYLSTRPFPKVVATAPTRQQLYDVLWAEIAKWLSN 99

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              +   E     ++   +             + +    RT    +P+   G H  Y M 
Sbjct: 100 SKVEKLLEWTKTKVYMKGF------------EERWWATARTAV--KPENMQGFHEDY-ML 144

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
            + DEASG  D I   ILG L+   A    ++  NP R SG FY+  N+  D +K F++ 
Sbjct: 145 FVVDEASGVADPIMEAILGTLS--GAENKLLLCGNPTRTSGTFYDSHNRDRDLYKTFKVS 202

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
           +           E +  +Y   SD  RV V G+FP+ + DS I L  +E +  RE     
Sbjct: 203 SLDSPRTSKDNIEMLKRKYHEGSDPWRVRVLGEFPKGESDSLISLEAVETSTIREVNISN 262

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP----- 369
              L +G DIA  G D T++  R G  +  L  +SK D   T   I   V+K++      
Sbjct: 263 DYILNIGADIARYGDDETIIAPRIGGKVFDLLTYSKKDTMETVGNILRAVDKFKNMYHQI 322

Query: 370 --DAIIIDANNTGARTCDYL------EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
               I  D +  GA   D L      E L Y V  +     A++ +   N+ +E+   M 
Sbjct: 323 NRVKIKTDDDGLGAGVTDRLKEVIRHERLKYEVIPIQNGSSAIEKDKYYNKASEMWDNMR 382

Query: 422 DWLE------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
           + L+               L N   LI+ L + K + V + G++ IESK   + +  +S 
Sbjct: 383 EELDANLSSFIQNKEAIIQLPNDDKLIKQLSNRK-YTVDSKGKIQIESKKEMKKRIGESP 441

Query: 467 DYSDGLMYTFAEN 479
           D +D ++Y+FAEN
Sbjct: 442 DRADAVIYSFAEN 454


>gi|290968649|ref|ZP_06560187.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781302|gb|EFD93892.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 487

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 142/486 (29%), Positives = 232/486 (47%), Gaps = 37/486 (7%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           + E  Q L  L            FV   F W  +   L+G   P++WQ++ ++ V     
Sbjct: 5   DIELLQALGSLASDP------VAFVYFAFDWDSE--ELKG-QNPQTWQIKTLKEVGEGL- 54

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
                      + A ++G GIGK+ L AWL+LW +STRP    +  AN+ TQL+T  WAE
Sbjct: 55  -----SLSTALQHATASGHGIGKSALVAWLILWAISTRPDTRGVVTANTATQLETKTWAE 109

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           +SKW  L   K +F + S ++           C      + +      +S +R ++F G 
Sbjct: 110 LSKWYHLFRGKKFFTLTSTAI----------FCRQEGHERTWRIDAIPWSVDRTESFAGL 159

Query: 188 HNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
           HN    + +I DEAS   + I     G LT+++    W++  NP R +G+F++ F+K   
Sbjct: 160 HNQGNRLLLIFDEASAIDNKIWEVAEGALTDKDTEILWLVFGNPTRSTGRFFDCFHKYKK 219

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            W   +ID+RTV+  + +  +  I  YG+DSD  +V V G+FP      FI   I+  A 
Sbjct: 220 SWITQKIDSRTVDISNKTQLQKWIQTYGIDSDFVKVRVLGEFPDTSDTQFISTAIVRTAW 279

Query: 307 NREP---CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR-TTNNKISG 362
            R P       +AP I+G D A  GGD+TV+ LR+G   E L ++ + D       +++ 
Sbjct: 280 ERRPLRTAEYDFAPCIIGMDPAWTGGDSTVIFLRQGFFSEKLAEYKQNDNDGVMAARLAE 339

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
             +KY  DA+ ID    G     +   +G     V   +++   +   N+R E+   M +
Sbjct: 340 FEDKYHADAVFID-KGYGTGIYSFGVTMGRQWRLVSFAEKS-GAQAYANKRAEMWGNMKE 397

Query: 423 WLEFASLINH-SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
           WL+   +I    GLI+ L + ++F +   GE+ +E K   + +G +S + +D L  TFA 
Sbjct: 398 WLQEGGVIPQVDGLIEELTAPQAF-INARGEIQLEKKEDMKKRGIESPNMADALALTFAY 456

Query: 479 NPPRSD 484
              + +
Sbjct: 457 PVLQRN 462


>gi|282598712|ref|YP_003358792.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300860603|ref|ZP_07106690.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307292389|ref|ZP_07572245.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|258598082|gb|ACV83339.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300849642|gb|EFK77392.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306496518|gb|EFM66079.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|315146097|gb|EFT90113.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
          Length = 484

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 122/490 (24%), Positives = 216/490 (44%), Gaps = 51/490 (10%)

Query: 33  LHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
             F P+ + G  ++ +   P ++  + + +      + V +   +  K ++ +G+G+GKT
Sbjct: 3   KEFIPFADIGAAIDYYYDKPVAFCQDILHLDPDEWQDKVLDDLAKFPKVSVRSGQGVGKT 62

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+    K   +     ++  
Sbjct: 63  ALEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLNNSLIKDLLKWTKTKIYMV 122

Query: 152 PWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI 211
                        DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   I
Sbjct: 123 G------------DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVADPIMEAI 167

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA 271
           LG L+  +     +M  NP  + G FY+  N   D ++  ++ +   +  +    + +I 
Sbjct: 168 LGTLSGFD--NKLLMCGNPNNIEGVFYDSHNTDRDKYRTHKVSSYDSKRTNKENIQMLID 225

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL---IMGCDIAEEG 328
           +YG +SDV RV + G+FP+  +DSFI L I+E A +          +    +G D+A  G
Sbjct: 226 KYGENSDVARVRIYGEFPKGALDSFISLEIVEFAKDINISDSELKHVREGHIGVDVARFG 285

Query: 329 GDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI----SGLVEKYRPDA---IIIDANNTGA 381
            D+T+V  R G        +SK D   T  ++      +++ Y       I +D    G 
Sbjct: 286 DDSTIVFPRIGAKALPFEKYSKQDTMQTTGRVLKAAKRMMDDYPTIKKVFIKVDDTGVGG 345

Query: 382 RTCDYLEM------LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE---------- 425
              D L+       L Y V  V   + + D ++  N+ T++   + + LE          
Sbjct: 346 GVTDRLKEVISDEKLPYEVIPVNNGESSTD-DYYANKGTQIWGDVKELLEQNISNSINGQ 404

Query: 426 --FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
                L +++ LI+ L + K F + + G++ +ESK   + +   S D +D L   F E  
Sbjct: 405 GPTIELPDNANLIKELSTRK-FKMTSNGKIRLESKEDMKKRNVGSPDIADALTLAFYEPF 463

Query: 481 PRSDMDFGRC 490
               ++  + 
Sbjct: 464 RPEPINVKKA 473


>gi|257883493|ref|ZP_05663146.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294614775|ref|ZP_06694675.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|294622490|ref|ZP_06701512.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|257819151|gb|EEV46479.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291592387|gb|EFF23996.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|291598037|gb|EFF29147.1| conserved hypothetical protein [Enterococcus faecium U0317]
          Length = 471

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 125/484 (25%), Positives = 208/484 (42%), Gaps = 51/484 (10%)

Query: 34  HFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT 92
            F P+ + G+ ++ +   P ++  + + +       +V N   E  K ++ +G+G+GKT 
Sbjct: 4   EFIPFADIGSAIDYYYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTA 63

Query: 93  LNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP 152
           L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+    K+  +     ++   
Sbjct: 64  LEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG 123

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL 212
                       DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   IL
Sbjct: 124 ------------DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAIL 168

Query: 213 GFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR 272
           G L+  +     +M  NP  + G FY+  N   D ++  ++ +   +  +    E I+ +
Sbjct: 169 GTLSGFD--NKLLMCGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKK 226

Query: 273 YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD---PYAPLIMGCDIAEEGG 329
           YG +SDV RV + G+FP+  +DSFI L  +E A  ++             +G D+A  G 
Sbjct: 227 YGKESDVARVRIFGEFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGD 286

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS----GLVEKYRPD---AIIIDANNTGAR 382
           D+T++  R          +SK     T   +      L+ +Y       I +D    G  
Sbjct: 287 DSTILFPRIATRALEYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGG 346

Query: 383 TCDYLEML------GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF---------- 426
             D LE L       + V+ V     + D +F  N  T+L   + + LE           
Sbjct: 347 VTDRLEELIEDKHYPFEVFGVNNGSTSED-DFYDNLGTQLWGNIKEMLEENMTANLNGEQ 405

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
               L + S LI+ L + K F + +   + +ESK   + +   S D +D L   F E P 
Sbjct: 406 PVIELPSDSSLIKELSTRK-FKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPPS 464

Query: 482 RSDM 485
               
Sbjct: 465 HYQF 468


>gi|261208032|ref|ZP_05922709.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289567088|ref|ZP_06447483.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260077749|gb|EEW65463.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161103|gb|EFD09008.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 471

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 125/484 (25%), Positives = 207/484 (42%), Gaps = 51/484 (10%)

Query: 34  HFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT 92
            F P+ + G  ++ +   P ++  + + +       +V N   E  K ++ +G+G+GKT 
Sbjct: 4   EFIPFADIGAAIDYYYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTA 63

Query: 93  LNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP 152
           L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+    K+  +     ++   
Sbjct: 64  LEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG 123

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL 212
                       DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   IL
Sbjct: 124 ------------DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAIL 168

Query: 213 GFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR 272
           G L+  +     +M  NP  + G FY+  N   D ++  ++ +   +  +    E I+ +
Sbjct: 169 GTLSGFD--NKLLMCGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKK 226

Query: 273 YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD---PYAPLIMGCDIAEEGG 329
           YG +SDV RV + G+FP+  +DSFI L  +E A  ++             +G D+A  G 
Sbjct: 227 YGKESDVARVRIFGEFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGD 286

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS----GLVEKYRPD---AIIIDANNTGAR 382
           D+T++  R          +SK     T   +      L+ +Y       I +D    G  
Sbjct: 287 DSTILFPRIATRALEYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGG 346

Query: 383 TCDYLEML------GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF---------- 426
             D LE L       + V+ V     + D +F  N  T+L   + + LE           
Sbjct: 347 VTDRLEELIEDKHYPFEVFGVNNGSTSED-DFYDNLGTQLWGNIKEMLEENMTANLNGEQ 405

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
               L + S LI+ L + K F + +   + +ESK   + +   S D +D L   F E P 
Sbjct: 406 PVIELPSDSSLIKELSTRK-FKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPPS 464

Query: 482 RSDM 485
               
Sbjct: 465 HYQF 468


>gi|228950291|ref|ZP_04112468.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228809453|gb|EEM55897.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 495

 Score =  427 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 121/505 (23%), Positives = 200/505 (39%), Gaps = 83/505 (16%)

Query: 13  QKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNN 72
            +L ++   D +  +F   +L                 P  WQ E +  +  H       
Sbjct: 19  TQLLEIYVDDPV--AFVEDILEV--------------EPDPWQKEVLNDIANHSH----- 57

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
                   ++ +G+G+GKT + +W+ +W +  RP   +IC A ++ QL   LWAE++KWL
Sbjct: 58  -------VSVRSGQGVGKTAMESWICIWFLCCRPYPKIICTAPTKQQLYDVLWAEIAKWL 110

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +    K   +     ++   +               +    +T +  RP+   G H  Y 
Sbjct: 111 NSSQVKDLLKWTKTKIYMKGF------------EDRWFATAKTAT--RPENMQGFHEDY- 155

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
           M  I DEASG  D I   ILG L+   +     M  NP + SG F++  NK    +K  +
Sbjct: 156 MLFIADEASGIADDIMEAILGTLS--GSENKLFMCGNPTKTSGVFFDSHNKDRALYKSHK 213

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP-- 310
           + +           E +  +YG  SDV RV V G+FP+ + D+FI L   E A  RE   
Sbjct: 214 VSSADSPRTSKKNIEMLKKKYGEGSDVYRVRVEGEFPRGEADAFISLETAEAARMREVYK 273

Query: 311 ---------------CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRT 355
                               A + +GCD+A  G D T++  RRG  +  L    + D   
Sbjct: 274 VEVIENEEEESTVKEIIPDTAVVEIGCDVARFGSDETIIATRRGWKVLPLQVHHQRDTMY 333

Query: 356 TNNKISGLVEKY--------RPDAIIIDANNTGARTCDYLEM------LGYHVYRVLGQK 401
            +  +    +KY        +   I ID    G    D L+           V  +    
Sbjct: 334 VSGLLVQEAKKYFSWCERTGKRIPIRIDDTGVGGGVTDRLKEVVAENDYPIDVIPINFAS 393

Query: 402 RAVDLEFCRNRRTELHVKMAD-WLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK-- 458
           +           + ++    D  LEF +L +   LI  L S++ + + + G + IE K  
Sbjct: 394 K--GNAEYACIVSVMYGHFKDNCLEFVALPDDEDLIAQL-SVRKYQINSDGRIKIEPKKA 450

Query: 459 -RVKGAKSTDYSDGLMYTFAENPPR 482
            + +G KS D ++ ++  FA   P+
Sbjct: 451 MKDRGLKSPDRAEAVVMAFAPFYPK 475


>gi|332981151|ref|YP_004462592.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
 gi|332698829|gb|AEE95770.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
          Length = 461

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 133/448 (29%), Positives = 198/448 (44%), Gaps = 50/448 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
           + P  WQ E ++ +  +             + A+ +G G+GKT L AW +LW + TRP  
Sbjct: 25  AEPDDWQAETLQALADN------------PRVAVRSGHGVGKTALEAWALLWFLFTRPYP 72

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
            + C A +  QL   LWAE SKWL   P  K +FE Q   +                   
Sbjct: 73  KIPCTAPTREQLHDILWAEASKWLERAPALKPYFEWQKTRI------------VQKQYPG 120

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            +    RT    +P+   G H  + +  I DEASG  D I   I G LT  +A    +M 
Sbjct: 121 RWFATART--SNKPENMAGFHEEH-LLFIIDEASGIADNIFETIEGALTTSDAK--LLMC 175

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
            NP + SG F++ F K    +   ++     + +   + E +  +Y  DSDV RV V G+
Sbjct: 176 GNPTKNSGVFHDAFFKDRSLYWTRKVSCLDSQRVTLEYAERLKRKYHEDSDVYRVRVLGE 235

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
           FP+ + D+FI L+I+E A  R+  PD    L +G D+A  G D TV+  R G  + +L  
Sbjct: 236 FPKAEPDTFISLDIVEAATMRDVEPD--GVLEIGVDVARFGDDETVLAARAGLKLVYLKA 293

Query: 348 WSKTDLRTTNNKISGLVEKY-----RPD-AIIIDANNTGARTCDYLEM------LGYHVY 395
           ++K D  TT      L +       +P   I ID +  G    D          L   V 
Sbjct: 294 YTKQDTMTTAGYAIALAKDLMKECGKPKCTIKIDDDGVGGGVTDRCREVVREEKLYIDVI 353

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASLINHSGLIQNLKSLKSFIVPNTGEL 453
                    D E   N  TE    + D L  E A LIN   LI  L + K + + + G++
Sbjct: 354 DCHNGGAPEDKEHYENWGTEAWAYLRDLLQDEQAELINDEDLIGQLTTRK-YRITSKGKI 412

Query: 454 AIESK---RVKGAKSTDYSDGLMYTFAE 478
           A+ESK   + +G  S D +D ++  +A+
Sbjct: 413 ALESKDEMKRRGLMSPDRADAVVLAYAK 440


>gi|308069786|ref|YP_003871391.1| hypothetical protein PPE_03030 [Paenibacillus polymyxa E681]
 gi|305859065|gb|ADM70853.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 452

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 124/456 (27%), Positives = 186/456 (40%), Gaps = 58/456 (12%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ   +       ++  NNP     + ++ +G+G+GKT L A   LW +S  P   V
Sbjct: 6   PDDWQASTL-------MDLANNP-----RVSVRSGQGVGKTGLEAATALWFLSCFPYPKV 53

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           IC A +  QL   LWAE++KW S  P         +      W    ++       + + 
Sbjct: 54  ICTAPTRQQLHDVLWAEINKWQSKSP---------VLKRILKWTKTKIYM--KNYEERWF 102

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
              RT +  +P+   G H  Y M  I DEASG  D I   ILG L+        +M  NP
Sbjct: 103 ATARTAT--KPENMQGLHEDY-MLFIVDEASGVADPIMEAILGTLSGE--FNKILMCGNP 157

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
            + SG FY+  NK   D+K  ++               +  +YG  SDV RV V G+FP+
Sbjct: 158 TKTSGVFYDSHNKDRADYKTRKVSCLDSPRTSKDNIAMLKRKYGEGSDVWRVRVEGEFPR 217

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
              D+FI L + E A            L +G D+A  G D T +    GP I       K
Sbjct: 218 GGSDTFISLEVAEFAAKEVKLEPTGDMLTIGVDVARFGDDETSMFAGIGPRIVGEHHHFK 277

Query: 351 TDLRTTNNKISGLVEKYR-------PDAIIIDANNTGARTCDYL------EMLGYHVYRV 397
                T   +  L ++ +          I +D +  G    D L      E L Y +  +
Sbjct: 278 KGTMVTAGWVINLAKELQVAHPYLNRIRIRVDDSGVGGGVTDRLSEIVAEEGLPYEIIPI 337

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLE------------FASLINHSGLIQNLKSLKSF 445
                ++D E   N  TE+   + + LE               L +   LI  L + K +
Sbjct: 338 NNGSSSLD-EHYGNLVTEMWASIKEQLEQNMSNFMNGDSSILQLPDDDVLITQLTARK-W 395

Query: 446 IVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            + + G++ +ESK   + +G KS D +D  + TF E
Sbjct: 396 NMTSKGKMLLESKKDMKKRGLKSPDRADAFVLTFGE 431


>gi|54302246|ref|YP_132239.1| terminase large subunit [Photobacterium profundum SS9]
 gi|46915667|emb|CAG22439.1| hypothetical protein PBPRB0566 [Photobacterium profundum SS9]
          Length = 513

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 132/515 (25%), Positives = 213/515 (41%), Gaps = 42/515 (8%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEK------------GTPLEGF 48
           M+++   N E  Q   D+    +  L    FV++ +PW                +  +  
Sbjct: 1   MAKKEEINYEH-QLAIDIGGFYDDPL---GFVMYAYPWDTDPDLQIVKLPEPWASKYDSV 56

Query: 49  SAPRSWQLE----FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
             P +W  E      EV+  +  N V+    + F  +IS+G GIGK+  ++WL+ ++MST
Sbjct: 57  YGPDAWFCEMCDQLQEVIRKNDFNGVDPV--DAFLYSISSGHGIGKSCASSWLIHFVMST 114

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           RP    +  +N+  QL+T  W E+ KW   L NKHWF   +   +   ++ D        
Sbjct: 115 RPNSKGVVTSNTSEQLRTKTWGELGKWTKKLINKHWFVYNNGKGNMNFYHKDY------- 167

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAI-INDEASGTPDVINLGILGFLTERNANRF 223
            ++ +    +T  EE  ++F G H        + DEAS  PD I     G LT+     F
Sbjct: 168 -AETWRVDAQTCREENSESFAGLHCASSTPWYLFDEASAVPDKIWEVAEGGLTDGEP--F 224

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
           W +  NP R SG+F E + +    W R QID+ TV+  +        + YG DSD  RV 
Sbjct: 225 WFVFGNPTRNSGRFRECWRRFRQRWNRKQIDSSTVQVTNKKKISEWESDYGEDSDFYRVR 284

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG--PV 341
           V G FP    +  I   ++E A++R     P +P +M  D+A  GGDN V   R G    
Sbjct: 285 VKGVFPSASSNQKISGALLEAAMSRTAHVIPGSPRVMSLDVARGGGDNCVFRFRHGLNGG 344

Query: 342 IEHLFDWSKT---DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
           +        +   D          L  +++PDA  ID    G    D +  LG++   + 
Sbjct: 345 VRKKVTLPGSEYRDSMKLAAMAVQLCSEFKPDAFFIDETGVGGPVGDRIRQLGFNCIGIN 404

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLIN-HSGLIQNLKSLKSFIVPNTGELAIES 457
              +A D     N R  ++ +  +WL+    ++   GL+  + +++        E+ I  
Sbjct: 405 FASKAPDP-HYANMRAYMYHQWGEWLKAGGSLHYDEGLLTEVGAIEYTHDRKDREILIPK 463

Query: 458 K--RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
              +     STD  D      A         +   
Sbjct: 464 DVIKKAIGISTDDGDACALLHAYPVAPRQQGYNSA 498


>gi|323486060|ref|ZP_08091391.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
 gi|323400627|gb|EGA92994.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
          Length = 476

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 125/473 (26%), Positives = 193/473 (40%), Gaps = 51/473 (10%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
               P  +  E +                E  K AI +G+G+GKT + A  +LW +   P
Sbjct: 20  YRKNPVLFAQEVLLFEPDDWQKQALMDLAESPKVAIKSGQGVGKTGMEAVALLWFLCCYP 79

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              ++  A ++ QL   LW+EVSKW+S  P         L      W    ++       
Sbjct: 80  YPRIVATAPTKQQLHDVLWSEVSKWMSKSP---------LLSDILKWTKTYIYMVGN--E 128

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           K +  + RT +  +P+   G H    M  I DEASG  D I   ILG L+   AN   +M
Sbjct: 129 KRWFAVARTAT--KPENMQGFHED-NMLFIVDEASGVADPIMEAILGTLS--GANNKLLM 183

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP R SG FY+ FN     ++   + +   +  +    E +I +YG DS+V  V V G
Sbjct: 184 CGNPTRTSGTFYDAFNVDRSIYRCHTVSSADSKRTNKQNIESLIRKYGKDSNVVLVRVFG 243

Query: 287 QFPQQDIDSFIPLNIIEEALNREPCPD-PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
           +FP+Q+ D FI L+I+E     +   D P   +  G D+A  G D TV+    G  I   
Sbjct: 244 EFPKQEDDVFIALSIVEHCCMLDLPDDVPIKRISFGVDVARYGSDETVIAKNVGGRITLP 303

Query: 346 FDWSKTDLRTTNNKISGLVEK-------YRPD-AIIIDANNTGARTCDYLEMLG------ 391
             +    L TT  KI  L  +       YR    I ID    G    D LE +       
Sbjct: 304 VSFRGQSLMTTVGKIVQLYRQAITEFPRYRGKIYINIDDCGLGGGVTDRLEEVKQEEKLT 363

Query: 392 -YHVYRVLGQKRAVDL----------EFCRNRRTELHVKMADWL--EFASLINHSGLIQN 438
              +  V    +  +           +   N  T L   + D L  E  SL N + L+  
Sbjct: 364 RMVIVPVNAAGKVPEETLGDGKQKACDIYDNMTTYLWGTVKDALMMEEVSLENDNELVAQ 423

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             + + + + + G++ +ESK   + +G  S D +D +  +  +   +   + G
Sbjct: 424 F-TCRKYRLTSRGKMLLESKEEMKKRGIDSPDRADAVALSCYQ---KKTFNIG 472


>gi|332976102|gb|EGK12970.1| hypothetical protein HMPREF9374_1123 [Desmospora sp. 8437]
          Length = 462

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 122/459 (26%), Positives = 195/459 (42%), Gaps = 39/459 (8%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
               P  +  E ++       +       +  + A+ AG G+GKT   AW VLW + TRP
Sbjct: 17  YIRKPGLFVREVLKAEPDEWQDIALQALADNQRVAVRAGHGVGKTATEAWAVLWFLLTRP 76

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              + C A ++ QL   LW E++KWL   P    + E Q                 +   
Sbjct: 77  FPKIPCTAPTKPQLMDVLWPEIAKWLMNAPELAPYVEWQKTR------------VVMKQY 124

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
            + +    RT    +P+   G H  + +  + DEASG  + I   I G LT   +    +
Sbjct: 125 EERWFATARTS--NKPENMAGFHEEH-LLFVIDEASGVDNAIFETIDGALTTAGSK--LV 179

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
           M  NP R +G FY+ F++  D +  ++I     +     +   +  +YG DSD+ RV V 
Sbjct: 180 MFGNPTRTNGVFYDAFHQDRDLYWTYKISCLDSKMASKDYARNMARKYGEDSDIYRVRVQ 239

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
           G+FPQ D DSFIPL ++E+A  R+        L +G D+A  G D TV+  R GPV   L
Sbjct: 240 GEFPQGDPDSFIPLELVEDARVRDLEWIDEDELHIGVDVARFGSDETVLAARIGPVAFRL 299

Query: 346 FDWSKTD-LRTTNNKIS----GLVEKYRPDA--IIIDANNTGARTCDYLEM------LGY 392
             +        T  ++      L+E++R D   + +D    G    D L+       L  
Sbjct: 300 DRYGGRTPTTETVGRVLALARELMEEHRRDYAVVKVDDTGVGGGVTDQLQEIVAEEGLNI 359

Query: 393 HVYRVLGQKRA-VDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKSFIVP 448
            V           D +   +  TE    + D  +   +   I+   LI  L + K   + 
Sbjct: 360 DVIPCNNGATPEHDPDHYHDWGTESWGTLLDRFKAGEIALKIDDEDLIGQLTTRKK-EMT 418

Query: 449 NTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSD 484
           + G++ +ESK   + +G +S D +D L+  FAE    + 
Sbjct: 419 SKGKIKLESKEKMKKRGQRSPDRADALVLAFAEAATETG 457


>gi|289578588|ref|YP_003477215.1| hypothetical protein Thit_1395 [Thermoanaerobacter italicus Ab9]
 gi|289528301|gb|ADD02653.1| conserved hypothetical protein [Thermoanaerobacter italicus Ab9]
          Length = 460

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 123/464 (26%), Positives = 188/464 (40%), Gaps = 57/464 (12%)

Query: 52  RSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
             W  Q E ++ V  H             + A+ A  G+GKT + AW+ LW + T     
Sbjct: 30  DPWEKQEEILKAVRDHK------------RVAVRACHGVGKTKVAAWVALWFLYTHHNSK 77

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           VI  A +  Q++  LW E+    +                  P    VL   + +  + +
Sbjct: 78  VITTAPTWHQVENLLWREIHAAHAASR--------------IPLGGKVLQTQIELGEQWF 123

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
                  S ++P+ F G H  + + I+ DEASG          GFLT   A    ++  N
Sbjct: 124 ---ALGLSTDKPERFQGFHAEHILLIV-DEASGVEQYTFDAAEGFLTSIGAK--LLLIGN 177

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVE-----------GIDPSFHEGIIARYGLDSD 278
           P +LSG+FY  F  PL  + +  I                  + P + E    ++G DS 
Sbjct: 178 PTQLSGEFYNAFRSPL--YHKIHISAFDSPNLKAGKIVRPYLVTPEWVEDKRLKWGEDSP 235

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR 338
           +    V G+FP+Q  D+ IPL  IE A  R    +   P+ +G D+A  G D TV++LRR
Sbjct: 236 LWYSRVLGEFPEQGNDTLIPLAWIEAAQQRWHMTEAGEPVEIGADVARYGTDTTVIMLRR 295

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
           G   E ++     D      K+    +K   + I ID    GA   D L+  GY V  + 
Sbjct: 296 GDKAEIVYQLRGQDTMEVTGKVIDAFKKTGANVIKIDVVGIGAGVVDRLKEQGYPVQGLN 355

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPNTGELAIE 456
             + A D     N+R E +  + +  +    ++     L   L SLK +   + G + IE
Sbjct: 356 VGESATDKGRFVNKRAEWYWALRERFQEGTIAIPPDDELASQLASLK-YKFDSRGRIQIE 414

Query: 457 SK---RVKGAKSTDYSDGLMYTF----AENPPRSDMDFGRCPSY 493
           SK   R +G  S D +D LM  F     +       D  R  S+
Sbjct: 415 SKEELRRRGLPSPDKADALMLAFSSTGMKPVDEKIKDIFRRASF 458


>gi|255282256|ref|ZP_05346811.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267204|gb|EET60409.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 506

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 111/460 (24%), Positives = 184/460 (40%), Gaps = 48/460 (10%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
               P  +  E ++               E  + A+ +G+G+GKT + A  VLW +S   
Sbjct: 34  YRKDPVLYAREVLQFEPDEWQRDALMDLAEESRVAVKSGQGVGKTGIEAVAVLWFLSCFR 93

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              V+  A +  QL   LW+E++KW    P         L      W    ++       
Sbjct: 94  YARVVATAPTRQQLHDVLWSEIAKWQERSP---------LLKAILRWTKTYVYV--KGYE 142

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           K +  + RT +  +P+   G H    M  I DEASG  D I   +LG L+    N   +M
Sbjct: 143 KRWFAVARTAT--KPENMQGFHED-NMLFIVDEASGVADPIMEAVLGTLS--GGNNKLLM 197

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP R +G FY+ F K    +    + +      D +  + +I +YG DS++ RV V G
Sbjct: 198 CGNPTRTTGTFYDAFTKDRSIFACHTVSSLDSSRTDKNNIDALIRKYGEDSNLVRVRVKG 257

Query: 287 QFPQQDIDSFIPLNIIEEALNRE---PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
            FP+QD D FI   +I++  +R+   P     A +I+G D+A  G D TV+       I+
Sbjct: 258 LFPKQDDDVFISQELIDQCTSRQYELPESRGMAQVILGVDVARYGNDETVIYRNFKGRIK 317

Query: 344 HLFDWSKTDLRTTNNKISGLV----EKYRP----DAIIIDANNTGARTCDYLEMLGYH-- 393
            + +    +L  T   I        + Y        I ID    G    D L  +     
Sbjct: 318 MVRNRRGQNLMATAGDIVREYRHIVDGYPGFDGKIYINIDDTGLGGGVTDRLREVKKEQK 377

Query: 394 -----VYRVLGQKR--------AVDLEFCRNRRTELHVKMADWLEFASLI--NHSGLIQN 438
                +  +   ++            E+  N  T +   + + LE   ++  + +  +  
Sbjct: 378 LTRMVIIPINAAEKIETDTKAGKEAAEYYNNLTTHMWAAVRELLEKREIVIEDDAETVAQ 437

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYT 475
           L   K + V + G++ IE K   + +G  S D +D L  +
Sbjct: 438 LSMRK-YTVASNGKIEIEPKKEMKKRGLDSPDRADALTLS 476


>gi|167767949|ref|ZP_02440002.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|167710278|gb|EDS20857.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|291560988|emb|CBL39788.1| hypothetical protein CL2_30180 [butyrate-producing bacterium SSC/2]
          Length = 473

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 121/488 (24%), Positives = 193/488 (39%), Gaps = 68/488 (13%)

Query: 11  TEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSV 70
            +  +  +    +  + F   VL F+              P  WQ E    +  +     
Sbjct: 7   HDFLVESIPLWQQNPVQFFEEVLFFY--------------PDEWQKEAAFALRDN----- 47

Query: 71  NNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK 130
                   K  I +G+G+GKT   A  +LW +S      V+  A +  QL   LWAEVSK
Sbjct: 48  -------SKVTIKSGQGVGKTGFEAATLLWFLSCFENARVVATAPTLHQLNDVLWAEVSK 100

Query: 131 WLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           W S  P  K   +     +                  + +  + RT +   P+   G H 
Sbjct: 101 WQSKSPLLKEILQWTKTKISMIG------------SKERWYAVARTATT--PENMQGFHE 146

Query: 190 TYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
              M  I DEASG  D I   ILG LT   +N   ++  NP + SG FY+        + 
Sbjct: 147 D-NMLFIVDEASGVADPIMEAILGTLT--GSNNKLLLCGNPTKASGTFYDSHTSDRKLYY 203

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
              +++   +  +    + +I +YG +S+V RV V G FP+QD D ++PL ++E ++  E
Sbjct: 204 CITVNSAESKRTNKDNIDSLIRKYGEESNVVRVRVKGLFPKQDDDVYMPLEMLEASIILE 263

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE---- 365
             P P     +G D+A  G D+TV+       I         DL  T   +         
Sbjct: 264 EIP-PADICTLGVDVARFGDDDTVIARNMNNKITLEKIRHGQDLMKTVGDVVVECRNIKE 322

Query: 366 --KY-RPDAIIIDANNTGARTCDYLEML-------GYHVYRVLGQKRAVDL---EFCRNR 412
             KY +   +IID    G    D L  L       G  +  V       D    E   + 
Sbjct: 323 KFKYKKTIYVIIDDTGLGGGVTDRLNELKSEGKLSGVVIVPVNFSAAVPDKKAAEKYHDI 382

Query: 413 RTELHVKMADWLE--FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTD 467
            +     + D LE   A L N + LI  L S + + + ++G++ +ESK   + +  +S D
Sbjct: 383 TSYAWSILRDMLEEKEAVLPNDTELIAQL-SARKYDLSSSGKIRLESKKAMKERIGESPD 441

Query: 468 YSDGLMYT 475
            +D ++ +
Sbjct: 442 RADAVVLS 449


>gi|332980681|ref|YP_004462122.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
 gi|332698359|gb|AEE95300.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
          Length = 486

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 110/470 (23%), Positives = 182/470 (38%), Gaps = 60/470 (12%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
           + P  + +E +          + +   +  + A+ +  G GK+ +   ++LW + +    
Sbjct: 16  NDPVWFVIEILGTRPWKKQIDIISAVRDNPRTAVRSCHGAGKSFIAGQVILWFLYSFYPS 75

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            V+  A +  Q++  +W EV                S      P   ++L     I    
Sbjct: 76  IVLSTAPTWRQVEKLIWKEVR--------------ASYRRSKVPLGGNLLPKRPEIQIIQ 121

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
                   S   PD F G H    + ++ DEA+G P+ I   I G LT  +A    ++  
Sbjct: 122 DEWYAVGLSTNEPDRFQGFHEE-NILVVVDEAAGVPEEIFEAIEGVLTSEHAR--LLLLG 178

Query: 229 NPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE----------------------------- 259
           NP  + G FY  F  P   W+   I   T                               
Sbjct: 179 NPTSVGGTFYNAFRTPG--WENISISAFTTPNFTAFGITEDDIINKTWESKITNSLPNPK 236

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI 319
            I P++      R+G +S   +  V GQFP +  D+ IPL  IE A+ R        P+ 
Sbjct: 237 LITPAWVADKYRRWGPNSPAYQARVLGQFPSEGEDTLIPLAWIEAAMARWEDTPEGEPIE 296

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A  G D TV+  RRG  +  L  ++K D   T   I  +  K       +D    
Sbjct: 297 IGVDVARFGSDKTVIAARRGQKVLPLNVYAKQDTMETVGCIIMVHRKIGASKTKVDVIGV 356

Query: 380 GARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--------EFASLIN 431
           GA   D L+  G+ V  +   + A D E   N R+EL   M + L        E  +L  
Sbjct: 357 GAGVVDRLKEQGHPVIGINVAEAATDTEKFANLRSELWWNMRELLDPNQRLNPEPIALPP 416

Query: 432 HSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
              L+ +L  +K + + + G + +ESK   + +  +S D +D ++  FA+
Sbjct: 417 DDELLADLSGVK-YKIDSRGRIQVESKEDMKKRLGRSPDRADAVVLAFAK 465


>gi|319956916|ref|YP_004168179.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
 gi|319419320|gb|ADV46430.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
          Length = 462

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 113/419 (26%), Positives = 185/419 (44%), Gaps = 26/419 (6%)

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
              + ++   +    K +I +G G GKTTL AW+VLW    R    +   A +  QL   
Sbjct: 30  KQQMKAIRAIDQGKKKISIRSGHGTGKTTLLAWIVLWWGLGREDAKIPMTAPTGHQLYDL 89

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY-STMCRTYSEERPD 182
           L  E+ KW   +P +              + ++V   +  ID  +    + RT  +++P+
Sbjct: 90  LMPEIRKWREKMPVQ--------------YQNEVEVKTEKIDFANGNFAVPRTARKDQPE 135

Query: 183 TFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
              G H T  +A I DEASG P VI     G +T    +   IM +NP R  G FY+  +
Sbjct: 136 ALQGFHAT-NLAFIIDEASGIPQVIFEVAEGAMTGE--STLVIMAANPTRTEGYFYDSHH 192

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    W+ FQ +    E +   + E    +YG DSDV RV + G+FP+Q  ++   L  +
Sbjct: 193 KNRWQWECFQFNAEESENVSKEWIEEKKRQYGEDSDVYRVRIKGEFPRQSSNAVFSLQEV 252

Query: 303 EEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           ++A  RE   D  A +  G D+A+ G D +V+  R+G     +   S   L      +  
Sbjct: 253 DDATTREIVDDSGAEV-WGLDVADFGDDKSVLAKRKGKHFHEITARSGLTLPDLAGWLIY 311

Query: 363 LVEKY--RPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAVDLEFCRNRRTELHVK 419
              +   +P  I +DA   G+         G   V  V G   A + E   N+R E +  
Sbjct: 312 EYNQAKRKPAVIFVDAIGIGSSLPAVCFEKGLDIVIGVKGSNSASNSEKYHNKRAEWYYN 371

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAI-ESK--RVKGAKSTDYSDGLMYT 475
           + D LE   + +   L+  L + + + + +TG++ + E K  + +  +S D +D    T
Sbjct: 372 LKDLLEDGKIPDDDELVGELMA-QKYQISSTGKIQLVEKKEIKKELGRSPDKADACALT 429


>gi|253578914|ref|ZP_04856185.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849857|gb|EES77816.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 473

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 109/451 (24%), Positives = 180/451 (39%), Gaps = 48/451 (10%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             P  +  E +                   K +I +G+G+GKT L A + LW ++  P  
Sbjct: 4   DDPVMFFREVLNFEPDEWQAQAARDLAANPKVSIKSGQGVGKTGLEAAVFLWFVTCFPHP 63

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            ++  A ++ QL   LW+E+SKW+S                   W    ++     + K 
Sbjct: 64  RIVATAPTKQQLHDVLWSEISKWMSKSELLSIL---------LKWTKTYVYMV--GEEKR 112

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
           +  + RT +  +P+   G H    M  I DEASG  D I   ILG L+   AN   ++  
Sbjct: 113 WFGVARTAT--KPENMQGFHED-NMLFIVDEASGVADPIMEAILGTLS--GANNKLLLCG 167

Query: 229 NPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF 288
           NP + SG FY+   +    +K   + +      +    + ++ +YG DS+V RV V G+F
Sbjct: 168 NPTKTSGTFYDSHTRDRALYKCHTVSSMDSTRTNKENIDSLVRKYGWDSNVVRVRVRGEF 227

Query: 289 PQQDIDSFIPLNIIEEALNREPCPDPYAP---LIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
           P Q+ D FIPL++IE+  ++    D       + +G D+A  G D T++        + +
Sbjct: 228 PNQEDDVFIPLSLIEQCSSKLLELDDADGMQFVSLGVDVARFGDDETIIYRNYHGHCKIV 287

Query: 346 FDWSKTDLRTTNNKISGLVEK-YRPD-------AIIIDANNTGARTCDYLEM-------L 390
            +    +L  T   I    +K YR          + ID    G    D L+         
Sbjct: 288 RNRRGQNLMATVGDIVQEFKKIYREHPTYESKVYVQIDDTGLGGGVTDRLKEVRKEQKLY 347

Query: 391 GYHVYRVLGQKR--------AVDLEFCRNRRTELHVKMADWL--EFASLINHSGLIQNLK 440
              V  +   ++            E   N  T +   M D L  +   + +    I  L 
Sbjct: 348 KMQVIPINAAEKIETDTAAGKDAAERYNNLTTAMWASMRDLLDNKQIVIEDDEQTIGQLS 407

Query: 441 SLKSFIVPNTGELAIESK---RVKGAKSTDY 468
           S K + + + G+L IE K   + +G  S D 
Sbjct: 408 SRK-YTMASNGKLEIEPKKEMKKRGLDSPDR 437


>gi|160940775|ref|ZP_02088117.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436295|gb|EDP14062.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
          Length = 484

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/487 (23%), Positives = 185/487 (37%), Gaps = 70/487 (14%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
           L     P  +  + +          +     +    ++ +G GIGK+ + AW V+W M T
Sbjct: 8   LFYADNPIYFVEDVIRAKPDEKQRDILRSLRDYPMTSVRSGHGIGKSAVEAWSVIWYMCT 67

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           RP   + C A +E QL   LWAE+SKW+   P                W  + L+     
Sbjct: 68  RPFPKIPCTAPTEHQLMDVLWAEISKWMRNNPALRD---------DLIWTKEKLYMQ--G 116

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
             + +  + RT +   P+   G H  + + II DEASG  D +   +LG +T  +A    
Sbjct: 117 HPEEWFAVPRTAT--NPEALQGFHAEHVLYII-DEASGVSDKVFEPVLGAMTGEDAK--L 171

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEV 284
           +M  NP RL+G FY+  ++  + +    +D R  + +  +F + II  +G DSDV RV V
Sbjct: 172 LMMGNPTRLAGFFYDSHHRNREQYSAIHVDGRDSQHVSRTFVQKIIDMFGEDSDVFRVRV 231

Query: 285 CGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPV--- 341
            GQFP+   DS I +   EEA N +    P   + +G D+A  G D++ +          
Sbjct: 232 AGQFPKSTPDSLIAMEWCEEAANLQV-YAPGGQIDIGVDVARYGDDSSALYPLIDKKQSL 290

Query: 342 IEHLFDWSKTDLRT--TNNKISGLVEKYRPDAI--IIDANNTGARTCD------------ 385
              L+  ++T          I      Y   AI   +D +  G    D            
Sbjct: 291 PYELYHHNRTTEIAGYVVIMIKQFAMDYPDAAIRVKVDCDGLGVGVYDNLYDQRDQIIDA 350

Query: 386 ----YLEMLGYH-------------------VYRVLGQKRA-----VDLEFCRNRRTELH 417
                    G +                   +               D     N    + 
Sbjct: 351 IWYDRCRRAGINPEDGNQWNECQNVPKLDLEIIECHFGGSGGKVDDNDPVEYSNSTGLMW 410

Query: 418 VKMADWLEFASL--INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGL 472
            K+  +L+   L   +   L+  L + + ++V   G+L +E K   + +G  S D +D L
Sbjct: 411 GKVRKYLQEGKLQLPDDDTLVSQLCNRR-YLVNKDGKLELERKESMKKRGLTSPDIADAL 469

Query: 473 MYTFAEN 479
                E 
Sbjct: 470 ALALYEP 476


>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 255

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 250/255 (98%), Positives = 254/255 (99%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
           IGKTTLNAWLVLWLMS RPG+S+ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS
Sbjct: 1   IGKTTLNAWLVLWLMSIRPGMSIICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 60

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI
Sbjct: 61  LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 120

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
           NLGILGFLTE+NANRFWIMTSNPRRLSGKFYEIFN+PLDDWKRFQIDTRTVEGIDPSFHE
Sbjct: 121 NLGILGFLTEQNANRFWIMTSNPRRLSGKFYEIFNRPLDDWKRFQIDTRTVEGIDPSFHE 180

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
           GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE
Sbjct: 181 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 240

Query: 328 GGDNTVVVLRRGPVI 342
           GGDNTVVVLRRGPVI
Sbjct: 241 GGDNTVVVLRRGPVI 255


>gi|266623290|ref|ZP_06116225.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
 gi|288864932|gb|EFC97230.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
          Length = 484

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 107/488 (21%), Positives = 191/488 (39%), Gaps = 72/488 (14%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
           L     P  +  + + V        +     +    ++ +G G+GK+ + +W V+W + T
Sbjct: 8   LFYADEPIYFVEDIIRVTPDQKQRDILRSLRDYPMTSVRSGHGVGKSAVESWSVIWFLCT 67

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLG 163
           RP   + C A ++ QL   LWAE+SKWL   P  K+        ++   +          
Sbjct: 68  RPFPKIPCTAPTQHQLYDILWAEISKWLRNNPELKNDIIWTQQRVYMNGY---------- 117

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
              + +  + RT +   P+   G H  + + II DEASG  D +   +LG +T  +A   
Sbjct: 118 --PEEWFAVPRTAT--NPEALQGFHAEHVLYII-DEASGVSDKVFEPVLGAMTGEDAK-- 170

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            +M  NP RLSG F++  +K   ++    ID R  + ++  F + II  +G+DSDV RV 
Sbjct: 171 LLMMGNPTRLSGFFFDSHHKSRSEYSAMHIDGRDSQHVNQKFVQKIINMFGMDSDVFRVR 230

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           V GQFP+   DS I ++  E A   +P       + +G D+A  G D++ +      V  
Sbjct: 231 VAGQFPKSTPDSLIMMDWCEAATQLKPETVRN-RVDIGVDVARYGDDSSALYPVIDKVQS 289

Query: 344 HLFD-WSKTDLRTTNNKISGLVEKYRPD------AIIIDANNTGARTCDYLE-------- 388
             ++ +        +  +  ++++Y  +       + +D +  G    D L         
Sbjct: 290 DGYELYHHNRTTEISGYVVQMIKRYAVECLDAVIRVKVDCDGLGVGVYDNLYDLTDQIID 349

Query: 389 ---------------------------MLGYHVYRVLGQKRA-----VDLEFCRNRRTEL 416
                                       L   +               D     N    +
Sbjct: 350 EVWRDRCRREGLDPDNGNQWNECQRIPQLDLEIVECHFGAAGGKIDEDDPVEYSNSTGLM 409

Query: 417 HVKMADWLEFAS--LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDG 471
             K+   L+  +  + +   LI  L + + +IV   G+L +E K   + +G  S D +D 
Sbjct: 410 WGKIRKLLQTGALQIPDDDALISQLSNRR-YIVNKDGKLELERKEAMKKRGLPSPDIADA 468

Query: 472 LMYTFAEN 479
           L     + 
Sbjct: 469 LALALYDP 476


>gi|153810665|ref|ZP_01963333.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
 gi|149833061|gb|EDM88143.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
          Length = 469

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 123/465 (26%), Positives = 195/465 (41%), Gaps = 53/465 (11%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
           L   + P  +  + ++         +     E    ++ +G GIGK+ + AW V+W M T
Sbjct: 8   LYYANHPVEFVQDILKADPDPEQKKILRSLVENQMTSVRSGHGIGKSAVEAWSVIWFMCT 67

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
            P   + C A ++ QL   LWAE+SKW                     W  + L+     
Sbjct: 68  HPYPKIPCTAPTQHQLFDILWAEISKWKRN---------NKTLDSELIWTKEKLYM--KG 116

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
            ++ +  + RT S   PD   G H  + M  I DEASG  D I   +LG L+   A    
Sbjct: 117 HAEEWFAVARTAST--PDALQGFHAEH-MLYIIDEASGVEDKIFEPVLGALSTPGAK--L 171

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEV 284
           +M  NP +LSG FY+  NK  + +  F ID R    +   F + II  YG DSDV RV V
Sbjct: 172 LMCGNPTQLSGFFYDSHNKNREQYSTFHIDGRNSTRVSQEFVQTIINMYGEDSDVFRVRV 231

Query: 285 CGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI-MGCDIAEEGGDNTVVVLRRGPVIE 343
            G FP  + D +IPL ++E+++  E  P  +  +I +GCD+A  G D TV+  R    ++
Sbjct: 232 AGDFPLAEDDIYIPLPLVEKSIATEYFPRRHPQIIHIGCDVARFGTDKTVIGYRTDEKVQ 291

Query: 344 HLFDWSKTDLRTTNNKISG----LVEKYR-------PDAIIIDANNTGARTCDYLEMLGY 392
                   D   T + I      LV +Y        P  I ID    G    D L  +  
Sbjct: 292 FFKKRVGQDTMKTADDIVSLGMLLVYQYGLKPDIDEPIPIKIDDGGVGGGVVDRLRQIKR 351

Query: 393 H---------VYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-----------FASLINH 432
           +         VY V   ++ +  +F  +  T +   +   L+              L + 
Sbjct: 352 NNPERFWWMEVYPVKFGQK-IRHKFFDDSTTYMMSVLKKLLQPFDDNGLPKDVEIILPDD 410

Query: 433 SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
             L+  +   K + +    ++ +ESK   + +G +S D +D ++ 
Sbjct: 411 DALVAQISGRK-YEMTENSKIRVESKKVMKARGVQSPDEADCILL 454


>gi|148653111|ref|YP_001280204.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
 gi|148572195|gb|ABQ94254.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
          Length = 520

 Score =  340 bits (871), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 91/490 (18%), Positives = 181/490 (36%), Gaps = 73/490 (14%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
           +WQ E +            +      + ++++G G GK+     + LW +   P   ++ 
Sbjct: 41  TWQQELL----------FKSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLF 90

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHC-----SLGIDSK 167
            A    QL+T +W E++  L  L N               W +D +        +     
Sbjct: 91  TAPQIGQLRTVVWKEINICLQRLRNNK----------ALGWLADYVVVLAEKIYIKGFKD 140

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            +    +T  + +P    G H  + M +  DEA G  D +    +G LT  N     ++T
Sbjct: 141 TWFVFAKTAPKHQPTNIAGQHGDHYM-VWADEACGIDDAVMEVAIGALTHENNRA--VLT 197

Query: 228 SNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRV 282
           S P + +G FY+  +K        W   + +      +        + +YG  +S    +
Sbjct: 198 SQPAKNTGFFYDTHHKLSHHNGGKWTALEFNGEMSPIVSKDKLIEALYQYGSRNSPGYLI 257

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY---APLIMGCDIAEE-GGDNTVVV--- 335
            + G+FP+     ++      E + ++PC         +I+  D+  + G D++V+    
Sbjct: 258 RIRGKFPELK-GEYLLTRTDYENMKQQPCVIEEGDKWGIIVAVDVGGDVGRDSSVISVMQ 316

Query: 336 ----LRRGPVIEHLFDW------SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
               + +G +  H+         ++ ++ T   KI+ ++  Y    ++ID    G     
Sbjct: 317 VVDKMIKGRIERHVHLLDIPLFSNRANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQ 376

Query: 386 YLEMLGYHVYRVLGQKRAVD---LEFCRNRRTELHVKMADWLEFA---SLINHSGLIQNL 439
            L+  G +   V       +     +  N+R+  +V MA  +E            + Q +
Sbjct: 377 SLKADGVYFDEVHWGSPCFNNTLKRYYMNKRSHAYVSMAKAVEKGYFSVSDKVKKMYQVM 436

Query: 440 KSLKS------FIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
            +L+       +         + SK+    KG KS D +D + + F EN           
Sbjct: 437 TNLEEQMTRLPYYFDEKARWCMMSKKDMLKKGIKSPDIADTIAFGFMEN-------ISYA 489

Query: 491 PSYQYEGVDL 500
           P   YE +++
Sbjct: 490 PVESYEDLNI 499


>gi|332974843|gb|EGK11758.1| hypothetical protein HMPREF9373_1714 [Psychrobacter sp. 1501(2011)]
          Length = 520

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 90/490 (18%), Positives = 180/490 (36%), Gaps = 73/490 (14%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
           +WQ E +            +      + ++++G G GK+     + LW +   P   ++ 
Sbjct: 41  TWQQELL----------FKSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLF 90

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHC-----SLGIDSK 167
            A    QL+T +W E++  L  L N               W +D +        +     
Sbjct: 91  TAPQIGQLRTVVWKEINICLQRLRNNK----------ALGWLADYVVVLAEKIYIKGFKD 140

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            +    +T  + +P    G H  + M +  DEA G  D +    +G LT  N     ++T
Sbjct: 141 TWFVFAKTAPKHQPTNIAGQHGDHYM-VWADEACGIDDAVMEVAIGALTHENNRA--VLT 197

Query: 228 SNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRV 282
           S P + +G FY+  +K        W   + +      +        + +YG  +S    +
Sbjct: 198 SQPAKNTGFFYDTHHKLSHYNGGKWIALEFNGEMSPIVSKEKLIEALYQYGSRNSPGYLI 257

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY---APLIMGCDIAEE-GGDNTVVV--- 335
            + G+FP+     ++      E +   PC         +I+  D+  + G D++V+    
Sbjct: 258 RIRGKFPELK-GEYLLTRTDYENMKAHPCVIKEGDKWGIIVTVDVGGDVGRDSSVISVLQ 316

Query: 336 ----LRRGPVIEHLFDW------SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
               + +G +  H+         ++ ++ T   KI+ ++  Y    ++ID    G     
Sbjct: 317 VVDKMVKGRIERHVHLLDIPLFSNRANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQ 376

Query: 386 YLEMLGYHVYRVLGQKRAVD---LEFCRNRRTELHVKMADWLEFA---SLINHSGLIQNL 439
            ++  G +   V       +     +  N+R+  +V MA  +E            + Q +
Sbjct: 377 SVKADGVYFDEVHWGSPCFNNTLKRYYMNKRSHAYVSMAKAVEKGYFSVSDKIKKMYQVI 436

Query: 440 KSLKS------FIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
            +L+       +         + SK+    KG KS D +D + + F EN           
Sbjct: 437 TNLEEQMTRLPYYFDEKARWCMMSKKDMLKKGIKSPDIADTIAFGFMEN-------ISYA 489

Query: 491 PSYQYEGVDL 500
           P+  YE +++
Sbjct: 490 PAESYEDLNI 499


>gi|83593922|ref|YP_427674.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
 gi|83576836|gb|ABC23387.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
          Length = 505

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 111/463 (23%), Positives = 176/463 (38%), Gaps = 62/463 (13%)

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
           P   K  + AG G+GKTT  A  + W +         C A + +QL+  LW+E+++    
Sbjct: 34  PAGAKVTVRAGHGVGKTTATAAAIWWHLECFDYSKTPCTAPTASQLEQILWSELARLRRR 93

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLH-CSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY-- 191
              +        +L     ++      +     + +  + RT   ++PD   G H +   
Sbjct: 94  ADARAQGTGLPAALRLEALFAVSGRAIADRGTPREWFVVARTARRDQPDALQGFHASDID 153

Query: 192 ----------------GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSG 235
                            +  + +EASG PD +     G L+   A    +M  NP R +G
Sbjct: 154 LEAGAGPRLSAKSGGAALMFVIEEASGVPDAVFEVAEGALSSPGAR--LLMVGNPTRNTG 211

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
            F     +    +   ++       +DP +  G++ +YG +S+V RV   G FP+QD D 
Sbjct: 212 FFARSHKRDRASFTALRLRCADSPLVDPGYRAGLVRKYGAESNVVRVRADGAFPRQDDDV 271

Query: 296 FIPLNIIEEALNREPCPDPYAP---LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD 352
            I L   E AL R P P   A      +G D+A  G D TV +LR GPV+  +   +  D
Sbjct: 272 LIALETAEAALAR-PLPARMATEDERRLGVDVARFGDDRTVFLLRIGPVVGAIEVTAGRD 330

Query: 353 LRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG----YHVYRVLGQKRAVDLEF 408
                 +   L E +R   I +D    GA   D L   G             +RA   E 
Sbjct: 331 TMAVAGRARRLAEIWRAGRIYVDEIGVGAGVVDRLREDGAPVVAVNVAASAPERAAGEER 390

Query: 409 CRNRRTELHVKMADWLE------------------------FASLI---NHSGLIQNLK- 440
            R  R  L + +  WL                           S +     + L Q+L  
Sbjct: 391 GRLLRDHLWLMVRGWLRDEAPVFAGPGGGPASGSAAGLLSGMGSCLVPGVDADLAQDLAG 450

Query: 441 --SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
             +   +    +G + +ESK   + +G +S D +D L  TF E
Sbjct: 451 ELATPRYAFDGSGRVVVESKDAMKRRGLRSPDLADALALTFHE 493


>gi|269119479|ref|YP_003307656.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
 gi|268613357|gb|ACZ07725.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
          Length = 499

 Score =  323 bits (829), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 99/472 (20%), Positives = 177/472 (37%), Gaps = 53/472 (11%)

Query: 58  FMEVVDAHCLNSVNNPNPEVF----KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICL 113
           F ++++ H L+       + F    + ++ AG   GK++L   L  + + TRP   VI  
Sbjct: 22  FKDILNFHFLSEDQTRVLQAFNEYRRLSVPAGHSTGKSSLAGGLTTYWLITRPKSRVIVT 81

Query: 114 ANSETQLKTTLWAEVSKWLSLLP---------------------NKHWFEMQSLSLHPAP 152
           A +  QLKT  WAEV+K  +                         + WF +   +  P  
Sbjct: 82  APTYRQLKTIYWAEVNKIYNRSKLKQLNLFEINDKIMRINDKDLKREWFALPVTASTPEG 141

Query: 153 WYS---------DVLHCSLGI----DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
                       + +   LGI    D +    + +    E+    +   +   + ++ DE
Sbjct: 142 MQGQHGDKTEVIEQIMKHLGIEEIGDDETIEIVSQILRGEKQIEGLTKEDKEKLLVMVDE 201

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE 259
           +SG  + I   + G  T+ +     ++  N  + +G FYE    P   + +  + +    
Sbjct: 202 SSGVKNEIFEVLEG--TDYD---KLVLFGNMTKNTGYFYESVYNPKSKFYKVTMSSYNSP 256

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI 319
            +       +   YG DS+V RV + G+ P  + +S    N I+ A  R      Y  + 
Sbjct: 257 FMKKEQIHDLEETYGPDSNVVRVRLKGEAPDGNENSIFSSNKIDSAFQRSLSLSEYETIK 316

Query: 320 MGCDIA-EEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII--IDA 376
           +G D+    GGD++ +  ++   +    D     L     +I     K R   II  ID 
Sbjct: 317 LGVDVGKGSGGDSSTIYEKKDNRVRKKLDRKDFTLPDVKREIIQYCYKNRDKLIIANIDG 376

Query: 377 NNTGARTCDYLEM---LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS 433
              G      LE        V  +    +A + +   N+RTE++ +++  L+   L    
Sbjct: 377 TGLGTGLVQELEEGEIENLVVNDIQFAGKAKNKKEFNNKRTEMYFELSRNLDKLDLEEDQ 436

Query: 434 GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
            L + L  ++ +   N G   + SK   +     S D SD L     E   R
Sbjct: 437 ELKRELL-IQIYEFDNNGRFKLISKDKIKEMLGHSPDKSDALALCNYEAETR 487


>gi|312964323|ref|ZP_07778627.1| terminase B protein [Escherichia coli 2362-75]
 gi|331655801|ref|ZP_08356790.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
 gi|312291036|gb|EFR18910.1| terminase B protein [Escherichia coli 2362-75]
 gi|323186470|gb|EFZ71817.1| terminase B protein [Escherichia coli 1357]
 gi|323969205|gb|EGB64507.1| terminase B protein [Escherichia coli TA007]
 gi|325495624|gb|EGC93488.1| DNA pacase B subunit [Escherichia fergusonii ECD227]
 gi|331046575|gb|EGI18664.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
          Length = 494

 Score =  315 bits (807), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 92/483 (19%), Positives = 182/483 (37%), Gaps = 54/483 (11%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPNKHWFEMQSLSLHP 150
            + + +++  +   PG   I +AN   Q+ T ++  +   W +      W       L  
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSRFPWLA-DYFVLTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             +Y              ++ + + +     +   G H  + + II DEASG  D     
Sbjct: 123 TAFYEVTGKGV-------WTVVPKGFRLGSEEALAGEHADHLLYII-DEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K       P   +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 --SLINHSGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
              L   +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIPV-GINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSD 484
             D
Sbjct: 472 PQD 474


>gi|324111095|gb|EGC05081.1| terminase B protein [Escherichia fergusonii B253]
          Length = 494

 Score =  315 bits (806), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 92/483 (19%), Positives = 182/483 (37%), Gaps = 54/483 (11%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPNKHWFEMQSLSLHP 150
            + + +++  +   PG   I +AN   Q+ T ++  +   W +      W       L  
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSRFPWLA-DYFVLTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             +Y              ++ + + +     +   G H  + + II DEASG  D     
Sbjct: 123 TAFYEVTGKGV-------WTVVPKGFRLGSEEALAGEHADHLLYII-DEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K       P   +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRILEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 --SLINHSGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
              L   +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIPV-GINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSD 484
             D
Sbjct: 472 PQD 474


>gi|56266643|gb|AAV84926.1| DNA pacase B subunit [Enterobacteria phage phiW39]
          Length = 494

 Score =  314 bits (805), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 92/483 (19%), Positives = 182/483 (37%), Gaps = 54/483 (11%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPNKHWFEMQSLSLHP 150
            + + +++  +   PG   I +AN   Q+ T ++  +   W +      W       L  
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKINWATATSRFPWLA-DYFVLTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             +Y              ++ + + +     +   G H  + + II DEASG  D     
Sbjct: 123 TAFYEITGKGV-------WTVVPKGFRLGSEEALAGEHADHLLYII-DEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K       P   +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +A Y G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 --SLINHSGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
              L   +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIPV-GINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSD 484
             D
Sbjct: 472 PQD 474


>gi|168467778|ref|ZP_02701615.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|195629119|gb|EDX48493.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
          Length = 494

 Score =  313 bits (803), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 94/482 (19%), Positives = 181/482 (37%), Gaps = 52/482 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
             + + W      +  F    +WQ +         + SV  P     K ++S+G G GK+
Sbjct: 16  AQYRYDWIAAADVM--FGKTPTWQQD-------QIIESVQEPGS---KTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS-KWLSLLPNKHWFEMQSLSLHP 150
            + + +++  +   PG   I +AN   Q+ T ++  +   W +      W   +   L  
Sbjct: 64  DMTSIMIMLFIIMFPGARAIIVANKIQQVMTGIFKYLKINWSTATSRFPWLA-EYFVLTD 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             +Y              ++ + + +     +   G H  + + II DEASG  D     
Sbjct: 123 TSFYEITSKGV-------WTVVPKGFRLGNEEALAGEHADHLLYII-DEASGVSDKAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           + G LT ++     +  S P R SG FY+  +K       P   +    +++     + P
Sbjct: 175 MTGALTGKDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPNGIYTAITLNSEESPLVTP 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F +  +A Y G DS +  ++V G FP+      +  + +E A  R+         I   
Sbjct: 233 EFIKMKLAEYGGRDSPMYLIKVRGLFPKTQDGFLLGRDEVERASRRKVKIAKGWGWIACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + ++S         KI+     ++Y    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGERNKRRIIGYRIIEYSDVTETQLAAKINAECSPDRYPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I+ID +  G  T D L +  G    R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IVIDGDGLGKSTADLLYDNYGITAQRIRWGKKMHSREDRSLYFDQRAYANVQAAEAVKSG 412

Query: 428 SLINHSGLIQ-NLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPPR 482
            +    G       S     + + G+  + S    K+    +S D+ D   +    N   
Sbjct: 413 RMRLDKGDATIEEASKIPVGINSAGQWKVMSKEDMKKKLNLRSPDHWDTYCFGMLANYVP 472

Query: 483 SD 484
            +
Sbjct: 473 QN 474


>gi|56266666|gb|AAV84947.1| DNA pacase B subunit [Enterobacteria phage D6]
          Length = 502

 Score =  309 bits (792), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 101/444 (22%), Positives = 176/444 (39%), Gaps = 38/444 (8%)

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
           +      +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++
Sbjct: 49  SVQETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQY 108

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
            +    +H +      L    +Y              +  +C+ Y     +   G H  +
Sbjct: 109 WANAVKRHGWLQTYFVLSDTMFYERSRKGI-------WEVLCKGYRLGNEEALAGEHAAH 161

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------P 244
            + +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P
Sbjct: 162 -LLLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNP 218

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
              W    +++     + P F +  +  Y G DS    V+V GQFP++     +  +  +
Sbjct: 219 KGIWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECD 278

Query: 304 EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL--------RRGPVIEHLFDWSKT-DLR 354
            A  R+   +     +   D+   G D +V+ +        +R  V   + + S T D  
Sbjct: 279 RAARRKVLLEKNWGWVATADVG-NGRDKSVLNICKVSGHRDKRRVVNFKVMEMSGTMDPL 337

Query: 355 TTNNKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKR---AVDLEFC 409
              + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E  
Sbjct: 338 AFADFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERF 397

Query: 410 RNRRTELHVKMADWLEFASLINHSGLIQNLKSLK-SFIVPNTGELAIESKR----VKGAK 464
            N+R   ++   D ++   +   S      ++ K  F++   G++A+  K         K
Sbjct: 398 VNQRAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIK 457

Query: 465 STDYSDGLMYTFAENPPRSDMDFG 488
           S D  D   +T   +   ++ D G
Sbjct: 458 SPDRWDTYCFTMLVDYVPANEDIG 481


>gi|323179619|gb|EFZ65182.1| terminase B protein [Escherichia coli 1180]
          Length = 453

 Score =  309 bits (791), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 100/442 (22%), Positives = 174/442 (39%), Gaps = 38/442 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +
Sbjct: 2   QETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWA 61

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +H +      L    +Y              +  +C+ Y     +   G H  + +
Sbjct: 62  NAVKRHGWLQTYFVLSDTMFYERSRKGI-------WEVLCKGYRLGNEEALAGEHAAH-L 113

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLD 246
            +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P  
Sbjct: 114 LLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKG 171

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W    +++     + P F +  +  Y G DS    V+V GQFP++     +  +  + A
Sbjct: 172 IWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRA 231

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVL--------RRGPVIEHLFDWSKT-DLRTT 356
             R+   +     +   D+   G D +V+ +        +R  V   + +   T D    
Sbjct: 232 ARRKVLLEKNWGWVATADVG-NGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPLAF 290

Query: 357 NNKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKR---AVDLEFCRN 411
            + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E   N
Sbjct: 291 ADFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERFVN 350

Query: 412 RRTELHVKMADWLEFASLINHSGLIQNLKSLK-SFIVPNTGELAIESKR----VKGAKST 466
           +R   ++   D ++   +   S      ++ K  F++   G++A+  K         KS 
Sbjct: 351 QRAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIKSP 410

Query: 467 DYSDGLMYTFAENPPRSDMDFG 488
           D  D   +T   +   ++ D G
Sbjct: 411 DRWDTYCFTMLVDYVPANEDIG 432


>gi|304399103|ref|ZP_07380971.1| DNA packaging protein [Pantoea sp. aB]
 gi|304353343|gb|EFM17722.1| DNA packaging protein [Pantoea sp. aB]
          Length = 503

 Score =  308 bits (790), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 107/503 (21%), Positives = 189/503 (37%), Gaps = 57/503 (11%)

Query: 34  HFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTL 93
           + + W      +E F    +WQ E         +NSV     +     +++G G GK++L
Sbjct: 23  YRYNWALA--VVELFGMIPTWQQE-------EIMNSVQETGSQ---TTVTSGHGTGKSSL 70

Query: 94  NAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPW 153
            A ++L  M   P   VI +AN   Q+KT ++  V  + +    +H +     +L    +
Sbjct: 71  TAMMLLIYMIMYPDARVIIVANKIGQVKTGVFKYVKTYWANAARRHPWLQNYFTLTDTMF 130

Query: 154 YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILG 213
           Y              +  +C+ Y     +   G H  + + I+ DEASG  D     + G
Sbjct: 131 YEKSRKGI-------WEVLCKGYRLGNEEALAGEHAAHILLIL-DEASGISDKAIAIMRG 182

Query: 214 FLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDPSFH 266
            LTE +     +M S P R SG FY+  +        P   W    +++     +   F 
Sbjct: 183 ALTEEDNR--MLMMSQPTRPSGYFYDSHHSLARHPDNPNGFWNAIVLNSEEAPHVTLKFI 240

Query: 267 EGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIA 325
              +  Y G DS    V+V G+FP+      +  +  + A  R+   +     +   D+ 
Sbjct: 241 REKLVEYGGRDSLEYMVKVLGRFPRNVSGYLLGRDECDRAARRKVYLEKGWGWVATADVG 300

Query: 326 EEGGDNTVVVLR--------RGPVIEHLFDWSKT-DLRTTNNKISGLV--EKYRPDAIII 374
             G D +++ +         R  V   L +   T D  +  + I+     E+Y    I +
Sbjct: 301 -NGRDKSILNICKVSGYGDARRVVSFKLLEMPGTMDPISFGDYIANECTQERYPGITIAV 359

Query: 375 DANNTGARTCDYLEMLGYHVYRVLGQKRAVDL---EFCRNRRTELHVKMADWLEFASL-I 430
           D +  G+ T   LE  G +   +   +        E  +N+R   ++  AD +    + I
Sbjct: 360 DGDGVGSGTLKQLERRGVNAISIRWGQPPFSKKVRERFKNQRAWSNIMAADAIRSGRMRI 419

Query: 431 NHSGLIQNLKSLKSFIVPNTGELAIESK----RVKGAKSTDYSDGLMYTF------AENP 480
           + S       S   + +   G + +  K    +    KS D  D   + F      AE  
Sbjct: 420 DMSQHTAEQASKIPYFMDEMGRIMMVPKPQMRQKLNIKSPDRWDTYCFIFLIGYRPAEAE 479

Query: 481 PRSDM-DFGRCPSYQYEGVDLLI 502
              DM DF +    +   +D L+
Sbjct: 480 LSEDMADFTQSKLDELSELDALL 502


>gi|323948959|gb|EGB44853.1| terminase B protein [Escherichia coli H252]
          Length = 502

 Score =  307 bits (787), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 99/444 (22%), Positives = 175/444 (39%), Gaps = 38/444 (8%)

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
           +      +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++
Sbjct: 49  SVQETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQY 108

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
            +    +H +      L    +Y              +  +C+ Y     +   G H  +
Sbjct: 109 WANAVKRHGWLQTYFVLSDTMFYERSRKGI-------WEVLCKGYRLGNEEALAGEHAAH 161

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------P 244
            + +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P
Sbjct: 162 -LLLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSRAKTPDNP 218

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
              W    +++     + P F +  +  Y G DS    V+V GQFP++     +  +  +
Sbjct: 219 KGIWTAIVLNSEESPFVTPQFIKEKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECD 278

Query: 304 EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL--------RRGPVIEHLFDWSKT-DLR 354
            +  R+   +     +   D+   G D +V+ +        +R  V   + +   T D  
Sbjct: 279 RSARRKVLLEKNWGWVATADVG-NGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPL 337

Query: 355 TTNNKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKR---AVDLEFC 409
              + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E  
Sbjct: 338 AFADFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERF 397

Query: 410 RNRRTELHVKMADWLEFASLINHSGLIQNLKSLK-SFIVPNTGELAIESKR----VKGAK 464
            N+R   ++   D ++   +   S      ++ K  F++   G++A+  K         K
Sbjct: 398 VNQRAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIK 457

Query: 465 STDYSDGLMYTFAENPPRSDMDFG 488
           S D  D   +T   +   ++ D G
Sbjct: 458 SPDRWDTYCFTMLVDYVPANEDIG 481


>gi|307308936|ref|ZP_07588619.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
 gi|306900570|gb|EFN31183.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  307 bits (785), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 109/439 (24%), Positives = 190/439 (43%), Gaps = 38/439 (8%)

Query: 80  GAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKH 139
             +    G GKT ++A  + W +     + V   A SE+ +K+ +W E            
Sbjct: 50  ITVKGSSGWGKTFISAISLWWSLIVFDPVKVTIFAPSESTIKSGIWNE------------ 97

Query: 140 WFEMQSLSLHPAPWYSDVLHCS-LGIDSKHYSTMC----RTYSEERPDTFVGHHNTYGMA 194
              +Q L  + AP + ++   S   I  K     C    R  S++      G H+   + 
Sbjct: 98  ---LQVLYSNMAPLFRELFEVSATKIFRKSRGETCWAEYRLVSKDNIAAARGFHSKNNI- 153

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP--LDDWKRFQ 252
           +I DEASG  DVI  G L  +         ++ SNP + SG F++ +  P    DW +  
Sbjct: 154 VIADEASGIEDVIFTGALLNVLNDGPGAKVVLVSNPDKASGFFFKTWRDPELSKDWIKVH 213

Query: 253 IDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-NREP 310
              R      P   E     YG + S      V G+FP  D+D  I    ++EA+ N++ 
Sbjct: 214 GSIRDKPNYTPGEEERFARLYGGVTSRDYLTLVEGEFPLSDVDGLISREFLDEAVTNKDA 273

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV----EK 366
            P+P AP+I G D A  G D +V+ +R   V+    +W+  +      ++  L     +K
Sbjct: 274 IPNPKAPIIWGLDPAGAGKDKSVLAIRHDNVLRGFEEWAGLEPVALALRVKELYLKTSKK 333

Query: 367 YRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK-RAVDLEFCRNRRTELHVKMADWLE 425
            RP  I +D N  GA   D L+     VY+ +  +    + +     R ++  +M +W+ 
Sbjct: 334 DRPAVIAVDGNGLGAGVYDALKHFKIPVYKCMFAEVPKRNPDRYTRVRDQIWFEMREWIH 393

Query: 426 FA--SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
               S+ NH  LI++L ++ ++   ++ ++ IE K   + +  +S DY+D L  TF+ + 
Sbjct: 394 TGDVSIPNHKKLIEDL-AIPTYE--DSPKIKIEDKKSLKKRLGRSPDYADALALTFSVSH 450

Query: 481 PRSDMDFGRCPSYQYEGVD 499
            R    +      +Y+ + 
Sbjct: 451 TRYASKYQWDKPIEYDNLS 469


>gi|260871239|ref|YP_003238019.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
 gi|257767818|dbj|BAI39311.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
          Length = 494

 Score =  306 bits (784), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 90/482 (18%), Positives = 177/482 (36%), Gaps = 52/482 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ +         + S           ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQD-------EIIESTQQDGSW---TSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKHWFEMQSLSLHP 150
            + + + +  +   PG  VI +AN   Q+   ++  + S W + +    W   +   L  
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFPWLS-KYFILTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             ++              ++ + ++      +   G H  + + II DEASG  D     
Sbjct: 123 TSFFEVTGKGV-------WTILIKSCRSGNEEALAGEHADHLLYII-DEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINHSGLIQ-NLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPPR 482
            +    G       S     + + G+  + S    K+     S D+ D   +    N   
Sbjct: 413 RMRLDKGAATIEEASKIPVGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYVP 472

Query: 483 SD 484
            D
Sbjct: 473 QD 474


>gi|46401730|ref|YP_006576.1| PacB [Enterobacteria phage P1]
 gi|301646767|ref|ZP_07246623.1| putative terminase B protein [Escherichia coli MS 146-1]
 gi|129547|sp|P27753|TERL_BPP1 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|68597607|sp|Q5XLR0|TERL_BPP7 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|33323612|gb|AAQ07582.1|AF503408_106 PacB [Enterobacteria phage P7]
 gi|215636|gb|AAA21724.1| pacB [Enterobacteria phage P1]
 gi|33338757|gb|AAQ14080.1| PacB [Enterobacteria phage P1]
 gi|33338866|gb|AAQ14188.1| PacB [Enterobacteria phage P1]
 gi|54112354|gb|AAV28854.1| PacB [Enterobacteria phage P7]
 gi|301075042|gb|EFK89848.1| putative terminase B protein [Escherichia coli MS 146-1]
          Length = 494

 Score =  306 bits (783), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 90/482 (18%), Positives = 177/482 (36%), Gaps = 52/482 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ +         + S           ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQD-------EIIESTQQDGSW---TSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKHWFEMQSLSLHP 150
            + + + +  +   PG  VI +AN   Q+   ++  + S W + +    W   +   L  
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFPWLS-KYFILTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             ++              ++ + ++      +   G H  + + II DEASG  D     
Sbjct: 123 TSFFEVTGKGV-------WTILIKSCRPGNEEALAGEHADHLLYII-DEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINHSGLIQ-NLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPPR 482
            +    G       S     + + G+  + S    K+     S D+ D   +    N   
Sbjct: 413 RMRLDKGAATIEEASKIPVGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYVP 472

Query: 483 SD 484
            D
Sbjct: 473 QD 474


>gi|331649955|ref|ZP_08351031.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
 gi|331041212|gb|EGI13366.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
          Length = 494

 Score =  305 bits (782), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 90/482 (18%), Positives = 177/482 (36%), Gaps = 52/482 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L  F    +WQ +         + S           ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVL--FGKTPTWQQD-------EIIESTQQDGSW---TSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV-SKWLSLLPNKHWFEMQSLSLHP 150
            + + + +  +   PG  VI +AN   Q+   ++  + S W + +    W   +   L  
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFPWLS-KYFILTE 122

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
             ++              ++ + ++      +   G H  + + II DEASG  D     
Sbjct: 123 TSFFEVTGKGV-------WTILIKSCRPGNEEALAGEHADHLLYII-DEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +A Y G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL--------RRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +        +R  +   + +++         KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMQEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINHSGLIQ-NLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPPR 482
            +    G       S     + + G+  + S    K+     S D+ D   +    N   
Sbjct: 413 RMRLDKGAATIEEASKIPVGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYVP 472

Query: 483 SD 484
            D
Sbjct: 473 QD 474


>gi|48697461|ref|YP_024846.1| Pas60 [Actinoplanes phage phiAsp2]
 gi|47679679|gb|AAT36808.1| Pas60 [Actinoplanes phage phiAsp2]
          Length = 492

 Score =  304 bits (779), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 105/461 (22%), Positives = 173/461 (37%), Gaps = 53/461 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
            +P +W  + ++V  A     + +  P   + A+    G+GK+   A LV W  +TR  +
Sbjct: 21  DSPTAWAADCLDVRLAGYQGEILDAVPRERRVAVRGPHGLGKSFSGAILVNWFATTRDLM 80

Query: 109 ----SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
                +I  A++   L+  LW E+ KW           +  ++L  AP+        L +
Sbjct: 81  GKDWKIITTASAWRHLEVYLWPEIHKWAG--------RINFVALGRAPYNPRTELLDLRL 132

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA---- 220
              H +      +  +P+   G H    +  + DEA   P      I G  +        
Sbjct: 133 KLTHGAATA--VASNQPERIEGAHAEE-LLYLLDEAKIVPPATWDSIEGAFSNAGVDVAD 189

Query: 221 NRFWIMTSNPRRLSGKFYEIFNK--PLDDWKRFQIDTRT---VEGIDPSFHEGIIARYGL 275
           N +    S P   SG+FY+I  +    +DW    +          I  ++ +   +++G 
Sbjct: 190 NAYAFAMSTPGAPSGRFYDIHRRAPGYEDWWTRHVTLEEAIASGRISRAWADQRRSQWGS 249

Query: 276 DSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP------CPDPYAPLIMGCDIAEEGG 329
           DS V    V G+F   D DS IPL  +E A+ R         P P  PL  G D+   GG
Sbjct: 250 DSAVFHNRVLGEFHASDEDSVIPLAWLEAAIERWHEWDRQGRPSPGGPLWTGVDVGR-GG 308

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           D TV+  R G  +  L    + D   T   I     + R    IID    GA   D L  
Sbjct: 309 DETVLAARDGWAVT-LETNRRRDTMATVGLI-----QAREGRAIIDVIGLGAGVFDRLRE 362

Query: 390 LGYHVYRVLGQKRAVDLEF-----CRNRRTELHVKMADWLE-----FASLINHSGLIQNL 439
           LG       G   A   +        N R+  +  + + L+       +L     +I +L
Sbjct: 363 LGTRPLAYTGSAGATVRDRSGKFGFTNTRSAAYWNLRELLDPAFDPVLALPPDDLMISDL 422

Query: 440 KSLKSFIVPNT--GELAIESKRV---KGAKSTDYSDGLMYT 475
            +   + V      ++ +E K     +  +S D  D +  +
Sbjct: 423 TT-PHWEVTTGVPPKIKVEPKDKVVERLGRSPDRGDAIAMS 462


>gi|323516996|gb|ADX91377.1| hypothetical protein ABTW07_0941 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|323518424|gb|ADX92805.1| hypothetical protein ABTW07_2381 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 663

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 89/431 (20%), Positives = 154/431 (35%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     E    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSKQSLEEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               ++  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYVITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWLEFAS-----LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V +A  +           ++  +   L  +  +   +     I SK   +  G KS D  
Sbjct: 554 VGLARAIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|299769795|ref|YP_003731821.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
 gi|298699883|gb|ADI90448.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
          Length = 668

 Score =  297 bits (759), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 91/431 (21%), Positives = 153/431 (35%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     E    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSKQSLEEQRQKYGSRDDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               I+  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYIITVDVGGGVGRDDSVIVISKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWLEFAS-----LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V  A  +           ++  +   L  +  +   +     I SK   R  G KS D  
Sbjct: 554 VGFARAVASGRFKMKTKKHYVKIKDQLIHIP-YRFDDFARYKILSKDEMRRMGIKSPDLG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|256392042|ref|YP_003113606.1| hypothetical protein Caci_2856 [Catenulispora acidiphila DSM 44928]
 gi|256358268|gb|ACU71765.1| conserved hypothetical protein [Catenulispora acidiphila DSM 44928]
          Length = 484

 Score =  295 bits (755), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 88/479 (18%), Positives = 164/479 (34%), Gaps = 58/479 (12%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
             + P  W  + +          +     +    A+ +  G GK+ + + L  W + T P
Sbjct: 24  YLADPARWVDDKLGEYLWSRQVDIATSVRDQRLTAVQSCHGTGKSFVASRLTAWWLDTHP 83

Query: 107 --GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
                V+  A +  Q+K  LWAE++K  +    +         ++   W  D    + G 
Sbjct: 84  PGEAFVVTTAPTGDQVKAILWAEINKAFAKAEARG--TPLPGRINETDWKYDKFLVAFG- 140

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
                    R  S+  P  F G H  Y + +I DEA G         L   T  +     
Sbjct: 141 ---------RKPSDYNPHAFQGIHAKYVL-VILDEACGISKQFWTAALAIATGVHCRI-- 188

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE--------------GIDPSFHEGII 270
           +   NP      F ++       W   +I  R                  +  ++   + 
Sbjct: 189 LAIGNPDDPGSHFAQVCKSDR--WNMIKIAARDTPNFTGEEVPDDLADMLVSQAYVLDMA 246

Query: 271 ARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP----CPDPYAPLIMGCDIAE 326
             +G +S +   +V  +FP    D  + L+ +  A  REP     PD   P+ +G D+  
Sbjct: 247 EEFGPESPIYLSKVDAEFPSDASDGVVRLSKL-MACTREPVHPYAPDRLVPVELGVDLGA 305

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            GGD T +  RRG      +   + D     + I   + +     + +D+   G      
Sbjct: 306 -GGDETCIRERRGIAAGREWRNREKDSEKVVDHIVRAIRETGATKVKVDSIGIGWGIVGS 364

Query: 387 LEMLG------YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL-EFAS-------LINH 432
           L+           V  V   + +   E     R+++  ++   L E            + 
Sbjct: 365 LQARRKQGLHTAEVVGVNVSEASTQPEKYARLRSQIWWEVGRKLSEDGGWDLSQLDTTDR 424

Query: 433 SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN-PPRSDMDF 487
             L+  L + K + +  +G + +E K   + +  +S D +D L+  F     P+  +  
Sbjct: 425 DRLVSQLTAPK-YDLDASGRIVVEKKEETKKRIGRSPDNADALLLAFYTPSVPKPGIRV 482


>gi|184158505|ref|YP_001846844.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
 gi|183210099|gb|ACC57497.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
          Length = 663

 Score =  295 bits (755), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 87/431 (20%), Positives = 153/431 (35%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     +    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               ++  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYVITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWLEFAS-----LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V +   +           ++  +   L  +  +   +     I SK   +  G KS D  
Sbjct: 554 VGLQRAIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|213156231|ref|YP_002318651.1| phage terminase [Acinetobacter baumannii AB0057]
 gi|301346399|ref|ZP_07227140.1| phage terminase [Acinetobacter baumannii AB056]
 gi|301594275|ref|ZP_07239283.1| phage terminase [Acinetobacter baumannii AB059]
 gi|213055391|gb|ACJ40293.1| phage terminase [Acinetobacter baumannii AB0057]
          Length = 663

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 88/431 (20%), Positives = 156/431 (36%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     +    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               ++  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWL-----EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V +A  +     +  +  ++  +   L  +  +   +     I SK   +  G KS D  
Sbjct: 554 VGLARAIANGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|332852816|ref|ZP_08434408.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332871045|ref|ZP_08439658.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
 gi|332729027|gb|EGJ60377.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332731805|gb|EGJ63085.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
          Length = 663

 Score =  295 bits (754), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 88/431 (20%), Positives = 154/431 (35%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     +    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               ++  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWLEFAS-----LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V +A  +           ++  +   L  +  +   +     I SK   +  G KS D  
Sbjct: 554 VGLARAIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|260551382|ref|ZP_05825582.1| phage terminase [Acinetobacter sp. RUH2624]
 gi|260405545|gb|EEW99037.1| phage terminase [Acinetobacter sp. RUH2624]
          Length = 663

 Score =  295 bits (754), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 88/431 (20%), Positives = 154/431 (35%), Gaps = 51/431 (11%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S             +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEIS-----------INLAR 256

Query: 146 LSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
           L   P  W +D +        +    + +    +T  + +P    G+H    M  + DEA
Sbjct: 257 LKQGPLAWLADYVGYQSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEA 315

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTR 256
           SG  D +     G LT  +     +MTS P R +G FYE  +K        W     +  
Sbjct: 316 SGVDDAVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGE 373

Query: 257 TVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
               +     +    +YG   D   ++ V G+FP    +  I     EE        D +
Sbjct: 374 ESPLVSEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDH 433

Query: 316 A-PLIMGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKI 360
               ++  D+    G D++V+V+             RR  V++     ++ D+     KI
Sbjct: 434 QFGYVITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKI 493

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELH 417
           + L+ +Y    +++D N  G     YL+  G     V    +     + +   N+R+  +
Sbjct: 494 NELLLQYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAY 553

Query: 418 VKMADWLEFAS-----LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           V +A  +           ++  +   L  +  +   +     I SK   +  G KS D  
Sbjct: 554 VGLARAIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIG 612

Query: 470 DGLMYTFAENP 480
           D   + F EN 
Sbjct: 613 DAFAFLFLENV 623


>gi|216906085|ref|YP_002333619.1| terminase [Abalone shriveling syndrome-associated virus]
 gi|216263178|gb|ACJ72002.1| terminase [Abalone shriveling syndrome-associated virus]
          Length = 507

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 109/470 (23%), Positives = 187/470 (39%), Gaps = 45/470 (9%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            WQLE ++ + A      ++    V   A+S G G GKT L+  L +W     PG     
Sbjct: 50  DWQLEIVDYI-AKFFRKNSDEKHFVCAIAVSGGNGTGKTKLSKALNIWRFCCHPGSRQFI 108

Query: 113 LANSETQLK----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
           L NSE Q K    T L   +SK LS +       ++S + + +P  +D        D   
Sbjct: 109 LTNSERQTKRTGFTMLVRRISKLLSCIA-----ALESSAYYYSPAVADKPEVRTN-DMWD 162

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
            + + ++ +E       G H+   M    DE++   D +   +    T+     F   T 
Sbjct: 163 VTYLLQSSTEA---ALSGLHHPM-MTFSFDESTYFNDHVWQALENMWTQGQVLCF--CTG 216

Query: 229 NPRRLSGKFY-EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR-------YGLDSDVT 280
           NP   +  ++  +FNK L       + TR V  ++        AR       YG      
Sbjct: 217 NPSHDNNNYFARLFNKSLHKKDSLWL-TRCVSLLELPLKYRNDARARYIEEHYGKTHPRY 275

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD-PYAPLIMGCDI--AEEGGDNTVVVLR 337
              V GQFP+++  +   +  I EA+ RE   +  + P+IMG D+  +   G  + + +R
Sbjct: 276 IASVLGQFPKKNTCNPFDITAISEAMEREVREEFIHHPVIMGIDVSISANNGSASAICVR 335

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL-----EMLGY 392
            G  +  L ++          K+  L+++ +P  +++DAN  G    + L     E    
Sbjct: 336 EGTAVRVLREYRCH-YTEFRIKLLELLQEIKPTIVVVDANGVGFGLYEELHRTLPETSNV 394

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASLINHSGLIQNLKSLKSFIVPNT 450
            VY V     A       ++ +EL  K ++W   E  S+  +   +  L SL       +
Sbjct: 395 RVYGVRAHAEAFLKSEYADKMSELAKKSSEWFNNELVSIPKNYQFLNALTSLS--FADAS 452

Query: 451 GELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           G++ +  K   + K   S D +D    TF +     +MD+ +     Y  
Sbjct: 453 GKIKLIGKTDAKKKVDLSMDMADAFFLTFLDGV---EMDWAQGVKDNYLD 499


>gi|134287454|ref|YP_001109621.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
 gi|134131876|gb|ABO60570.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
          Length = 509

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 84/457 (18%), Positives = 157/457 (34%), Gaps = 49/457 (10%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           ++    H +   ++ + +  + ++S+G G GKT+  A + LW +      + I  A   +
Sbjct: 34  LKAPTHHQIQMFDSVSKQGSRTSVSSGHGTGKTSGFAIIALWHLLCYYLSNTILTAPKIS 93

Query: 119 QLKTTLWAEVSKWLSLLPNKHW-FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS 177
            +   +W E +   + + N    +  +   +       +     +     ++  + ++  
Sbjct: 94  TVSDGVWKEFADLSTKISNGPQSWIWEYFVI-------ESERVYVRGYKLNWFVIAKSAP 146

Query: 178 EERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
              P+   G H  + +  + DEASG PD     I G LT+        + S P R SG F
Sbjct: 147 RGSPENLAGAHRDW-LLWLADEASGIPDDNFGVITGSLTDE--RNRMCLASQPTRSSGFF 203

Query: 238 YEIFN----KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           YE  +         W     ++     +   F      +Y  +    +++V G+FP+   
Sbjct: 204 YETHHALSRAEGGPWNNLVFNSEFSPIVSAKFIAEKKLQYTEEE--YQIKVQGRFPENSS 261

Query: 294 DSFIPLNIIEEALNREPC-PDPYAPLIMGCDIAEEG-GDNTVV----VLRRGPV------ 341
              +    IE  + R    PD +   ++  D+   G  D TV+    V+ RG        
Sbjct: 262 KYLVGPQAIEACVGRTVIKPDEHWGWLLPVDVGGGGWRDETVMPALHVIGRGEYGMDARR 321

Query: 342 ---IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR-V 397
              I      +  D    +  I     +      +IDA   G   C  L++ G+  YR V
Sbjct: 322 AQLISVPLHSNTQDPAQLHGVIVHAARERSNATAMIDAGGMGLIVCKQLDLDGFSQYRKV 381

Query: 398 LGQKRAVDLEF---CRNRRTELHVKMADWLEFA--SLINH------SGLIQNLKSLKSFI 446
                    E+     N+R +     A  +      +           L++    +  F 
Sbjct: 382 NWGNPNFAKEYKDRYVNQRAQACCGFARAITEGRFGINPDVPKSFVKKLVKQGSRIPYFW 441

Query: 447 VPNTGELAIESKRVK----GAKSTDYSDGLMYTFAEN 479
                   I  K          S D  D L + F E+
Sbjct: 442 -DEKARRQIMKKEDMREKENLPSPDVFDALSFAFLED 477


>gi|228924410|ref|ZP_04087639.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228835241|gb|EEM80653.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 293

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 77/283 (27%), Positives = 124/283 (43%), Gaps = 30/283 (10%)

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEV 284
            +  NP R SG FY+  N+  D +K  ++ +           E +  +YG  SDV RV V
Sbjct: 2   FLCGNPTRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVRV 61

Query: 285 CGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEH 344
            G+FP+ + D+FIPL I+E+A + +  P     L +G D+A  G D TV+  R G  +  
Sbjct: 62  LGEFPKAEADAFIPLEIVEQAASCKVEPT-GETLDLGVDVARFGDDETVIAPRIGNKVFK 120

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGARTCDYL------EMLG 391
           L +  K D   T   +  L ++Y           I +D +  G    D L      E L 
Sbjct: 121 LLNHYKQDTMETAGHVLKLAKEYMAKYKQLKRVDIKVDDSGVGGGVTDRLKEVIKSERLP 180

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE------------FASLINHSGLIQNL 439
           + VY V+   + +D E   N   E    + D LE               + N   +I   
Sbjct: 181 FKVYPVVNNGKPLDDEHYDNAGAEGWAVVRDLLEENMKAFIQGEEPTMEIPNDEKMISQF 240

Query: 440 KSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            S K + + + G++A+E K   + +G +S D +D ++  F + 
Sbjct: 241 SSRK-YRITSRGKIALERKEEMKKRGLQSPDRADAIVLAFYKP 282


>gi|226227228|ref|YP_002761334.1| hypothetical protein GAU_1822 [Gemmatimonas aurantiaca T-27]
 gi|226090419|dbj|BAH38864.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 549

 Score =  273 bits (697), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 106/544 (19%), Positives = 177/544 (32%), Gaps = 91/544 (16%)

Query: 13  QKLFDLMWSDEIKLSFSNFVLHFFP----WGEKGTPLEGFSAPRSWQLEFMEVVDAHCLN 68
             + D        L ++   L        W      L        W            L 
Sbjct: 10  SLVIDHSAYRHDPLGWAEVALGVSRETLLW-----SLFDAYGTHEW------DGTPDPLA 58

Query: 69  SVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV 128
           +V     +    A+++G G GKT L A L+LW ++  P      +A    Q +  +W EV
Sbjct: 59  TVLEAIAKNQWVAVASGTGTGKTFLEAVLLLWWIAVEPDSIATTVATKADQQEKGIWREV 118

Query: 129 SK-WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           ++ W          E+ +L +   PW  D              T      EE      G 
Sbjct: 119 ARHWPRFQACFPEAELTTLRIRMEPWRGDAWGA-------WGITAAPKAGEESSSAVQGL 171

Query: 188 HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR---RLSGKFYEIFNKP 244
           H    + I+ DE  G P  +   ++   T            NP       G+F E     
Sbjct: 172 HAKR-LLILVDETPGVPQPVMTALVNTATGE--ENVIAAFGNPDYQADPLGQFAET---- 224

Query: 245 LDDWKRFQIDTRTVEGI-----------DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
                  +I       +                     +YG++S V +  V G  P+Q  
Sbjct: 225 -KRVTAIRISALDHPNVVLGVERIPGAATRLSIATREDKYGVESGVYQSRVRGIAPEQSA 283

Query: 294 DSFIPLNIIEEALNREPCPDPYA----PLIMGCDIAE-EGGDNTVVVLRRGPVIEHLFDW 348
            + I L     A +R       A    P  +G D+A+ E GD   V + +G  +  +   
Sbjct: 284 SALIHLAWCVAAADRAESVQHAALALGPKALGVDVAQSENGDKAAVAMGQGARLLSVIAK 343

Query: 349 SKTDLRTTNNKISGLVEKYR--PDAIIIDANNTGARTCDYL------EMLGYHVYRVLGQ 400
           +  +      ++  L+      P+ + +D    GA T ++L      E  G  V R  G 
Sbjct: 344 ACPNATKLGAEVWQLMRDEGIVPEYVGVDPIGVGAATVNHLDGECEKENAGRSVVRCSGG 403

Query: 401 KRAV----------------DLEFCRNRRTELHVKMADWLEFA--SLINHSGLIQNLKSL 442
            +A+                D    +N R ++  ++ + L     +L     L + L ++
Sbjct: 404 AKAMEASSRAADGSAMEWLADANKFKNLRAQMWWQLREDLRNGLIALPRDRELFRELTTV 463

Query: 443 KSFIVPNTGELA-IESK---RVKGAKSTDYSDGLMY-------TFAENPPRSDMDFGRCP 491
           +       G +  +ESK   R +  +S D +D ++Y       T    PP    D  R P
Sbjct: 464 Q---FDEDGGIVTLESKDDIRKRLGRSPDRADAVVYWNWVRPRTRVNQPPPEGFDVAR-P 519

Query: 492 SYQY 495
              Y
Sbjct: 520 IRNY 523


>gi|159897183|ref|YP_001543430.1| hypothetical protein Haur_0654 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890222|gb|ABX03302.1| conserved hypothetical protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 472

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 100/490 (20%), Positives = 169/490 (34%), Gaps = 82/490 (16%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEV-FKGAISAGRGIGKTTLNAWLVLWLMS 103
           L     P ++  E +  V       +        ++  + A   +GKT L   LV W   
Sbjct: 2   LPYAHDPVAYAREVLGEVWWTKQELIARSLLTPPYRTLVKACHKVGKTHLGGGLVNWWYD 61

Query: 104 TRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
           +     V+  A ++ Q++  LW EV   +       +   +S  L   P +         
Sbjct: 62  SFDPGLVLTTAPTDRQVRDLLWKEVR--MQRRGRAGFTGPKSPRLESTPDH--------- 110

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                       ++ +  D+F GHH+ + +  I DEA G   V          E  A   
Sbjct: 111 --------FAHGFTAKDGDSFQGHHSPHTL-FIFDEAVGVASVFWETAESMFNEGGA--- 158

Query: 224 WIMTSNPR---------RLSGKFYEI----------------FNKPLDDWKRF-QIDT-- 255
           W+   NP           LSG ++ I                   P     R  ++DT  
Sbjct: 159 WLAIFNPTDTSSQAYAEELSGGWHVISMSVLEHPNILAELQGLPPPFPSAIRLSRVDTLL 218

Query: 256 ----RTVEGIDPSFHEGIIAR--YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
               R +   +P     I  R  +     +    + G++P Q  ++       + A +  
Sbjct: 219 KKWCRALSPEEPKRATDIHWRDAWYRPGPIAEARLLGRWPSQATNNVWSDGAFQVAESL- 277

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY-- 367
             P    P  +GCD+A  G D T + +RRG    +    +      T  ++  L  +Y  
Sbjct: 278 LLPASDEPCELGCDVARYGDDFTEIHVRRGGHSLYHEAANGWSTVETAGRLKQLANEYGR 337

Query: 368 ------RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
                 R  A+ ID +  G    D     GY    V G + A D E   NRR+EL   +A
Sbjct: 338 RCGVDGRAVAVKIDDDGIGGGVVDL--ADGYTFLGVSGARTAYDPEKYPNRRSELWFSVA 395

Query: 422 D-----WLEFASLINHSGLIQNLK---SLKSFIVPNTGELAIESK---RVKGAKSTDYSD 470
           +      L F +L   +   + L+      ++   + G   +E K   + +  +S D  D
Sbjct: 396 ERAMEQRLSFVAL--DAETRRELRRQAMAPTWKQDSQGRRVVEPKADTKKRIKRSPDGMD 453

Query: 471 GLMYTFAENP 480
            +   +A  P
Sbjct: 454 AVNLAYAPAP 463


>gi|322656964|gb|EFY53248.1| DNA packaging protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
          Length = 411

 Score =  255 bits (652), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 77/327 (23%), Positives = 132/327 (40%), Gaps = 30/327 (9%)

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
           +      +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++
Sbjct: 49  SVQETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQY 108

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
            +    +H +      L    +Y        GI    +  +C+ Y     +   G H  +
Sbjct: 109 WANAVKRHGWLQTYFVLSDTMFYE---RSRKGI----WEVLCKGYRLGNEEALAGEHAAH 161

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------P 244
            + +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P
Sbjct: 162 -LLLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNP 218

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
              W    +++     + P F +  +  Y G DS    V+V GQFP++     +  +  +
Sbjct: 219 KGIWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECD 278

Query: 304 EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL--------RRGPVIEHLFDWSKT-DLR 354
            A  R+   +     +   D+   G D +V+ +        +R  V   + +   T D  
Sbjct: 279 RAARRKVLLEKNWGWVATADVG-NGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPL 337

Query: 355 TTNNKISGLV--EKYRPDAIIIDANNT 379
              + I      EKY    I +DA+  
Sbjct: 338 AFADFIYNECTPEKYPNITIAVDADGL 364


>gi|262316909|emb|CBA18135.1| putative terminase B [Paenibacillus phage phiBP]
          Length = 248

 Score =  252 bits (644), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 104/242 (42%), Gaps = 16/242 (6%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
              +P+++  E +         SV++   +    ++ +G+G+GKT L A + LW +   P
Sbjct: 23  YRKSPKTFFKEILNFSPDKWQESVSDDIAKYRFVSVRSGQGVGKTALEAAISLWFLCCFP 82

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              V+C A +  QL   LWAE+SKW S  P         +      W    ++       
Sbjct: 83  FPRVVCTAPTRQQLNDVLWAEISKWQSQSP---------ILKRILKWTKTKIYM--KNYE 131

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           + +    RT +  +P+   G H  Y M  I DEASG  D I   I G L+         M
Sbjct: 132 ERWFATARTAT--KPENMQGFHEDY-MLFIVDEASGVDDRIMAAIFGTLSGDY--NKLFM 186

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP + SG F++  N+    ++  ++             E + A+YG  SDV RV V G
Sbjct: 187 CGNPTKTSGFFFDSHNRDRAIYRTHRVSCLDSPRTSKENIEMLKAKYGEGSDVWRVRVLG 246

Query: 287 QF 288
           +F
Sbjct: 247 EF 248


>gi|111222161|ref|YP_712955.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
 gi|111149693|emb|CAJ61385.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
          Length = 535

 Score =  247 bits (631), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 92/467 (19%), Positives = 151/467 (32%), Gaps = 59/467 (12%)

Query: 47  GFSAPRSWQLEFMEVV-DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTR 105
               P  W  + +  V        + N      K A+ +    GK+ + A  V   + T 
Sbjct: 52  YRDEPVRWARDRLGGVHLWSKQQEIINALRVHRKVAVPSCHDAGKSFVAAAAVAHWLDTH 111

Query: 106 PG--ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
           P      I  A +  Q++  LW E+ +   L+            ++   W  D    + G
Sbjct: 112 PPGSAFAITTAPTFPQVRAILWREIRRLSRLM------NPPLGRVNQTEWLIDDDLVAFG 165

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                     R  ++     F G H  Y + ++ DEA G P  + +      T  NA   
Sbjct: 166 ----------RKPADHDEGGFQGIHAQYPL-VVLDEAGGIPQQLWIAADSIATNENARI- 213

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE--------------GIDPSFHEGI 269
            +   NP   +  F ++    L  W    I                     +  ++ E  
Sbjct: 214 -LAIGNPDDPTSYFAQVC--ELPSWHVITIPAAETPAFTGEQIPDDLRQALLSRAWAEEK 270

Query: 270 IARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA---PLIMGCDIAE 326
              +G D+ V   +V  QFP+      I  + + +       P P +   P+ +G D+  
Sbjct: 271 RREWGEDNPVYISKVLAQFPKDVAWKVIKASDVAKRRIGRDEPWPASKLRPVCLGVDVG- 329

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
           EG D TVV  RRG      +     +       I   V       + IDA   G      
Sbjct: 330 EGRDWTVVRERRGVQAGREWQARTPEPEQAVKLIGQAVLITGAKTVNIDAGGPGWGIAAA 389

Query: 387 LEML-------GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL------EFASLINHS 433
           L          G  V  +    ++ + E   N R EL   +   L      + + + N  
Sbjct: 390 LRGWLKQHKVRGVAVNPIRFGAKSREPEKYLNMRAELWWGVGRLLSEQGGWDLSVMENAD 449

Query: 434 GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
                L     +       + IESK   R +  +S D +D L+  FA
Sbjct: 450 DTTAQLLD-PIWREGAGDRIVIESKEELRKRTGRSPDNADALLLAFA 495


>gi|161789175|ref|YP_001595730.1| PacB [Vibrio sp. 0908]
 gi|161761461|gb|ABX77106.1| PacB [Vibrio sp. 0908]
          Length = 572

 Score =  246 bits (628), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 81/438 (18%), Positives = 155/438 (35%), Gaps = 38/438 (8%)

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
              +  +N   P   + ++++G G GK+ L A L L  + T P    +  ANS  Q+   
Sbjct: 47  FQQIEVINALTPVGARVSVASGHGTGKSHLTAALCLHFIITHPESLCMLTANSLDQVTNV 106

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
           +++ + +    +  +  +  Q   +    +Y+             +    +T S+   + 
Sbjct: 107 VFSYIKRCWVKICQRQPWLEQYFVITAKSFYA-------KGYKGVWQIFGKTCSKGNEEG 159

Query: 184 FVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK 243
             G H    M ++ DEASG  D     + G LTE N     ++ S   R +G F +   +
Sbjct: 160 LAGQHRRDYM-VVVDEASGVSDRAFEVLRGALTEDN--NKMLLISQFTRPTGHFADSQME 216

Query: 244 --PLDDWKRFQIDTRTVEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLN 300
                 +    +++     ++  F       Y G+ S    + V G  P       I  +
Sbjct: 217 LAEQGLYTAITLNSEMSPFVNLKFIREKRIEYGGVTSPEYGIRVLGVCPDDASGFLISRS 276

Query: 301 IIEEALNREPCPDPYAPLIMGCDIA-EEGGDNTVVVL---------RRGPVIEHLFDWSK 350
           ++++              +   D+A  EG D++V+ +         R+  V++ +   + 
Sbjct: 277 LVDKGFEAVIEFADEWGWVAVADVAGGEGRDSSVLKIGKVCGFGSERQVEVVKAIEAPAD 336

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD---LE 407
            D       I      Y   ++ IDA+  G  T    E LG +V R+   +        +
Sbjct: 337 MDGVQFARFIHQETAGYTNISVGIDADGYGLTTAQECEKLGVNVTRIHWGRPPHANSVKQ 396

Query: 408 FCRNRRTELHVKMADWLEFASLINH--------SGLIQNLKSLKSFIVPNTGELAIESKR 459
                +    V + + L    L  H          L +    +  +     G   I SK+
Sbjct: 397 RFPKEKDFACVMVKEALGTGRLKLHRGETKQFEKKLQKQFVKIP-YEFDELGRWRIFSKK 455

Query: 460 V---KGAKSTDYSDGLMY 474
               +G KS D  D   +
Sbjct: 456 QLRSEGIKSPDIFDATAF 473


>gi|257459276|ref|ZP_05624390.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
 gi|257443289|gb|EEV18418.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
          Length = 431

 Score =  245 bits (625), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 76/318 (23%), Positives = 131/318 (41%), Gaps = 18/318 (5%)

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGT--PDVINLGILGFLTERNANRFWIMTSNPRRLS 234
           S ERP+   G        +I +EA        +    +  +   N N    +   P+  +
Sbjct: 104 SAERPENIEGFGYD---TVILNEAGIILKDPYLWDNAISPMLLDNPNSRAFIGGVPKGKN 160

Query: 235 GKFYEIFNKPL---DDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQ 290
            KF+++  + +     W+ FQ  +     +     + ++A  G  DSDV R E+ G+F  
Sbjct: 161 -KFFDLAQRGMRNEKGWRNFQFSSYDNPLLQKEEIDRLVAELGGADSDVARQEIFGEFLD 219

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
              +S   L  IE A  ++   D  AP+I   D+A EG D +V+  R+G  +E L  +  
Sbjct: 220 TTSNSVFSLAAIEAAFRKQRYFDAGAPVIWALDVAREGDDESVLCKRQGDSVEPLKPYRI 279

Query: 351 TDLRTTNNKISGLVEK--YRPDAIIIDANNTGARTCDYLEMLGYH--VYRVLGQKRAVDL 406
                   +I G  E+   +P AI ID    GA   D L  LG    V    G  +A D 
Sbjct: 280 ASTSELAREIYGEYERTDLKPHAIYIDTIGVGAGVFDTLCDLGLRGIVREAKGSFKASDE 339

Query: 407 EFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGA 463
               N+R E++  + + L   ++     L + L+++  +         +  K   + +  
Sbjct: 340 RKYANKRAEMYFNLREKLPLLAIAPDEELKRQLQTIAFY-FDKKERYLLMPKEGIKKEYG 398

Query: 464 KSTDYSDGLMYTFAENPP 481
           +S D +D L  +F +  P
Sbjct: 399 RSPDRADALAMSFFDLCP 416


>gi|292670767|ref|ZP_06604193.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292647388|gb|EFF65360.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 442

 Score =  243 bits (621), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 80/376 (21%), Positives = 147/376 (39%), Gaps = 28/376 (7%)

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           +A    Q K   W  +  + + +P +         ++ +  Y ++        ++     
Sbjct: 63  VAPYRNQAKRVAWEYLKYYTNPIPGR--------VVNESELYIEL----PTRHARSPGAR 110

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINL-GILGFLTERNANRFWIMTSNPR 231
                 + PD   G +      +I DE +     +    I   L +R    + +    P+
Sbjct: 111 LYIIGADHPDALRGIYLDG---VILDEYADIKPELWGGVIRPALADRQG--WAVFIGTPK 165

Query: 232 RLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
             + +FYE++        W      T     +     + + A+  +     R E+   F 
Sbjct: 166 GQN-QFYEMYQHAEKSAGWYSCIYRTDETGVLPAEELKDMQAQ--MTEMEIRQELLCDFT 222

Query: 290 QQDIDSFIPLNIIEEALNREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
               D  IP++++  A NR    D     P+I+G D+A  G D TV+ +R+G  ++ +  
Sbjct: 223 ASASDVVIPIDLVTAAANRLLKDDDVLGQPVILGVDVARFGDDRTVLCVRQGLWLKEVRT 282

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE 407
           ++      T +++   + ++ P A  IDA   GA   D L  L Y V  V   + A+D  
Sbjct: 283 FTGLSTMETASRVIDCINQHHPHATFIDAGAMGAGVIDRLRQLRYQVSEVNFGEMAMDAA 342

Query: 408 FCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
              N R E++ K   WLE    I  +  ++   S   +    TG + +E K   + +  K
Sbjct: 343 RYANIRAEMYFKCRAWLEAGGAIPQNAELKTELSTVEYKFNPTGRIILEPKDKLKERTGK 402

Query: 465 STDYSDGLMYTFAENP 480
           S D +DG + TFA   
Sbjct: 403 SPDLADGFVLTFARPV 418


>gi|298387330|ref|ZP_06996883.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259999|gb|EFI02870.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 500

 Score =  242 bits (618), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 93/491 (18%), Positives = 160/491 (32%), Gaps = 88/491 (17%)

Query: 53  SWQL---EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP--- 106
            W     + +         +V     +    A+++G   GK  + A   L  M   P   
Sbjct: 15  DWCAFASDVLRANLDEEQKAVLRSVQKNPMTALASGTSRGKDFVAACAALCFMYLTPEWD 74

Query: 107 -------GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLH 159
                     +   A S+ Q++  +  EV +                          ++ 
Sbjct: 75  DDGNLIRNTKIALSAPSQRQVENIMTPEVRRLFRNAGILP---------------GRLVA 119

Query: 160 CSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERN 219
             +  D + Y         +  + + G H    M +I  EASG  + I   I G L    
Sbjct: 120 NDIRTDYEEYFLTGFKADNKNQEVWSGFHAANVMFVIT-EASGVSETIFSAIEGNL---Q 175

Query: 220 ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP-----------SFHEG 268
            N   ++  NP   +G            + +F++D+     +              + E 
Sbjct: 176 GNSRLLLVFNPNITTGYAANAMKSDR--FAKFRLDSLNATNVTAKREIIPGQVNYEWVED 233

Query: 269 IIARY----------------------GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            +  +                         +D+ R++V G FP+   D  IP   IE A 
Sbjct: 234 KVKHWCTPITKEEYNEGEGDFLFENNLYRPNDLFRIKVRGMFPKVAEDVLIPYEWIEIAN 293

Query: 307 NREPCPDPYAP---LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL 363
            R     PY P     +G D+A  G DN+V   R G  +     + ++  + ++  + G 
Sbjct: 294 KRWQENHPYRPRKSCKLGVDVAGMGRDNSVFCPRYGNYVSQFDVF-QSAGKASHMHVVGK 352

Query: 364 VEKYR---PDAIIIDANNTGARTCDYLEMLG----YHVYRVLGQKRAVDLE---FCRNRR 413
              Y+    D I ID    GA     L   G    + V    G K   D+       N R
Sbjct: 353 ALSYKRTDRDIIFIDTIGEGAGVYSRLVEQGIRNIFSVKNSQGAKGLHDITGEYSFANMR 412

Query: 414 TELHVKMADWLE----FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
             L+  + DWL+    F  ++          +   +   + G++ IE K   + +  +S 
Sbjct: 413 AYLYWALRDWLDPKNNFFPMLPPCDQFTEEATETKWKFRSDGKILIEPKEEIKKRIKRSP 472

Query: 467 DYSDGLMYTFA 477
           DY D L  TF 
Sbjct: 473 DYMDALSETFY 483


>gi|225155389|ref|ZP_03723881.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
 gi|224803845|gb|EEG22076.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
          Length = 479

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 92/451 (20%), Positives = 166/451 (36%), Gaps = 48/451 (10%)

Query: 42  GTPLEGFSA--PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT-LNAWLV 98
           GTP        P ++ +  +++        +            +   G GKT+ +   L 
Sbjct: 12  GTPAPHAEKLNPITFAVAVLKLRIYSWQAKIMASVWSGKPTVAATPNGAGKTSVIIVALA 71

Query: 99  LWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVL 158
           L L+   PG +V+  + +   +   ++A                  SL++H A + +   
Sbjct: 72  LTLLHEFPGATVVLTSATYRAVCDQIFA------------------SLAVHQAKFSAWKW 113

Query: 159 HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG--MAIINDEASGTPDVINLGILGFLT 216
           + +   D +    +   ++ +R   F G H   G  + II DEA    D I +       
Sbjct: 114 NDTEINDGQGGRII--GFATDRGGRFEGFHAYPGRPLLIILDEAKSIADDIFVAA----- 166

Query: 217 ERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLD 276
           +R      +  S+   L G+F++ F++    + +FQ        I P F E + A+YG D
Sbjct: 167 DRCQPTMLLYISSWGGLFGRFHDAFSQDR--FAQFQAGIADCPHITPEFIEAMRAQYGED 224

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL 336
           SD+ R  + GQ P+ +   F+   +  E     P         + CD AE   D  V+  
Sbjct: 225 SDIYRSMILGQRPKGNETGFVVPFVDYERCESNPPVWQEGTKQVFCDFAET-SDECVIAK 283

Query: 337 RRGPVIEHLFDW-SKTDLRTTNNKISGLVEKYRPDAIII--DANNTGARTCDYLEMLGYH 393
           R G  +  +  W    +     ++  G + + + +  +I  DA+ TG      L + G  
Sbjct: 284 RDGNRLSIVDAWIPDGNTAGITDRFEGHLRRLQNEGFVIRGDADGTGHGYITALSLRGIK 343

Query: 394 VYRVLGQKRAVDLEFCRNRRTELHVKMADWLE--FASLINHSGLIQNLKSLKSFIV---- 447
           +  V      +D  +  N   E     A  ++  F  L +   L + L S +        
Sbjct: 344 ISGVKNNDAPMDNHYF-NLAAEHWWTFAKKVKSNFWILPHDEVLKRQLCSREEVYRKVGD 402

Query: 448 -----PNTGELAIESKRVKGAKSTDYSDGLM 473
                   G L +  K     KS D +D L+
Sbjct: 403 KKVYGREDGRLQLMPKSRLSTKSPDRADALV 433


>gi|283956317|ref|ZP_06373797.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792037|gb|EFC30826.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 430

 Score =  241 bits (615), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 74/324 (22%), Positives = 127/324 (39%), Gaps = 21/324 (6%)

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGT-----PDVINLGILGFLTERNANRFW 224
             +    S ER +   G        +I +EA         + +    +  +   N     
Sbjct: 96  GAVLHMRSAERSENIEGFGYD---LVILNEAGIILKGSKGEYLWYNAIRPMLLDNPKSRA 152

Query: 225 IMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTR 281
           I+   P+  +  FYE+  K L D  WK FQ  +     +     + +I   G  DS+V +
Sbjct: 153 IIGGVPKGKN-LFYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEDSEVVK 211

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
            E+ G+F          L  IE A+++            I G D+A  G D +V+  R+G
Sbjct: 212 QEIYGEFIDSSSAELFALTEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSVLAKRKG 271

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
            +++ +  +S+       N+I     +   +P  I ID    G    D L   G  V+  
Sbjct: 272 FIVDEIKKYSQLGTMELANRILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEA 331

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIES 457
                A   E   N+R +++   A  L+   L+    L ++++ ++ +   + G L I S
Sbjct: 332 NSANSATSNE-YLNKRAQMYFTFAKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVS 389

Query: 458 K---RVKGAKSTDYSDGLMYTFAE 478
           K   +    KS D SD +  TF E
Sbjct: 390 KEQLKKNYGKSPDVSDAVALTFFE 413


>gi|153951273|ref|YP_001397540.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|153951467|ref|YP_001398214.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938719|gb|ABS43460.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938913|gb|ABS43654.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 430

 Score =  241 bits (614), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 80/325 (24%), Positives = 126/325 (38%), Gaps = 23/325 (7%)

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV------INLGILGFLTERNANRF 223
             +    S ER +   G        +I +EA                I   L + N    
Sbjct: 96  GAVLHMRSAERSENIEGFAYD---LVILNEAGIILKDSKGGYLWYNSIRPMLLD-NPKSR 151

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVT 280
            I+   P+  +  FYE+  K L D  WK FQ  +     +     + +I   G   SDV 
Sbjct: 152 AIIGGVPKGKN-LFYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGESSDVV 210

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRR 338
           R E+ G+F          L+ IE A+++            I G D+A  G D +V+  R+
Sbjct: 211 RQEIYGEFIDSSSAELFSLSGIENAMSKNSFSTQKMQGENIWGLDVARYGDDKSVLAKRK 270

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
           G VI+ L  +S+       NKI    +  + +P  I ID    G    D L   G  V+ 
Sbjct: 271 GFVIDELKKYSQLGTIELANKILAEYKQSEEKPKGIFIDTCGLGVGVYDVLLNYGLPVFE 330

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
                 A   +   N+R +++   A  L+   L+    L  +++ ++ +   + G L I 
Sbjct: 331 ANSANSATSNQ-YLNKRAQMYFTFAKNLKHMELVKDEELKNDMRRIE-YEYSDKGLLKIV 388

Query: 457 SK---RVKGAKSTDYSDGLMYTFAE 478
           SK   +    KS D SD +  TF E
Sbjct: 389 SKEQLKKNYGKSPDLSDAVALTFFE 413


>gi|226940459|ref|YP_002795533.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715386|gb|ACO74524.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 272

 Score =  237 bits (605), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 73/265 (27%), Positives = 113/265 (42%), Gaps = 9/265 (3%)

Query: 239 EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
           +   +    W   QID+RTVEG +          YG +SD  +V V G FP      FI 
Sbjct: 5   KCGRRFRHRWVARQIDSRTVEGTNKEQIAKWAEDYGEESDFFKVRVRGMFPSMSARQFIS 64

Query: 299 LNIIEEALNREPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTT 356
              +  A  R   P+   YAP I+  D A EG D  V+ LR+G     L   +K D    
Sbjct: 65  ETDVSAAYGRALRPEQYQYAPKILTVDPAWEGDDEFVIGLRQGLSFRVLHTMAKNDNDLV 124

Query: 357 NNK-ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTE 415
             + I+   ++   DA+ +DA   G       + +G     V     ++D   C N+R E
Sbjct: 125 AAQVIARYEDEEGADAVFVDA-GFGTGIVSAGKSMGRDWTLVWFAGNSMDAG-CLNKRAE 182

Query: 416 LHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRV---KGAKSTDYSDGL 472
           +     DWL+    I    ++++       +    G++ IESK+    +G  S + +D L
Sbjct: 183 MWRDARDWLKSGGAIPDDPVLRDELQAPEIVPRLDGKIQIESKKEMKARGVPSPNRADAL 242

Query: 473 MYTFAENPPRSD-MDFGRCPSYQYE 496
           + +FA    R D +D  R  S + E
Sbjct: 243 ILSFAYPVTRRDPLDALRNHSERRE 267


>gi|57237579|ref|YP_178593.1| terminase B protein, putative [Campylobacter jejuni RM1221]
 gi|57166383|gb|AAW35162.1| terminase B protein, putative [Campylobacter jejuni RM1221]
          Length = 430

 Score =  237 bits (604), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 74/324 (22%), Positives = 124/324 (38%), Gaps = 21/324 (6%)

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGT-----PDVINLGILGFLTERNANRFW 224
             +    S ER +   G        +I +EA         + +    +  +   N     
Sbjct: 96  GAVLHMRSAERSENIEGFGYD---LVILNEAGIILKGSKGEYLWYNAIRPMLLDNPKSRA 152

Query: 225 IMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTR 281
           I+   P+  +  FYE+  K L D  WK FQ  +     +     + +I   G   S+V +
Sbjct: 153 IIGGVPKGKN-LFYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVK 211

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
            E+ G+F          L+ IE A+++            I G D+A  G D + +  R+G
Sbjct: 212 QEIYGEFIDSSSAELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKG 271

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
            VI  +  +S+       NKI     +   +P  I ID    G    D L   G  V+  
Sbjct: 272 FVIYEIKKYSQLGTIELANKILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEA 331

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIES 457
                A   E   N+R +++      L+   L+    L ++++ ++ +   + G L I S
Sbjct: 332 NSANSATSNE-YLNKRAQMYFTFTKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVS 389

Query: 458 K---RVKGAKSTDYSDGLMYTFAE 478
           K   +    KS D SD +  TF E
Sbjct: 390 KEQLKKNYGKSPDVSDAVALTFFE 413


>gi|315929403|gb|EFV08605.1| phosphatase, Ppx/GppA family [Campylobacter jejuni subsp. jejuni
           305]
          Length = 430

 Score =  236 bits (603), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 75/324 (23%), Positives = 124/324 (38%), Gaps = 21/324 (6%)

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGT-----PDVINLGILGFLTERNANRFW 224
             +    S ER +   G        +I +EA         + +    +  +   N     
Sbjct: 96  GAVLHMRSAERSENIEGFGYD---LVILNEAGIILKGSKGEYLWYNAIRPMLLDNPKSRA 152

Query: 225 IMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTR 281
           I+   P+  +  FYE+  K L D  WK FQ  +     +     + +I   G   S+V +
Sbjct: 153 IIGGVPKGKN-LFYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVK 211

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
            E+ G+F          L+ IE A+++            I G D+A  G D + +  R+G
Sbjct: 212 QEIYGEFIDSSSAELFSLSEIENAMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKG 271

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
            VI  +  +S+       NKI     +   +P  I ID    G    D L   G  V+  
Sbjct: 272 FVIYEIKKYSQLGTIELANKILAEYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEA 331

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIES 457
                A   E   N+R +++   A  L+   L     L ++++ ++ +   + G L I S
Sbjct: 332 NSANSATSNE-YLNKRAQMYFTFAKNLKHMELFKDEELKKDMRMIE-YEYSDKGLLKIVS 389

Query: 458 K---RVKGAKSTDYSDGLMYTFAE 478
           K   +    KS D SD +  TF E
Sbjct: 390 KEYLKKNYGKSPDVSDAVALTFFE 413


>gi|189460514|ref|ZP_03009299.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
 gi|189432758|gb|EDV01743.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
          Length = 556

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 90/510 (17%), Positives = 161/510 (31%), Gaps = 93/510 (18%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP--------- 106
            E + V        + +      + ++++G   GK  + A   +  +   P         
Sbjct: 57  REALGVTLDKEQQEILSSVQYNRRTSVASGTARGKDFVAACAAICFLYLTPRWRKNSLGE 116

Query: 107 -----GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS 161
                   V   A ++ Q+K  +  E+S+  +    +    +  L+ +     +D     
Sbjct: 117 IELVENTKVALTAPTDRQVKNIMMPEISRLFNRAKARGVELIGKLNAYDIRTNND----- 171

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN 221
                  +        E   + + G H  + M ++  EA+G  D     I G L     +
Sbjct: 172 ------EWFLTGFKADEHNHEAWSGFHAVHTMFVVT-EATGIGDDTFAAIEGNL---QGD 221

Query: 222 RFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE-------------- 267
              ++  NP +  G   +   +  D W ++++++ T   I                    
Sbjct: 222 SRILLVFNPNKTVGYAAKS--QKGDRWHKYRLNSLTAPNIASKKIIIPGQVDYDWVLDKL 279

Query: 268 -------------------GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
                                  ++    D+ R +V G FP+ D D+ IP   +EEA  R
Sbjct: 280 ENWCEKISPDEIISEMDDFEFEGQWYRPEDLFRKKVLGLFPKVDEDTLIPRQWLEEAHER 339

Query: 309 EPCPDPYAPL-----IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK---TDLRTTNNKI 360
                   PL     I+G D+A  G D T  VLRR   +      +     D      KI
Sbjct: 340 WKQAKGREPLRADLNILGVDVAGMGRDATCYVLRRDNWVASFDTHNSGGVADHMKVAGKI 399

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDY---LEMLGYHVYRVLGQKRAVDL----------- 406
                +     + ID    GA        LE   +++      + A              
Sbjct: 400 MVARRQNIGLYVSIDTIGEGAGVYSRCVELEDEPHYILSCKYSESAKTPNGRELSDITGQ 459

Query: 407 EFCRNRRTELHVKMADWL----EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---R 459
               N R  L   + DWL       +++          +   F V + G+L IE K   +
Sbjct: 460 NKFFNMRAYLFWAVRDWLNPRNNTGAMLPPDDKFDEEATEIKFSVKSNGKLYIEPKEDIK 519

Query: 460 VKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
            +  +S D  D L  TF        ++  R
Sbjct: 520 ERLGRSPDKFDALANTFYPVRYAKPINVNR 549


>gi|154175204|ref|YP_001409090.1| Ppx/GppA family phosphatase [Campylobacter curvus 525.92]
 gi|112803006|gb|EAU00350.1| phosphatase, Ppx/GppA family [Campylobacter curvus 525.92]
          Length = 433

 Score =  229 bits (584), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 89/458 (19%), Positives = 164/458 (35%), Gaps = 56/458 (12%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             WQ E      A                 I  GR  G T   A   +  +    G  ++
Sbjct: 11  TDWQREVFFKNKAKF-------------TTIEKGRRSGFTKGMANACIEWLI--EGKKIL 55

Query: 112 ----CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
                 AN +   +     E+ +  + +   H                  L    G    
Sbjct: 56  WVDTVTANLQRYFERYFVPELKQLPADMWKFH-------------AQDKKLTVGEGYLDM 102

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT--PDVINLGILGFLTERNANRFWI 225
                    S ERP+   G        +I +EA        +    +  +     N    
Sbjct: 103 R--------SAERPENIEGFGYD---VVILNEAGIILKNSYLWDNAIRPMLLDYPNSRAF 151

Query: 226 MTSNPRRLSGKFYEIFNKPL---DDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTR 281
           +   P+  + +F+++ ++ +    DW  FQI +     +     + +IA  G +DSDV +
Sbjct: 152 IGGVPKGKN-RFFDLASRGMRNEKDWVNFQISSFENPLLRKEEIDELIAELGGVDSDVVK 210

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPV 341
            E+ G+F     ++  PL+ IE A  +    +P A  I G D+A +G D +V+ +R G  
Sbjct: 211 QEIYGEFLDTTTNALFPLSQIEAAFGKVRAYEPNAVQIWGLDVARDGDDESVLCVREGYH 270

Query: 342 IEHLFDWSKTDLRTTNNKISG--LVEKYRPDAIIIDANNTGARTCDYLEM--LGYHVYRV 397
           +++L  +          +I     + + +P+AI ID+   GA T D L    LG      
Sbjct: 271 VKNLEGFRIASTTELAREIYRRYEMSEKKPEAIFIDSVGVGAGTFDRLCEFGLGAICREA 330

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIES 457
               +A +     N+R E++  + +     ++  H  L + L+ ++         L +  
Sbjct: 331 KASYKATNEAKFANKRAEMYFALKEKFHLLTMNAHEKLKKQLQMIEFQYDRKERYLILPK 390

Query: 458 K--RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
              + +   S DY+D L  TF ++   +     +   Y
Sbjct: 391 DELKKEYGTSPDYADALALTFFDDVMSARRTEEKRQRY 428


>gi|153806881|ref|ZP_01959549.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
 gi|149131558|gb|EDM22764.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
          Length = 513

 Score =  229 bits (584), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 85/492 (17%), Positives = 150/492 (30%), Gaps = 92/492 (18%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP--------- 106
            + +         ++          A+++G   GK  + A   L  M   P         
Sbjct: 27  RDALCARLDREQQAIIESVQHNPMTAVASGTARGKDFVAACASLCFMYLTPRFNEKGVLV 86

Query: 107 -GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
               V   A +  Q+K  +  E+ + +     K  F               ++   +  D
Sbjct: 87  GNTKVAMTAPTGRQVKNIMTPEIRRLIRAARTKFPFCCP----------GRLVADDIRTD 136

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
            + +        +   +++ G H    M +I  EASG  +++   I G L     N   +
Sbjct: 137 YEEWFLTGFKADDNATESWSGFHAANTMFVIT-EASGISEIVYNAIEGNL---QGNSRML 192

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE------------------ 267
           +  NP   +G            + +F++ +   E +                        
Sbjct: 193 IVFNPNITTGYAARAMKSDR--FAKFRLSSLNAENVVKKQIVIPGQVDYEWVKDKVINWC 250

Query: 268 ---------------GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
                              +    +D+ RV+V G FP+   D  IP   IE A       
Sbjct: 251 SPIQQTDFNEGEGDFNWEGKLYRPNDLFRVKVLGMFPKVSEDVLIPYEWIEIANRNWQEL 310

Query: 313 D-----PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL---V 364
                 P     +G D+A  G DN+V+  R G  +   FD  ++  R  +  + G+    
Sbjct: 311 QASGFIPAKSCKLGVDVAGMGRDNSVLCPRYGNYV-PQFDVHQSAGRADHMHVVGMTIPY 369

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE------------FCRNR 412
            K +     ID    GA     L                   E               N 
Sbjct: 370 LKKKGAKAFIDTIGEGAGVYSRLLEE-----EFTNAFSCKYSEGTDGLHDITGEYEFANM 424

Query: 413 RTELHVKMADWL----EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
           R  L+  + DWL     F + +     +    +   +   + G++ IE K   + +  +S
Sbjct: 425 RAYLYWALRDWLNPKNGFGAALPPCDQLMEEATETKWKFLSNGKVIIEPKEDVKKRIKRS 484

Query: 466 TDYSDGLMYTFA 477
            DY D L  TF 
Sbjct: 485 PDYMDALANTFY 496


>gi|282598783|ref|YP_003359102.1| putative large subunit terminase [Clavibacter phage CMP1]
 gi|262212571|gb|ACY35907.1| putative large subunit terminase [Clavibacter phage CMP1]
          Length = 872

 Score =  229 bits (584), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 88/428 (20%), Positives = 150/428 (35%), Gaps = 48/428 (11%)

Query: 91  TTLNAWLVLWLMSTRP--GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           T L   LV W +S  P    SV+  A    Q+   ++  +    +L   +   +     +
Sbjct: 424 TRLAGDLVTWFVSVFPPEETSVMVSAPIREQIDVMMFRYLRDNYNLAIERE--QPLIGEI 481

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN 208
              P++         +         R        +F G H+ + +A++ DEA G P+ + 
Sbjct: 482 TKWPYWQVGAPLDKKLVMPK-----RPADGNLISSFQGIHDGH-VAVVLDEAGGLPEDLY 535

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN--KPLDDWKRFQIDTRTVEGIDPSFH 266
           +G     T  +A    +   NP + +  F+E F   +    W RF I             
Sbjct: 536 IGANAVTTNFHARI--LAIGNPDKRNTPFHERFTDTEKFSSWNRFTIGAEDTPNFTGEKI 593

Query: 267 EG------------------IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
                               +  R      V   +V G FP+ D  +F   ++I    + 
Sbjct: 594 YEDPAKDEDVKKHLVQVSWAVEMRKSARPSVVAAKVDGNFPESDDTTFFDQSVINRGYST 653

Query: 309 EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL---RTTNNKISGLVE 365
           E  P+      MG DI+ +G D +V  +  G  I    +W++ D      +  +I     
Sbjct: 654 EIEPESTDFKYMGVDISYQGEDQSVAYINHGGQIRIADEWNRFDGAEHIESAIRIHNKAC 713

Query: 366 KYRPDAIIIDANNTGARTCDYLEML------GYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           +     + ID   TGA     L+ML       Y +  V G  R  +     N R   + +
Sbjct: 714 QEGVQEVRIDMAGTGAGVYSNLKMLDQFKDKPYVLIGVNGANRTPNSNRWLNARAWHYDQ 773

Query: 420 MADWLEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLM 473
               L    +   I    L + ++ L+     N G+L I  K   R  G  S D+ D  +
Sbjct: 774 FRTGLITGKIDITITDVDLKKEME-LQPSTFTNRGQLQITRKDDMRKMGISSPDHLDAAI 832

Query: 474 YTFAENPP 481
           Y+  +  P
Sbjct: 833 YSAIDTTP 840


>gi|303257560|ref|ZP_07343572.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
 gi|302859530|gb|EFL82609.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
          Length = 330

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 118/301 (39%), Gaps = 17/301 (5%)

Query: 195 IINDEASGTPDVIN-LGILGFLTERNANRFWIMTSNPRR--LSGKFYE----IFNKPLDD 247
           ++ DE +     +    I   L +R     +     P+   L  + Y+    + +K   D
Sbjct: 6   VVIDEVAQIKPTLWGEVIRPALADRKGWAAF--IGTPKGINLFSQLYDQALNLMSKGDPD 63

Query: 248 WKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN 307
           W            ID      +  +  +  +  R E    F     +  IP++ I  A N
Sbjct: 64  WIAMLYSVEQTHVIDEKELAAL--KVEMSENEFRQEFLCDFSAAQDNGLIPIDDIRAAAN 121

Query: 308 REPCPDPY--APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +      Y  APLI G D+A  G D +V+  RRG V        K D     ++I+  + 
Sbjct: 122 KFYRESEYMGAPLIYGIDVARFGSDASVIFKRRGLVAFEPIVIRKFDNMALADRIAVEMA 181

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           K +PDA+ ID+   G    D L  + + V  V    +A+D E   NRR E+   MA W++
Sbjct: 182 KEKPDAVFIDS-GAGQGVIDRLRQMRFDVVEVPFGAQAIDKEQFANRRMEMWWHMAQWIK 240

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
               I    ++Q      ++     G   +E+K   + +  +S D +D L  TFA     
Sbjct: 241 QGGAIPPDPVLQGDLGAPTYGYTPKGPKILEAKDKLKERIGRSPDLADALALTFAAPVAP 300

Query: 483 S 483
            
Sbjct: 301 K 301


>gi|282880015|ref|ZP_06288737.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
 gi|281306129|gb|EFA98167.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
          Length = 459

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 81/466 (17%), Positives = 156/466 (33%), Gaps = 87/466 (18%)

Query: 80  GAISAGRGIGKTTLNAWLVLWLMSTRP----------GISVICLANSETQLKTTLWAEVS 129
            A+++G   GK  + A   +  M   P             +   A +  Q    +  EV+
Sbjct: 2   VAVASGTSRGKDFVAACAAMCFMYLTPRWNINHRLIQNTKIAMTAPTGRQCINIMIPEVA 61

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           +                          +L   +  ++  +       S++  + + G H 
Sbjct: 62  RLFRNASVLP---------------GRMLSDGIRTNNAEWFLTAFKASDDNTEAWSGFHA 106

Query: 190 TYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
              M ++  EASG  +     I G L     N   ++  NP   +G   +        +K
Sbjct: 107 VNTMFVVT-EASGVSETTFNAIEGNL---QGNSRLLLVFNPNVTTGYAAKAMKSSR--FK 160

Query: 250 RFQIDTRTVEGI-----------DPSFHEGIIARY----------------------GLD 276
           +F++++   E +           D  + +  +  +                         
Sbjct: 161 KFRLNSLNAENVIKKKNVIPGQVDYEWVKDKVHNWCELIQKEDFNNGEGDFMFEDSFYRP 220

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL-----IMGCDIAEEGGDN 331
           +D+ R++V G FP+   D+ IP   +E A +R    +    +      +G D+A  G D+
Sbjct: 221 NDLFRIKVLGLFPKASEDTLIPFEWLELAHDRWKKLNAEDFVPRKYARVGIDVAGMGRDS 280

Query: 332 TVVVLRRGPVIEHLFDWS---KTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +  VLR G  +  +       K D      +    + + +   ++ID    GA     L 
Sbjct: 281 SCFVLRYGNYVPEIKIHQSGGKADHMKVAGEAVQWLVE-KNTKVMIDTIGEGAGVYSRLL 339

Query: 389 MLGY-HVYRVLGQKRAVDLE------FCRNRRTELHVKMADWL----EFASLINHSGLIQ 437
            LGY + Y     +    L          N R   +  + DWL     F   +     + 
Sbjct: 340 ELGYDNAYSCKFSEGTKGLHDITGQYEFANMRAYCYWAVRDWLNPKNGFNPALPPCDELD 399

Query: 438 NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
              +   +   ++G + IE K   + +  +S D +D L+ TF  N 
Sbjct: 400 AELTEVHWSFQSSGSIIIEPKENIKSRLKRSPDRADALISTFYPNT 445


>gi|212703250|ref|ZP_03311378.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
 gi|212673294|gb|EEB33777.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
          Length = 330

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 64/301 (21%), Positives = 116/301 (38%), Gaps = 23/301 (7%)

Query: 197 NDEASGTPDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD-------W 248
            DE +     +    +   L +R  +   +    P+  +  F E++ + +         W
Sbjct: 1   MDEVAQMKPEVWGEVVQPALADRRGSA--VFIGTPKG-ANLFAELYQRGMAAQAQGDAAW 57

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
                   + + +     E +     L  +  R E+   F     D  IPL  + EA  R
Sbjct: 58  CALSYPVTSTDVLPAEDVERLRRE--LSDNAFRQEMLCDFTASSDDILIPLPDVLEAEAR 115

Query: 309 EPCPDPYA--PLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEK 366
           +   D     P+I+G D+A  G D++V+V R+G  ++        D     ++++  + +
Sbjct: 116 QLAWDDVGGMPVILGVDVARFGADSSVIVRRQGLKVDGPVVMRGLDNMQLADRVAAAIME 175

Query: 367 YRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF 426
            RP A+ IDA   G    D L  LG+ V  V    + +      NRR+E+   +  WL+ 
Sbjct: 176 NRPHAVFIDA-GQGQGVIDRLRQLGHEVIEVPFGGKPLQEGRFANRRSEMWYGLRQWLKS 234

Query: 427 ASLINHSG----LIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
              +   G     ++   S   +     G + +E K   + +   S D +D L  TFA  
Sbjct: 235 GGKLPDEGDDVPRLRAELSAPLYWYDAAGRMVLEPKDKIKERLGASPDIADALALTFAAP 294

Query: 480 P 480
            
Sbjct: 295 V 295


>gi|320103661|ref|YP_004179252.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
 gi|319750943|gb|ADV62703.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
          Length = 553

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 81/407 (19%), Positives = 133/407 (32%), Gaps = 49/407 (12%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             P  W                           ++ G  +GK+ L A L LW + T PG 
Sbjct: 45  GRPDYW----------EGQRRAALALTRARSVVVATGNAVGKSYLAAGLTLWWLYTHPGS 94

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            V+  A S+  L T L+ E+ K L+    +    +  + +         L    G     
Sbjct: 95  LVVATAPSQGLLGTVLFRELQKALA-ASRRRGLGLPGMVVGSDRGTPFSLRVGPGRRLAA 153

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
               C   +    +   G H+   M ++ DEASG            LT  N  + ++   
Sbjct: 154 EGWGCLGIATRGVERLAGRHHADLM-VVVDEASGVQPEAWE----ALTSLNPRKLFV-CG 207

Query: 229 NPRRLSGKFYEIFNKPLDDWK-----------RFQIDTRTVEGI----------DPSFHE 267
           NP      F+++  + L +                I +     I          D  F  
Sbjct: 208 NPLTPGTVFHKLHQRGLTEASDPSIPDHARGVALTIPSTASPDINLERSPRGLADRGFIR 267

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP---DPYAPLIMGCDI 324
               ++G  S +    V G FP   + + I    +++A + E      +P    ++GCD+
Sbjct: 268 EAERQWGRGSPLWLSHVEGVFPTVAVHALIEPGWLDQAASLERSQTYENPPGQPVLGCDL 327

Query: 325 AEE-GGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGA 381
           A   G D T +V+R    I  L    +         I+ L  K+   P+ I+ D    GA
Sbjct: 328 AAGVGADRTAIVVRDEGGIRELIASDRLAPDEAATLIASLARKHLIAPERILYDGAGLGA 387

Query: 382 RTCDYLEMLG---YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
                L   G    H   + G   A       N R     ++   L+
Sbjct: 388 ELTTRLARQGPGFVHARAIFGA--ASGGAGFLNHRAWCGWRLRQRLD 432



 Score = 42.4 bits (98), Expect = 0.17,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 435 LIQNLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAEN 479
           L + L++L+  +V    +LA+E KR    +  +S D +D L+ TF+ +
Sbjct: 508 LREELEALRYRLVGT--KLALEDKRETRRRLGRSPDLADALLITFSVD 553


>gi|186682890|ref|YP_001866086.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
 gi|186465342|gb|ACC81143.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
          Length = 543

 Score =  216 bits (551), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 98/512 (19%), Positives = 176/512 (34%), Gaps = 104/512 (20%)

Query: 46  EGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTR 105
           +    P  +    + +   +    +     +     + A  G GK+ + + LV++ +   
Sbjct: 28  QYADDPVGFFKNELGIELTNEQTIIAESVRDRPITNVKAAHGTGKSFIASLLVIYFLFCV 87

Query: 106 PGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
            G+  I  A SE Q+K  LWAE+ K   L   K       + L     +S+ ++      
Sbjct: 88  GGV-AITTAPSEDQVKWILWAELRKIHGLHKTKLGGRCDIMQL----LFSETVYA----- 137

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              +    R YSE    +F G H    +  I DEA G    I+ G +  LT   ++   +
Sbjct: 138 ---FGITSRDYSEN---SFQGQHRQKQLL-IEDEADGITPQIDNGFIACLT--GSDNRGL 188

Query: 226 MTSNPRRLSGKFYEI------------FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY 273
              NP     +F +             F+ P   W  +++    V  + P   E II   
Sbjct: 189 RIGNPVDPQSQFAKTCKLDKRCLTVSAFSHPNVSW-AYELCADGVYRLKPEVAEHIINED 247

Query: 274 G----------------------------------LDSDVTRVEVCGQFPQQDIDSFIPL 299
           G                                    S   +  V G++ +   D  I L
Sbjct: 248 GEIKPQQEWPPEFPRDRIPGAISIDWIERVRREKFETSAYWKGRVMGEYAEDAADGIILL 307

Query: 300 NIIEEALNREPCPDPYA-------PLIMGCDIAEEGGDNTVVVLRRGPVIEHL-FDWSKT 351
            ++++A +       Y        P  +G D+  +GGD   + L RGPV+  +    +K 
Sbjct: 308 TLLKQARSLYDQNPQYWDAIAKRYPWRLGLDVG-DGGDPHALALLRGPVLYEVQIHPTKG 366

Query: 352 DLRTT-------NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQ---- 400
           DL  T        ++I  L   Y   +I +D    GA T   L+  GY            
Sbjct: 367 DLLDTERAADIAASQIKLLGTGY---SIAVDNTGVGAGTLAKLKKTGYQALPCRFGDVPS 423

Query: 401 -----KRAVDLEFCRNRRTELHVKMADWLEFASL-----INHSGLIQNLKSLKSFIVPNT 450
                ++    +   N + EL+ +  + L    +      N   + Q+L + + +     
Sbjct: 424 YKKKKQKEEPKQKFTNLKAELYWQFRELLMGGRIAIAPLENEEYVFQDLTATR-YSTNTK 482

Query: 451 GELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            E+  E K   + +  +S D S+ ++      
Sbjct: 483 DEIFCEPKDKTKSRLGRSPD-SEAVIIALTNP 513


>gi|294789575|ref|ZP_06754810.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
 gi|294482512|gb|EFG30204.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
          Length = 516

 Score =  215 bits (548), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 78/450 (17%), Positives = 147/450 (32%), Gaps = 63/450 (14%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRP----------GISVICLANSETQLKTTLWAEV 128
           K ++ +G G GKT     + LW +   P          G +    A +  Q+   +W E+
Sbjct: 49  KVSVVSGTGTGKTMSFGRIALWHLLCFPVAKYDGKIEIGSNTYIGAPAIKQVGDGVWKEI 108

Query: 129 SKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI-----DSKHYSTMCRTYSEERPDT 183
           +  +  +                 W ++ +               +        + +  +
Sbjct: 109 TDAVQAMRAN----------RATAWLAEYIVVQAERVYIIDYKATWFITKFAMQQGQSVS 158

Query: 184 FVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK 243
             G H  Y + II DEA+G  D     I G  T+       ++ S   +  G FYE  +K
Sbjct: 159 IAGKHRFYQL-IIIDEAAGVSDEHYEVINGTQTQGGNRT--LLASQGVKQGGFFYETHHK 215

Query: 244 ----PLDDWKRFQIDTRTVEGIDPSFHEGIIAR-YGLDSDVTRVEVCGQFPQQDIDSFIP 298
                  +W      +     +   + E +  +  G ++   RV V G+F + + ++ + 
Sbjct: 216 LNKENGGNWTALCFSSENSPFVTTEWLENVALQAGGKNTTEYRVRVLGKFAENEHENLLT 275

Query: 299 LNIIEEALNREPCPDPYAP--LIMGCDIAEE--------------GGDNTVVVLRRGPVI 342
              IE  ++  P  +   P   ++  D+                 G D+     RR    
Sbjct: 276 RAQIEPRIDTLPIIEKGEPFGWLLLVDVGAGEYRDDSVCIAAKVIGDDDFGENARRVEYE 335

Query: 343 EHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKR 402
            +    +  ++      I     +     I++DA   G   C  LE  G+ V R+     
Sbjct: 336 ANPIITNTKNIHEFRGLIVEKAAQLSNVRILVDAGGIGLELCKMLENDGFDVERINWGNP 395

Query: 403 AV---DLEFCRNRRTELHVKMADWLEFASLINH-------SGLIQNLKSLKS-FIVPNTG 451
                  E   N+R    V+  D +    ++            +     +   F    T 
Sbjct: 396 CFKRAYKERFFNQRACAMVRWRDAIRQGRVLFPKMENGLREKFLMQASRIPYGFTDTGTA 455

Query: 452 ELAIESK---RVKGAKSTDYSDGLMYTFAE 478
              I  K   R +G KS D +D + + F +
Sbjct: 456 RYQIAQKAEMRKRGIKSPDIADAMSFAFLD 485


>gi|315649222|ref|ZP_07902312.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
 gi|315275441|gb|EFU38799.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
          Length = 189

 Score =  211 bits (538), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 65/225 (28%), Positives = 93/225 (41%), Gaps = 45/225 (20%)

Query: 13  QKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNN 72
             L DL W D +  +F+  ++ F               P  WQ + M  V          
Sbjct: 9   TDLLDLYWDDPV--AFAEDMMGF--------------DPDDWQCDVMMDVT--------- 43

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
              +  + ++ +G+G+GKT L A LV+W +  RP   V+C A ++ QL   LW EVSKWL
Sbjct: 44  ---QFPRTSVRSGQGVGKTGLEAALVIWFLCCRPNPKVVCTAPTKQQLHDVLWTEVSKWL 100

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
                K+  +     ++                 + +    RT    +P+   G H  Y 
Sbjct: 101 ENSMVKNLLKWTKTKVYMIG------------HEQRWFATARTA--NKPENMQGFHEDY- 145

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           M  I DEASG  D I   ILG L+   A    +M  NP R SG F
Sbjct: 146 MLFIVDEASGVSDPIMEAILGTLS--GAENKLLMCGNPTRTSGVF 188


>gi|119386463|ref|YP_917518.1| PBSX family phage terminase large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377058|gb|ABL71822.1| phage terminase, large subunit, PBSX family [Paracoccus
           denitrificans PD1222]
          Length = 441

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 88/424 (20%), Positives = 153/424 (36%), Gaps = 30/424 (7%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T PG+S ICL + +  L  +++  + +  + L        
Sbjct: 26  GGRGSGKSWDRAMHMIVRHLTEPGLSSICLRDVQKSLDQSVFKLLVETAARLGVAEAIR- 84

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                   P  SD +  + G     ++ M   ++ E   +  G           +EA+  
Sbjct: 85  --------PVESDRIIRTPGNGIIAFNGMNE-FNAENIKSLEGFD-----IAWWEEAATA 130

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI---DTRTVEG 260
                  +   L +  +  ++  T NPR  S     +  +         +   + R    
Sbjct: 131 GQGPLDMLRPTLRKPGSQIWF--TYNPRLRSDPVDVMMRQDARFADSRTVVEANWRDNPF 188

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIM 320
             P   E  +     D    R    G +  +    FI   ++ EA+ R+P       L++
Sbjct: 189 RGPELEEERLLDLAGDEARYRHIWEGDYEAESDMQFIGGGLVREAMARQPFSQIGDELVL 248

Query: 321 GCDIAEEGGDNTVVVLRRGPVI--EHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           G D+A  G D +V+  RRG     E        D      ++   +++  PD + ID   
Sbjct: 249 GVDVARFGDDRSVIWARRGRDAQTELPIIMKGADTMAVAARVMAEIDRLHPDGVFIDEGG 308

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAV----DLEFCRNRRTELHVKMADWLEFASLINHSG 434
            G    D    +GY V  V    +A      +  CRN+R ++   M +WL     I  S 
Sbjct: 309 VGGGVIDRCRQMGYSVVGVNFGGKADRAIEGVPKCRNKRAQMWATMREWLRSGGCIPDSR 368

Query: 435 LIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN-PPRSDMDFGRC 490
            ++   +   +       + IE K   + +G  S D +D L  TFA    PRS       
Sbjct: 369 DLEMDLTGPLYSFDVNNAIEIEKKSDMKKRGVSSPDEADALALTFAYPVVPRSIQRQQEA 428

Query: 491 PSYQ 494
            + +
Sbjct: 429 RAQE 432


>gi|284162607|ref|YP_003401230.1| hypothetical protein Arcpr_1511 [Archaeoglobus profundus DSM 5631]
 gi|284012604|gb|ADB58557.1| protein of unknown function DUF264 [Archaeoglobus profundus DSM
           5631]
          Length = 435

 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/449 (20%), Positives = 162/449 (36%), Gaps = 68/449 (15%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
           S P ++   F++         +     +     + AGR  GKT   A   ++   T PG 
Sbjct: 13  SDPVTFAKVFLDWGAHPAQAQILRDRHQF--ITVVAGRRFGKTECMAVSAIYYALTNPGS 70

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
               +A S  Q    ++ ++ ++LS              ++  P++    H     DS  
Sbjct: 71  IQFVIAPSYDQ-SNIMFGQIVQFLSKSI----LGCMIRRIYKTPFH----HIIFKNDS-- 119

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV-INLGILGFLTERNANRFWIMT 227
              +    S  +P+   GH       II DEA+  PD  I+  I   L + N +  WI  
Sbjct: 120 ---VIHARSASKPEFLRGHKA---HRIILDEAAFIPDDVISNIIEPMLADYNGS--WIKI 171

Query: 228 SNPRRLSGKFYEIFNK----PLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
             P   +  FY+ + K       D+  ++  +     I   F E     YG +S + R E
Sbjct: 172 GTPFGKN-HFYDTYLKGQSPDFPDYSSYRFPSTVNPHISHEFIEKKKREYGENSIIFRTE 230

Query: 284 VCGQFPQQ------------DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDN 331
              +F +             ++D+ I L    E ++++         ++GCD+A+     
Sbjct: 231 YLAEFVEDQNAVFRWADIQKNVDNSIELIDSAENVSKQ--------YVIGCDLAKYQDYT 282

Query: 332 TVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP---DAIIIDANNTGARTCDYLE 388
            +VVL        L  + + + R     I  L E YR      ++ID+   G    + L+
Sbjct: 283 VIVVLDVTEKPYKLVHFERFNRRPYAEVIMRLKELYRRFNYAKVLIDSTGVGDPVLEDLQ 342

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL--INHSGLIQNLKSLKSFI 446
            +G   Y V   K  V L            ++   LE   +       L++ L+  + + 
Sbjct: 343 DVGAEGY-VFTPKSKVQLIQ----------RLQAALENGEIRYPYIEELVKELQFFE-YQ 390

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           +  TG + +E    +     DY   L   
Sbjct: 391 LTRTG-IKME---ARQGFHDDYVIALALA 415


>gi|168704975|ref|ZP_02737252.1| hypothetical protein GobsU_35915 [Gemmata obscuriglobus UQM 2246]
          Length = 519

 Score =  186 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 84/507 (16%), Positives = 153/507 (30%), Gaps = 94/507 (18%)

Query: 46  EGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEV-FKGAISAGRGIGKTTLNAWLVLWLMST 104
           +  + P  +  + ++V        +     +  ++  + A   +GK+ L   LV W   T
Sbjct: 29  KYRTDPAGYARDILKVKWWAKQVEIAEALCKPPYRVLVKASHSVGKSHLAGGLVNWWYDT 88

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           R     +  A ++ Q+K  LW EV +     P     +M  L   P  +           
Sbjct: 89  RFPGVCLTTAPTDRQVKDVLWKEVRRQRRKRPGFVGPKMPRLESDPTHF----------- 137

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
                      ++     +F G H    + +I DEA G               + A   W
Sbjct: 138 --------AHGFTARDATSFQGQHEA-SILLIFDEAVGIDGDFWEAAESMC--QGAEYGW 186

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID-------------------PSF 265
           +   NP   + + Y +  +    W    I       I                       
Sbjct: 187 LAIFNPTDTTSRAY-LEEQAGSRWTVIDIPATEHPNIAAELVARPPEYPSAVRLNWLRDR 245

Query: 266 HEGIIAR---------------------YGLDSDVTRVEVCGQFPQQDIDSFIPLNI--I 302
            E    R                     +     +    +  ++P      +       +
Sbjct: 246 LEQWAERIEPGDATPTDIQFPNPDGSPQWWRPGPLADARLLARWPASGCGVWSDPVWRSV 305

Query: 303 EEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           E A   +P P+ + P  +GCD+A  G D T + +R G V  H    +  D + T  ++  
Sbjct: 306 ERAAP-DPVPERWLP-QIGCDVARFGEDWTELHVRCGNVSLHHEAHNGWDTKRTTERLKQ 363

Query: 363 LVEKYRPDAIIIDANNT---------------GARTCDYLEMLGYHVYRVLGQKRAVDLE 407
           +  ++   A  +                    G       +  G++   V     A D E
Sbjct: 364 MCGEWAQWATQLRDRGADPIDPRRIPVKVDDDGVGGGVTDQRGGFNFQAVSSASNANDKE 423

Query: 408 FCRNRRTELHVKMADWLEFAS-----LINH--SGLIQNLKSLKSFIVPNTGELAIESK-- 458
              NRR+EL   +AD  +        L  H    L +      ++ +   G   +E K  
Sbjct: 424 AYPNRRSELWFTVADRAKRGELFLSNLPAHVRQELKRQ-AMAPTYKLDAAGRRVVEPKED 482

Query: 459 -RVKGAKSTDYSDGLMYTFAENPPRSD 484
            + +  +S D  D +   + E   R  
Sbjct: 483 TKERIGRSPDGMDAVNLAYYEPSGRGG 509


>gi|320091491|gb|ADW08983.1| terminase-like protein [Clavibacter phage CN77]
          Length = 414

 Score =  184 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/393 (18%), Positives = 137/393 (34%), Gaps = 60/393 (15%)

Query: 157 VLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLT 216
                 G  ++  +   R   ++   TF G        +  DEA G P  +  G    +T
Sbjct: 11  KYKKMDGSGNEAIAFGKRPTDQDIVSTFQGT-RKLRTFVALDEAGGVPPELFTGAEAVMT 69

Query: 217 ERNANRFWIMTSNPRRLSGKFYEIFNKP--LDDWKRFQIDTRTVEGIDPS---------- 264
            +++    +   NP     +F+ IF  P  +D+W  F I    +  +             
Sbjct: 70  GQDSKI--VAIGNPDSRGTEFHRIFTVPALMDEWNTFTISAYDLPTVTGEVVYPDHPEKQ 127

Query: 265 -------------FHEGIIARYGLDSD-VTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
                         H+  + + G   D     +V G+FP +  ++F P   I+   N   
Sbjct: 128 ERMLKGLTSLDWIQHKERVWKVGGKPDGRFLAKVLGEFPGETDNAFFPQEAIDRG-NDTT 186

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD----------------WSKTDLR 354
              P   +IMG D+A  G D++VV   +G  +                     WSK +  
Sbjct: 187 IDKPEKGIIMGVDLARMGDDDSVVYTNQGGRVRLFKGQVRYSDREGTKTTTGVWSKENTV 246

Query: 355 TTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVDLEF 408
            +  ++  +  +     + +D++  G    D LE L       Y +  +     + +   
Sbjct: 247 ASARRVHAIAMQIGAKQVRLDSSGIGGAVFDELEQLEEFDGKCYTLVGINNANSSSNNMR 306

Query: 409 CRNRRTELHVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAK-- 464
             N R E H  + D L      L     ++++   + ++ +   G + I  K    ++  
Sbjct: 307 WANIRAENHDNLRDMLIKGYLDLDPEDTMLRDELLVITYKLNLRGAVQITPKDEMKSELN 366

Query: 465 -STDYSDGLMYTFAENPPRSDMDFGRCPSYQYE 496
            S D  D ++Y+ A+     D   G  P  + E
Sbjct: 367 GSPDRLDAVIYSLADLDHIVD---GPQPGERIE 396


>gi|315122636|ref|YP_004063125.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496038|gb|ADR52637.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 301

 Score =  170 bits (430), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 61/170 (35%), Positives = 90/170 (52%), Gaps = 8/170 (4%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQ----L 56
           M+     N E +  L   + S  I  +   F  + + WGE+GTPL     PR+WQ    L
Sbjct: 1   MNATFQPNIEYDTALLQNVLSPAIAGNPLAFTKYMYRWGEEGTPLANCKGPRAWQTEVFL 60

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E  E ++ +          +VFK AI++ RGIGKT L AW+  W +STR G +V+  ANS
Sbjct: 61  ELAEFIEKNKEAKRLGKPLQVFKLAIASARGIGKTALVAWITYWFLSTRIGCTVVISANS 120

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQS----LSLHPAPWYSDVLHCSL 162
           + Q KTT +AE+ +W SL  N H+FE       L+   +PW ++ +  +L
Sbjct: 121 DDQCKTTSFAEIRRWHSLAKNAHFFEANIAEALLAGGCSPWQAEPVAKTL 170


>gi|261381054|ref|ZP_05985627.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
 gi|284796087|gb|EFC51434.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
          Length = 450

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/320 (17%), Positives = 116/320 (36%), Gaps = 40/320 (12%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQID 254
             +EA    D     ++  + +  +  +   T NP+ +    Y+ F   P DD     ++
Sbjct: 117 WIEEAENVSDESWNILIPTIRKAGSEIWL--TWNPKNILDPTYQRFVVNPPDDMVDIVVN 174

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--P 312
                 +         +    D D+ R    G+       S I    I+ A++       
Sbjct: 175 YTDNIYLPEVLRLEAESCKARDYDLYRHIWLGEPVADSELSVIKPKWIDAAIDSHIKLGF 234

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI 372
           +     I+G D+A+EG D +  +LR G V+  + +W   D+  + +K+    ++ + D I
Sbjct: 235 EATGQRILGFDVADEGDDASATILRHGSVVIDMDEWRGQDVIYSADKVYLYGQEAKADKI 294

Query: 373 IIDANNTGART-------CDYLEMLGYHVYRVLGQKRA------VDLEFCRNRRTELHVK 419
           + D+   GA            ++ +G++    + +  A       + +   N + +    
Sbjct: 295 VYDSIGVGAGVKAQFRRKTGKVQTIGFNAGGSVFKPEARYTDDKKNKDMFSNIKAQAWWM 354

Query: 420 MAD-------WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESKR- 459
           + +        +EF        LI            +   S       N G + +ESK+ 
Sbjct: 355 VRERFYKTWRAIEFGDTYPIDELISISGSLKDLEYLKAELSRPRVDYDNNGRVKVESKKD 414

Query: 460 --VKGAKSTDYSDGLMYTFA 477
              +G  S + +D L+  FA
Sbjct: 415 MAKRGIPSPNRADALIMAFA 434


>gi|329122215|ref|ZP_08250807.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|327474100|gb|EGF19511.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 452

 Score =  160 bits (404), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 65/440 (14%), Positives = 143/440 (32%), Gaps = 63/440 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T+P I V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLGLQAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+         I    I+ A++  ++         I+
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGVG 305

Query: 381 ART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA----- 421
           A        L+     +                     + +   N + +   ++      
Sbjct: 306 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDVEYVYGKTNRDMFANIKAQAWWRLRDRFYK 365

Query: 422 --------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         + +  +S I     ++   +         G + +ESK   + +G  
Sbjct: 366 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 425

Query: 465 STDYSDGLMYTFAENPPRSD 484
           S + +D L+  FA   P+ D
Sbjct: 426 SPNKADALVMCFA---PKED 442


>gi|229844502|ref|ZP_04464642.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
 gi|229812751|gb|EEP48440.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
          Length = 452

 Score =  158 bits (400), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/440 (14%), Positives = 144/440 (32%), Gaps = 63/440 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T+P I V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLGLQAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E ++     D ++ R    G+         I    I+ A++  ++         I+
Sbjct: 186 KELMEDMVQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWHGEDVIGSADRTRLNALEFGTNEIVYDSIGVG 305

Query: 381 ART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA----- 421
           A        L+     +                     + +   N + +   ++      
Sbjct: 306 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWRLRDRFYK 365

Query: 422 --------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         + +  +S I     ++   +         G + +ESK   + +G  
Sbjct: 366 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 425

Query: 465 STDYSDGLMYTFAENPPRSD 484
           S + +D L+  FA   P+ D
Sbjct: 426 SPNKADALVMCFA---PKED 442


>gi|260580755|ref|ZP_05848581.1| phage terminase large subunit [Haemophilus influenzae RdAW]
 gi|260092572|gb|EEW76509.1| phage terminase large subunit [Haemophilus influenzae RdAW]
          Length = 447

 Score =  153 bits (386), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 72/442 (16%), Positives = 145/442 (32%), Gaps = 59/442 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLSLQAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD----- 422
           A    + + L     V            E              N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 423 --WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
              +++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMDF 487
            + +D L+  +A   P+S +D 
Sbjct: 426 PNMADALVMCYAPTKPKSLLDL 447


>gi|319776448|ref|YP_004138936.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319897217|ref|YP_004135412.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|329123931|ref|ZP_08252483.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|317432721|emb|CBY81084.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317451039|emb|CBY87270.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
 gi|327468126|gb|EGF13613.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 447

 Score =  152 bits (383), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 72/442 (16%), Positives = 144/442 (32%), Gaps = 59/442 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLGLQAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD----- 422
           A    + + L     V            E              N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 423 --WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
              +++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMDF 487
            + +D L+  +A   P+S +D 
Sbjct: 426 PNMADALVMCYAPTKPKSLLDL 447


>gi|145629503|ref|ZP_01785301.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145641440|ref|ZP_01797019.1| predicted phage terminase large subunit [Haemophilus influenzae
           R3021]
 gi|144978346|gb|EDJ88110.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145273983|gb|EDK13850.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.4-21]
 gi|309750959|gb|ADO80943.1| Probable bacteriophage terminase, large subunit [Haemophilus
           influenzae R2866]
          Length = 447

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/442 (16%), Positives = 144/442 (32%), Gaps = 59/442 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QVEMLGLQDFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD----- 422
           A    + + L     V            E              N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 423 --WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
              +++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMDF 487
            + +D L+  +A   P+S +D 
Sbjct: 426 PNMADALVMCYAPTKPKSLLDL 447


>gi|330958838|gb|EGH59098.1| hypothetical protein PMA4326_09820 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 512

 Score =  151 bits (381), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 89/239 (37%), Gaps = 22/239 (9%)

Query: 267 EGIIARYGLDSDVTRVEVC---GQFPQQDIDSF--------IPLNIIEEALNREPC-PDP 314
           E +  R G  S     +V     ++P     +F        I    +  A  +E      
Sbjct: 253 EQMAWRAGKISSDFANDVDFFNQEYPATPDLAFQKVGHKPLIKTVKVSLARKKEIKHERR 312

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI-I 373
               ++G D A  GGD +  + R+G V   +   +  D      + + ++   +   +  
Sbjct: 313 IGAHVVGLDPAR-GGDTSTFIHRQGRVAWGIERNNIPDTMAVVGQAARMLMDDKTIRMMF 371

Query: 374 IDANNTGARTCDYLEMLGY--HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE---FAS 428
           ID    GA   D L  LG+   V  V     A D     N+R E+  +MA+W+      S
Sbjct: 372 IDIGGLGAGIYDRLVELGFGDRVTAVNFGSSASDSRKYANKRCEMWGEMAEWIHDDITPS 431

Query: 429 LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSD 484
           + +   L  +L S       + G+L +  K   + K  +S D  D L  TFAE     D
Sbjct: 432 IPDDDQLHSDLTSAAKDKYTSNGQLKLLPKEDAKKKIGRSPDDGDALALTFAEPVSADD 490


>gi|68250076|ref|YP_249188.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058275|gb|AAX88528.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 447

 Score =  149 bits (377), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 72/442 (16%), Positives = 144/442 (32%), Gaps = 59/442 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLGLQNFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIECAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNDNAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD----- 422
           A    + + L     V            E              N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 423 --WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
              ++   +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKHGDVYPDDELISLSSNIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMDF 487
            + +D L+  +A   P+S +D 
Sbjct: 426 PNMADALVMCYATTKPKSLLDL 447


>gi|301170180|emb|CBW29784.1| predicted phage terminase large subunit [Haemophilus influenzae
           10810]
          Length = 447

 Score =  147 bits (372), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 70/442 (15%), Positives = 141/442 (31%), Gaps = 59/442 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLADQ 73

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
             +      +            S+      +T +     +  G        +  +E    
Sbjct: 74  VEMLGLQDFFDVQKTQIIEQNGSRFTFAGLKT-NITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W    +  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGYVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD----- 422
           A    + + L     V            E              N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 423 --WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
              +++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMDF 487
            + +D L+  +A   P+S +D 
Sbjct: 426 PNMADALVMCYAPTKPKSLLDL 447


>gi|16273317|ref|NP_439561.1| terminase large subunit-like protein [Haemophilus influenzae Rd
           KW20]
 gi|1175785|sp|P44184|Y1410_HAEIN RecName: Full=Uncharacterized protein HI_1410
 gi|1574247|gb|AAC23058.1| predicted coding region HI1410 [Haemophilus influenzae Rd KW20]
          Length = 394

 Score =  146 bits (369), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 63/402 (15%), Positives = 133/402 (33%), Gaps = 46/402 (11%)

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
           ++ E+ K +S    +   + Q   L    ++       +G +   ++      +     +
Sbjct: 1   MFREIQKSISDSVIQMLAD-QIEMLSLQAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKS 59

Query: 184 FVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN- 242
             G        +  +E           ++  + E  +    I++ NP+ +    Y+ F  
Sbjct: 60  MTGID-----VVWVEEGENVSKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVI 112

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
            P +  K   ++ +          E +      D ++ R    G+       + I    I
Sbjct: 113 HPPERCKSVLVNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWI 172

Query: 303 EEALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           E A++   +          +G D+A+EG D+       G V+  +  W   D+  + N+ 
Sbjct: 173 EYAVDAHLKLGFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRT 232

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAVDLE----------- 407
           +    K++ D II D+   GA    + + L     V            E           
Sbjct: 233 NQSAVKFKADLIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQD 292

Query: 408 FCRNRRTELHVKMAD-------WLEFASLINHSGLI------------QNLKSLKSFIVP 448
              N + +    + D        +++  +     LI            +   S       
Sbjct: 293 MFSNIKAQSWWALRDRFYKTYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYD 352

Query: 449 NTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
           N G + +ESK   + +G  S + +D L+  +A   P+S +D 
Sbjct: 353 NNGRVKVESKKDMKKRGIPSPNMADALVMCYAPTKPKSLLDL 394


>gi|68249883|ref|YP_248995.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058082|gb|AAX88335.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 438

 Score =  145 bits (366), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/441 (14%), Positives = 152/441 (34%), Gaps = 64/441 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++  ++ R  + V C    +  +  ++   ++  +  L     FE+
Sbjct: 12  GGRGSGKSWGVAQLLI-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIEDLGYLEEFEV 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q  +++     S+ +   +  +              +  +  G        +  +EA   
Sbjct: 71  QRNAIYCLKTGSEFMFYGIKNNP------------NKIKSLEGID-----LVWIEEAENV 113

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGI 261
            +     ++  + +  +   W+ T NP+ +    Y+ F    P + + R +I+       
Sbjct: 114 SNESWDILIPTIRKERSE-IWV-TFNPKNILDPTYQRFVIAPPKNSFVR-KINYDENPYF 170

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLI 319
             +    +      D ++ R    G+         I    IE A++  ++    P    I
Sbjct: 171 PETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKI 230

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   
Sbjct: 231 VGFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGV 290

Query: 380 GART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA---- 421
           GA        L+     +                     + +   N + +   ++     
Sbjct: 291 GAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWRLRDRFY 350

Query: 422 ---------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGA 463
                          + +  +S I     ++   +         G + +ESK   + +G 
Sbjct: 351 KTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGI 410

Query: 464 KSTDYSDGLMYTFAENPPRSD 484
            S + +D L+  FA   P+ D
Sbjct: 411 PSPNKADALVMCFA---PKED 428


>gi|329119006|ref|ZP_08247700.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464879|gb|EGF11170.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 449

 Score =  145 bits (366), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/322 (17%), Positives = 105/322 (32%), Gaps = 42/322 (13%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQI 253
             +EA          ++  +        W+   NP+ +    Y+ F  + P D     + 
Sbjct: 114 WVEEAEAVTKNSWDVLIPSIRGDKNAEIWVSF-NPKNILDDTYQRFIVHPPKDS-IVLKA 171

Query: 254 DTRTVEGI-DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
           +        D      ++     D D+ R    G+       + I  + IE A++     
Sbjct: 172 NYDINPHFADTPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAAIDAHEKL 231

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD 370
                   I+G D+A+EG D    VLR G V+  +  W   D+  + +K+    ++   D
Sbjct: 232 GFSAAGRRILGFDVADEGDDANATVLRHGSVVTDMQQWRGQDVIYSADKVYLYAQEQNVD 291

Query: 371 AIIIDANNTGART-------CDYLEMLGYHVYRVLGQKRA------VDLEFCRNRRTELH 417
            I+ D    GA            ++ LG++    + +  A       + +   N + +  
Sbjct: 292 RIVYDNIGVGAGVKAQFRRKNGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFANIKAQAW 351

Query: 418 VKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESK 458
             + D        +          LI                S         G +  ESK
Sbjct: 352 WMVRDRFYKTWRAVHHGDSYPEDQLISLSSSLHELEYLTAELSRPQVDYDQNGRVKAESK 411

Query: 459 ---RVKGAKSTDYSDGLMYTFA 477
              + +G  S + +D L+  FA
Sbjct: 412 KDMKKRGIPSPNRADALVMVFA 433


>gi|309379923|emb|CBX21334.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 449

 Score =  144 bits (362), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/322 (17%), Positives = 104/322 (32%), Gaps = 42/322 (13%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQI 253
             +EA          ++  +        W+   NP+ +    Y  F  + P D     + 
Sbjct: 114 WVEEAEAVTKNSWDVLIPSIRGDKNAEIWVSF-NPKNILDDTYRRFIVHPPQDS-IVLKA 171

Query: 254 DTRTVEGI-DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
           +        D      ++     D D+ R    G+       + I  + IE A++     
Sbjct: 172 NYDINPHFADTPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAAIDAHEKL 231

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD 370
                   I+G D+A+EG D    VLR G V+  +  W   D+  + +K+    ++   D
Sbjct: 232 GFQAAGKRILGFDVADEGDDANATVLRHGSVVTDMRQWRGQDVIYSADKVYLYAQEQDID 291

Query: 371 AIIIDANNTGARTC-------DYLEMLGYHVYRVLGQKRA------VDLEFCRNRRTELH 417
            I+ D    GA            ++ LG++    + +  A       + +   N + +  
Sbjct: 292 RIVYDNIGVGAGVKAQFRRKRGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFANIKAQAW 351

Query: 418 VKMAD-------WLEFASLINHSGL------------IQNLKSLKSFIVPNTGELAIESK 458
             + D        +          L            +    S         G +  ESK
Sbjct: 352 WMVRDRFYKTWRAVHHGDSYPEDQLVSLSSSLHELEYLTAELSRPQVDYDQNGRVKAESK 411

Query: 459 ---RVKGAKSTDYSDGLMYTFA 477
              + +G  S + +D L+  FA
Sbjct: 412 KDMKKRGIPSPNRADALVMAFA 433


>gi|145629819|ref|ZP_01785613.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148827544|ref|YP_001292297.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
 gi|144977965|gb|EDJ87753.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148718786|gb|ABQ99913.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
          Length = 449

 Score =  143 bits (361), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 65/441 (14%), Positives = 151/441 (34%), Gaps = 64/441 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++  ++ R  + V C    +  +  ++   ++  +  L     FE+
Sbjct: 23  GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIEDLGYLEEFEV 81

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q  +++     S+ +   +  +              +  +  G        +  +EA   
Sbjct: 82  QRNAIYCLKTGSEFMFYGIKNNP------------NKIKSLEGID-----LVWIEEAENV 124

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGI 261
            +     ++  + +  +   W+ T NP+ +    Y+ F    P + + R +I+       
Sbjct: 125 SNESWDILIPTIRKERSE-IWV-TFNPKNILDPTYQRFVIAPPKNSFVR-KINYDENPYF 181

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLI 319
             +    +      D ++ R    G+         I    IE A++  ++    P    I
Sbjct: 182 PETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKI 241

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   
Sbjct: 242 VGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRTRLNALEFGANEIVYDSIGV 301

Query: 380 GART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA---- 421
           GA        L+     +                     + +   N + +    +     
Sbjct: 302 GAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFY 361

Query: 422 ---------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGA 463
                          + +  +S I     ++   +         G + +ESK   + +G 
Sbjct: 362 KTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGI 421

Query: 464 KSTDYSDGLMYTFAENPPRSD 484
            S + +D L+  FA   P+ D
Sbjct: 422 PSPNKADALVMCFA---PKED 439


>gi|319775727|ref|YP_004138215.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319896735|ref|YP_004134928.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|317432237|emb|CBY80589.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317450318|emb|CBY86534.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
          Length = 449

 Score =  143 bits (360), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/441 (14%), Positives = 151/441 (34%), Gaps = 64/441 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++  ++ R  + V C    +  +  ++   ++  +  L     FE+
Sbjct: 23  GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIEDLGYLEDFEV 81

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q  +++     S+ +   +  +              +  +  G        +  +EA   
Sbjct: 82  QRNAIYCLKTGSEFMFYGIKNNP------------NKIKSLEGID-----LVWIEEAENV 124

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGI 261
            +     ++  + +  +   W+ T NP+ +    Y+ F    P + + R +I+       
Sbjct: 125 SNESWDILIPTIRKERSE-IWV-TFNPKNILDPTYQRFVIAPPKNSFVR-KINYDENPYF 181

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLI 319
             +    +      D ++ R    G+         I    IE A++  ++    P    I
Sbjct: 182 PETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKI 241

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   
Sbjct: 242 VGFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGV 301

Query: 380 GART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA---- 421
           GA        L+     +                     + +   N + +    +     
Sbjct: 302 GAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFY 361

Query: 422 ---------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGA 463
                          + +  +S I     ++   +         G + +ESK   + +G 
Sbjct: 362 KTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGI 421

Query: 464 KSTDYSDGLMYTFAENPPRSD 484
            S + +D L+  FA   P+ D
Sbjct: 422 PSPNKADALIMCFA---PKED 439


>gi|260583110|ref|ZP_05850891.1| phage terminase large subunit [Haemophilus influenzae NT127]
 gi|260093822|gb|EEW77729.1| phage terminase large subunit [Haemophilus influenzae NT127]
          Length = 445

 Score =  143 bits (360), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/441 (14%), Positives = 151/441 (34%), Gaps = 64/441 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++  ++ R  + V C    +  +  ++   ++  +  L     FE+
Sbjct: 19  GGRGSGKSWGVAQLLV-EIAVRTKVRVFCGRELQNSMSDSVIKLIADTIEDLGYLEEFEV 77

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q  +++     S+ +   +  +              +  +  G        +  +EA   
Sbjct: 78  QRNAIYCLKTGSEFMFYGIKNNP------------NKIKSLEGID-----LVWIEEAENV 120

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGI 261
            +     ++  + +  +   W+ T NP+ +    Y+ F    P + + R +I+       
Sbjct: 121 SNESWDILIPTIRKERSE-IWV-TFNPKNILDPTYQRFVIAPPKNSFVR-KINYDENPYF 177

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLI 319
             +    +      D ++ R    G+         I    IE A++  ++    P    I
Sbjct: 178 PETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKI 237

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   
Sbjct: 238 VGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRTRLNALEFGANEIVYDSIGV 297

Query: 380 GART---CDYLEMLGYHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMA---- 421
           GA        L+     +                     + +   N + +    +     
Sbjct: 298 GAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFY 357

Query: 422 ---------------DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGA 463
                          + +  +S I     ++   +         G + +ESK   + +G 
Sbjct: 358 KTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGI 417

Query: 464 KSTDYSDGLMYTFAENPPRSD 484
            S + +D L+  FA   P+ D
Sbjct: 418 PSPNKADALVMCFA---PKED 435


>gi|145638997|ref|ZP_01794605.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
 gi|145271969|gb|EDK11878.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
          Length = 379

 Score =  142 bits (359), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/332 (16%), Positives = 111/332 (33%), Gaps = 40/332 (12%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +E           ++  + E  +    I++ NP+ +    Y+ F   P +  K   
Sbjct: 50  VVWVEEGENVSKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVL 107

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           ++ +          E +      D ++ R    G+       + I    IE A++   + 
Sbjct: 108 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKL 167

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD 370
                    +G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D
Sbjct: 168 GFTTKGMKKVGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKAD 227

Query: 371 AIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELH 417
            II D+   GA    + + L     V            E              N + +  
Sbjct: 228 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSW 287

Query: 418 VKMAD-------WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK 458
             + D        +++  +     LI            +   S       N G + +ESK
Sbjct: 288 WALRDRFYKTYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESK 347

Query: 459 ---RVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
              + +G  S + +D L+  +A   P+S +D 
Sbjct: 348 KDMKKRGIPSPNMADALVMCYAPTKPKSLLDL 379


>gi|307251380|ref|ZP_07533296.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306856621|gb|EFM88761.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 384

 Score =  135 bits (340), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 57/376 (15%), Positives = 121/376 (32%), Gaps = 46/376 (12%)

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
            E Q   L+  P++       +G +   ++      +     +  G        +  +E 
Sbjct: 2   LEDQIEILNLKPFFEVQKTQIIGRNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEG 56

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVE 259
                     ++  + E  +    I++ NP+ L    Y+ F   P +      ++ +   
Sbjct: 57  ENVSKESWDVLIPTIREDGSQI--IVSFNPKNLLDDTYQRFVINPPERCCSVLVNWQDNP 114

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAP 317
                  E +      D ++ R    GQ       + I    IE+A++  ++        
Sbjct: 115 YFPKELMEDMKQMKERDFELYRHVYEGQPVADSDLAIIKPLWIEKAVDAHKKLGFTASGR 174

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDAN 377
            ++G D+A+EG D        G V+  + +W   D+  + ++       +  D I+ D+ 
Sbjct: 175 KVVGFDVADEGIDANANCFAHGSVVLQVDEWRGDDVIQSAHRTHTNAVMWGVDEIVFDSI 234

Query: 378 NTGART---CDYLEMLGYHVYRVLGQKRAVDL-----------EFCRNRRTELHVKMAD- 422
             GA        ++                +            E   N + +    + D 
Sbjct: 235 GVGAGVKAEYRRMDTKRILCSGFNAGASVFEPDEYYTQDKTNGEMFANIKAQAWWLLRDR 294

Query: 423 ------WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESKR---VK 461
                  +EF  +     +I            +   S       N G++ +ESK+    +
Sbjct: 295 FYKTYRAIEFGDVYPVDEMISLSSDIKDLEYLKAELSRPRVDHDNNGKVRVESKKDMRKR 354

Query: 462 GAKSTDYSDGLMYTFA 477
           G  S + +D L+  FA
Sbjct: 355 GIPSPNKADSLVMCFA 370


>gi|85058727|ref|YP_454429.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779247|dbj|BAE74024.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 456

 Score =  135 bits (340), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/456 (16%), Positives = 141/456 (30%), Gaps = 68/456 (14%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
            P  +K A   GRG GK+   A   L +   R G      A            E    ++
Sbjct: 13  QPHRYKIA-KGGRGSGKSW--AIARLLVEIARRGTYRFLCA-----------REFQASMA 58

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +   +      +   +     +         +       +  +  +  G       
Sbjct: 59  DSVIQLIADTIQREGYLKEFEIQKAYIRYLATDSLFMFYGIKNNVTKIKSLEGID----- 113

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
               +EA          ++  + +  +   W+   NP+ +    Y+ F   PLDD     
Sbjct: 114 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVNPLDDICLLT 171

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
           +               +      D D+      G+       + I    I  A++     
Sbjct: 172 VHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHITL 231

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD 370
             +P     +G D+A+EG D+  ++L  G V+ HL  W+K D+  + +++    E    D
Sbjct: 232 GFEPAGKKRIGFDVADEGEDSNALILSHGSVVMHLETWNKGDVIQSADRVKNYAESVIAD 291

Query: 371 AIIIDANNTGARTCDYLEML------GYHVYRVLGQKRA------VDLEFCRNRRTELHV 418
            II D+   GA     L  +      G++    + +  A       + +   N + +   
Sbjct: 292 EIIFDSIGVGAGVKARLRRVSRITASGFNAGGGVFKPDAKYVDGKTNKDMFVNLKAQAWW 351

Query: 419 KMADW----LEFASLI----NHSGLIQNLK---------------------SLKSFIVPN 449
            + +           I    + S  ++ L+                     S       N
Sbjct: 352 GVRERFYNTWHAVEYIKHHPDDSDFVKGLRDDQLISLSSRLSSLDYLKAELSRPWVDYDN 411

Query: 450 TGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
            G + +ESK   + +G  S + +D L+  FA     
Sbjct: 412 NGRVKVESKKDMKKRGIPSPNRADALIMAFAPTYKP 447


>gi|149174861|ref|ZP_01853485.1| hypothetical protein PM8797T_10814 [Planctomyces maris DSM 8797]
 gi|148846198|gb|EDL60537.1| hypothetical protein PM8797T_10814 [Planctomyces maris DSM 8797]
          Length = 568

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 84/530 (15%), Positives = 153/530 (28%), Gaps = 141/530 (26%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             WQ + +E +              + +  +    G GK                   +I
Sbjct: 57  DDWQWDILESLFD----------LTIRRVFVKGNTGCGKGAAAGIACCTYFHIWNDAKII 106

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
              +S    +   + EV KW   +  K   ++ +  +     +S  L             
Sbjct: 107 ITRDSVRTAQKIAFGEVDKWWRKMRFKPPGKLLTSGVFDNNQHSISL------------- 153

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
                + +  + F G H+ + +    DEA+     +        T+    + ++  SNP 
Sbjct: 154 ----ANPQHIEGFRGAHSPH-VFFWFDEAT--APNLEDKYKLANTQA---KKFLALSNPS 203

Query: 232 RLSGKFYEIFNKPLDDW-----------KRFQIDTRTVEGIDPSFHEGIIARYG------ 274
            LSG F + F     D            +   +       +     E  +A  G      
Sbjct: 204 TLSGTFRDSFPVVNPDKTQTIIDQYGNTRCITVSGWECTNVKEKCLEQPVAPIGGIKISD 263

Query: 275 ------------------------------------LDSDVTRVEVCGQFPQQDID-SFI 297
                                                D  +  V   G+FP QD D   I
Sbjct: 264 NYYPHGSPIAADDFEKVQPRIPGQTCYDEFMALLNDADPLIRNVYALGKFPDQDPDKQVI 323

Query: 298 PLNIIEE------ALNREPCPDPYAPLIM--------------GCDIA--EEGGDNTVVV 335
             + + E        NR          I+              G D+A    G D +V+ 
Sbjct: 324 LPDWLIEPVKFWTRWNRLCLRAREQFHILALKLLEQILPVEGFGLDVAASRFG-DASVLA 382

Query: 336 LRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA------IIID-ANNTGARTCDYLE 388
           +     I  + +   +D + T + +      +  D       I ID     G    D L+
Sbjct: 383 VGGRYGIRAIHECQFSDTQQTMSWVLETANSHGVDLEQGIVPIAIDWGGGYGNAVGDPLK 442

Query: 389 MLGYHVYRVLG-QKRAVDLEFCRNRRTELHVKMADWLEFAS--------LINHSGLIQNL 439
               +V  + G     +D +   N+R EL+ + A  L+ A         L ++  L   L
Sbjct: 443 KRNVNVIEIHGNASSNLDSKKYANKRAELYGEAARRLDPAGDFRMMPFALPDNQRLKAEL 502

Query: 440 KSLKSFIVPNTG-ELAIESKRVKG--------------AKSTDYSDGLMY 474
            + +     + G +  I  K  +G               +S D +D ++Y
Sbjct: 503 VAPEKIYAGHDGEKYYITPKGRRGSDANYNGKTLHEILGRSPDRADAVVY 552


>gi|261402679|ref|YP_003246903.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
 gi|261369672|gb|ACX72421.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
          Length = 437

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 74/390 (18%), Positives = 138/390 (35%), Gaps = 47/390 (12%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           ++AGR  GK+ L  +L+++L  T+       +A      +  ++ E+  ++         
Sbjct: 50  VAAGRRFGKSKLMCFLLIFLSCTQKDKKFAVIAPYYANAR-IIFKELRTYIEKNKTLQKL 108

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 +  +P+          ID +         S + P +  G        +I DEA+
Sbjct: 109 ---VKRITESPYMVIEFKTGCIIDFR---------SADNPTSIRG---ESYHLVILDEAA 153

Query: 202 GT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF---NKPLDDWKRFQIDTRT 257
               DV+   I   L + +A    I  S P   +  FYE F       +    F+  T +
Sbjct: 154 FIKDDVVKYVIKPLLIDYDAP--LIEISTPNGHN-HFYESFLMGENRQNRHISFRFPTWS 210

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI----DSFIPLNIIEEALNREPCPD 313
              +  S  E I   +G DS V + E C +F           +I    I+  +      +
Sbjct: 211 NPFLPKSVIEEIKREFGEDSLVWKQEFCAEFIDDQDAVFKWEYI-QQCIDSNIELLTVGE 269

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRT---TNNKISGLVEKYRPD 370
                +MG D+A+      +++L        L  + +   +       +I  L  K++P 
Sbjct: 270 KGHRYVMGVDLAKYQDYTVIIILDVSENPYKLVYFERFKDKPYSYVVERIKELYIKFKP- 328

Query: 371 AIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI 430
            + +D+   G    + LE      ++   Q +            +L  K+   LE   +I
Sbjct: 329 VVCVDSTGVGDPVVEQLEDCNPIPFKFTNQSK-----------MQLITKLQTALERKEVI 377

Query: 431 --NHSGLIQNLKSLKSFIVPNTGELAIESK 458
                 LI  LK  +   V     ++ E+K
Sbjct: 378 FPYIDTLITELKYFRY--VKKKTTISFEAK 405


>gi|241763591|ref|ZP_04761642.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
 gi|241367184|gb|EER61538.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
          Length = 521

 Score =  130 bits (327), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/233 (24%), Positives = 94/233 (40%), Gaps = 26/233 (11%)

Query: 275 LDSDVTRVEVCGQFPQQDID---SFIPLNIIEEALNR-EPCPDPYAPLIMGCDIAEEGGD 330
           L   +    + G F     D     IP   ++ A  R +P  D     ++G D A  G D
Sbjct: 267 LPEPLRSQMLRGDFSAGAADPAWQLIPTEWVKAAQARWQPRQDKGPMTVLGLDPARGGTD 326

Query: 331 NTVVVLRRGPVIEHLFDWSK---TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            T V  R     + L         D  TT    + LV       I +DA   G+   D++
Sbjct: 327 KTSVARRHDCWFDVLISEPGIVTKDGPTTAAFTAPLVR--NGAPIAVDAIGIGSSALDFI 384

Query: 388 EMLGYHVYRVLGQKRAVDLE-----FCRNRRTELHVKMADWL-----EFASLINHSGLIQ 437
           + LG  VY V+G +R+  ++       RNRR E++ ++ + L     +  +L     L+ 
Sbjct: 385 QGLGLLVYAVVGSERSDHMDKAGTMRFRNRRAEMYWRLREALDPTAEQPIALPPDQELLG 444

Query: 438 NLKSLKSFIVPNTGE---LAIESK---RVKGAKSTDYSDGLMYTFAENPPRSD 484
           +L +++ + V   G+   + I  K   R    +S D  D +  TF E  P  D
Sbjct: 445 DLTAVR-YKVVTMGQGAAIQIRDKDEIREALGRSPDKGDSVAMTFCEGIPLLD 496


>gi|303243859|ref|ZP_07330199.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
 gi|302485795|gb|EFL48719.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
          Length = 445

 Score =  128 bits (322), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 66/321 (20%), Positives = 121/321 (37%), Gaps = 31/321 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           ++AGR  GK+ L A+L+++L ST+       +A      +  ++ E+ K++      +  
Sbjct: 56  VAAGRRFGKSKLMAFLLIFLCSTQKNKKYAVIAPFYANAR-IIFRELKKYIEKS---NVL 111

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 +  +P+ +        ID +         S + P +  G        +I DEA+
Sbjct: 112 SRLVKRMVESPYMAIEFKTGCTIDFR---------SADNPTSIRG---ESYHLVILDEAA 159

Query: 202 GT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF---NKPLDDWKRFQIDTRT 257
               DV+   I   L + +A    I  S P   +  FYE F       +    F+  T T
Sbjct: 160 FIKDDVVKYVIKPLLLDYDAP--LIEISTPNGHN-HFYESFLMGKNKQNRHISFRFPTWT 216

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI----DSFIPLNIIEEALNREPCPD 313
              +  +  E I    G DS V + E C +F   +       +I    I+  +      +
Sbjct: 217 NPFLPKNAIEEIKQEVGEDSPVWKQEYCAEFIDNNEAVFNWEYI-QQCIDGTIKLLKSGE 275

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRT---TNNKISGLVEKYRPD 370
                +MG D+A+      + VL        L  + + +L       +K+  L + +   
Sbjct: 276 SGHQYVMGVDLAKFEDYTVITVLDVSVKPYKLVYFERFNLMPYSFVADKVKELYQLFNKP 335

Query: 371 AIIIDANNTGARTCDYLEMLG 391
            + +DA   GA   + +E L 
Sbjct: 336 QVCMDATGPGAAVVEQVESLN 356


>gi|187476925|ref|YP_784949.1| phage terminase large subunit [Bordetella avium 197N]
 gi|115421511|emb|CAJ48020.1| Putative phage terminase large subunit [Bordetella avium 197N]
          Length = 512

 Score =  120 bits (302), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 75/359 (20%), Positives = 123/359 (34%), Gaps = 60/359 (16%)

Query: 194 AIINDEASGTPDVINLGILG--FLTERNANRFWIMTSNP-RRLSGKFYEIFNKPLDDWKR 250
            I+ DEA+   +     +LG    T+       +MT NP   + G++   +  P  D K 
Sbjct: 144 LIVLDEATELREHQARFVLGWNRTTKAGQRCRVLMTFNPPTTVEGRWVVEYFAPWLDPKH 203

Query: 251 FQ------------IDTRTVEGI---------------DPSFHEGIIAR----------- 272
                         ID + VE                   +F    IA            
Sbjct: 204 PHPAKPGELRWFAVIDGKEVEVEGGAPFAHNGETIVPRSRTFIPSRIADNPFLMGTGYES 263

Query: 273 --YGLDSDVTRVEVCGQF---PQQDIDSFIPLNIIEEALNREPCPDPYAPLI-MGCDIAE 326
               L   +    + G F    + D    IP   +E A  R   PD  AP+  +G D+A 
Sbjct: 264 VLQSLPEPLRSQMLYGDFNAGIEDDPWQVIPTAWVEAAQARWKRPDRLAPMDSLGLDVAR 323

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII-IDANNTGARTCD 385
            G D T++  R G   +    +   D           +   R  A+I +D    GA   D
Sbjct: 324 GGRDKTILARRHGWWFDEPLVYPGKDTPDGPTVAGLAISALRDHAVIHLDVIGVGASPYD 383

Query: 386 YLEMLGYHVYRVLGQKRAVDLE-----FCRNRRTELHVKMADWLE-----FASLINHSGL 435
           +L      V  V   + A   +        NRR+EL  +M + L+       +L     L
Sbjct: 384 FLVTAKQQVVGVNVAEAACGTDKSGRLRFFNRRSELWWRMREALDPIHNTGIALPPDPRL 443

Query: 436 IQNLKSLKSFIVPNTGELA-IESKRVKGAKSTDYSDGLMYTFAENPPRSDMD-FGRCPS 492
           + +L +    +   T ++A  E    K  +S D+    +    + P R+ ++  G+  S
Sbjct: 444 LADLTAPTWSLSGATLKVASREDIIDKIGRSPDFGSAYVLALMDTPKRAAVEALGQARS 502


>gi|41179386|ref|NP_958694.1| Bbp25 [Bordetella phage BPP-1]
 gi|45569518|ref|NP_996587.1| hypothetical protein BMP-1p24 [Bordetella phage BMP-1]
 gi|45580769|ref|NP_996635.1| hypothetical protein BIP-1p24 [Bordetella phage BIP-1]
 gi|40950125|gb|AAR97691.1| Bbp25 [Bordetella phage BPP-1]
          Length = 533

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 87/237 (36%), Gaps = 21/237 (8%)

Query: 275 LDSDVTRVEVCGQF---PQQDIDSFIPLNIIEEALNREPCPDPYAPLI-MGCDIAEEGGD 330
           L   +    + G F    + D    IP   +E A  R   PD  AP+  +G D+A  G D
Sbjct: 289 LPEPLRSQMLYGDFNAGIEDDPWQVIPTAWVEAAQARWKRPDRLAPMDSLGVDVARGGRD 348

Query: 331 NTVVVLRRGPVIEHLFDWSKTDL---RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           NT++  R     +    +   D     T        +  +    I +D    GA   D+L
Sbjct: 349 NTILARRHAMWFDVPLTYPGKDTPDGPTVAGLAIAALRDH--AVIHLDVIGVGASPYDFL 406

Query: 388 EMLGYHVYRVLGQKRAVDLE-----FCRNRRTELHVKMADWLE-----FASLINHSGLIQ 437
                 V  V   + A   +        N R+EL  +M + L+       +L     L+ 
Sbjct: 407 AQAKQQVVGVNVAEAARGTDKSGRLRFFNLRSELWWRMREALDPTNNTGIALPPDPRLLA 466

Query: 438 NLKSLKSFIVPNTGELA-IESKRVKGAKSTDYSDGLMYTFAENPPRSDMD-FGRCPS 492
           +L +    +   T ++A  E    K  +S D+    +    + P R+ ++  G+  S
Sbjct: 467 DLTAPTWSLSGATLKVASREDIIEKIGRSPDFGSAYVLALMDTPKRAAVEALGQARS 523


>gi|300907068|ref|ZP_07124735.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|301304068|ref|ZP_07210185.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|300401186|gb|EFJ84724.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|300840675|gb|EFK68435.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|315257729|gb|EFU37697.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           85-1]
          Length = 440

 Score =  114 bits (285), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/340 (15%), Positives = 105/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 96  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 153

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 154 INYDENPFLSDTMLKVIEAAKRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 213

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      + R
Sbjct: 214 NFEPSGRKRIGFDVADSGADKCANVYRHGSVVYWADEWKAKEDELLKSCQRTYQAALE-R 272

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQKRA----------VDL 406
              I+ D+   GA        +              +  R                  + 
Sbjct: 273 DADIVYDSIGVGASAGAKFAEINEDRKRENMNASRINYQRFNAGAGVNEPDYEYIGIPNK 332

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQNLKSLKSF------------IV 447
           +F  N + +    +AD        ++         LI    S                  
Sbjct: 333 DFFANLKAQAWWLVADRFRNTFNAVKNGEQYPVDELISIDSSCPLLEKLKLELTTPHRDF 392

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 393 DKNGRVMVESKKDLAKRDVPSPNVADAFIMAFAPTDTAMD 432


>gi|226940437|ref|YP_002795511.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715364|gb|ACO74502.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 133

 Score =  113 bits (282), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 53/126 (42%), Gaps = 11/126 (8%)

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           +  AN++TQL+T    EV KW  L    HWF+ QS S+                 +K + 
Sbjct: 1   MITANTDTQLRTKTSPEVGKWQRLSITSHWFDPQSASIAA----------RDKEHAKTWR 50

Query: 171 TMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
                +SE   + F G HN    + +I DEAS   D +     G LT+      WI   N
Sbjct: 51  ADFVPWSEHNTEAFAGLHNKGKRIVLIFDEASAIADKVWEVAEGALTDEETEIIWIAFGN 110

Query: 230 PRRLSG 235
           P R  G
Sbjct: 111 PTRNIG 116


>gi|229125159|ref|ZP_04254306.1| hypothetical protein bcere0016_54220 [Bacillus cereus 95/8201]
 gi|228658294|gb|EEL13987.1| hypothetical protein bcere0016_54220 [Bacillus cereus 95/8201]
          Length = 164

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 53/147 (36%), Gaps = 21/147 (14%)

Query: 354 RTTNNKISGLVEKY--------RPDAIIIDANNTGARTCDYLEM------LGYHVYRVLG 399
                 +    +KY        +   I ID    G    D L+           V  +  
Sbjct: 1   MYVTGLLIKEAKKYFSWCERTGKRIPIRIDDTGVGGGVTDRLKEVVAENDYPIDVIPINF 60

Query: 400 QKRAVDLEFCRNRRTELHVKMADW-LEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK 458
             +           + ++    D  LEF S+ +   LI  L S++ + + + G + IE K
Sbjct: 61  ASK--GNAEYACIVSVMYGHFKDNCLEFVSIPDDEDLIAQL-SVRKYQINSDGRIKIEPK 117

Query: 459 ---RVKGAKSTDYSDGLMYTFAENPPR 482
              + +G KS D ++ ++  FA   P+
Sbjct: 118 KAMKDRGLKSPDRAEAVVMAFAPFYPK 144


>gi|218290759|ref|ZP_03494841.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239297|gb|EED06496.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 422

 Score =  111 bits (277), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 65/365 (17%), Positives = 125/365 (34%), Gaps = 42/365 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
           S P S QL  + +   H      + +   F+ A + GR  GKT   A  +       PG 
Sbjct: 7   SEPTSKQLR-LRLYTPHSGQVALHRSTARFRVA-TCGRRWGKTYACANEIAKWAWEHPGA 64

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
               +A +  Q                       + +  +    ++  +   +       
Sbjct: 65  MTWWVAPTYRQ----------------------TLTAYRIITRNFHGAIEKATTTHMRIE 102

Query: 169 YSTMCRT--YSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL-GFLTERNANRFWI 225
           + +   T   S E  D   G        ++ DEA+  P       L   L+++      I
Sbjct: 103 WKSGSITEFRSTENFDALRG---EGLDFLVVDEAAMVPKEAWEAALRPTLSDKAGRA--I 157

Query: 226 MTSNPRRLSGKFYEIFNKP----LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
           + S P+  +  FY ++ +       +W+ F+  T     I P   E   AR  L SDV R
Sbjct: 158 IVSTPKGRN-WFYHVWARGQDPAFPEWESFRFPTLANPYIPPEEVEE--ARTTLPSDVFR 214

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLR-RGP 340
            E   +F +     F  +        +E  P P    ++G D+A+    + +VV+     
Sbjct: 215 QEYEAEFLEDSAGVFRGIRDCIS--GQEEEPQPGRRYVVGWDVAKHQDFSVLVVMDLERA 272

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQ 400
            +  +  +++ D      ++  + ++Y    +++DA   G    + +  +G         
Sbjct: 273 HVVKMDRFNQVDYALQLERVKHICQRYNNARLLMDATGVGDPLLEQVRRMGIQAEGYSLS 332

Query: 401 KRAVD 405
             A  
Sbjct: 333 NTAKQ 337


>gi|74311301|ref|YP_309720.1| putative bacteriophage protein [Shigella sonnei Ss046]
 gi|73854778|gb|AAZ87485.1| putative bacteriophage protein [Shigella sonnei Ss046]
          Length = 473

 Score =  110 bits (274), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 128 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 185

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 186 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 245

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 246 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 305

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 306 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 364

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 365 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 424

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 425 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 464


>gi|188492395|ref|ZP_02999665.1| phage terminase large subunit [Escherichia coli 53638]
 gi|188487594|gb|EDU62697.1| phage terminase large subunit [Escherichia coli 53638]
          Length = 467

 Score =  110 bits (274), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 122 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 179

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 180 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 239

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 240 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 299

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 300 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 358

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 359 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 418

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 419 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 458


>gi|16759908|ref|NP_455525.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142320|ref|NP_805662.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213583175|ref|ZP_03365001.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213647535|ref|ZP_03377588.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213855100|ref|ZP_03383340.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|25512685|pir||AF0621 probable prophage terminase large chain STY1047 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16502201|emb|CAD05440.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137950|gb|AAO69511.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 467

 Score =  110 bits (274), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 110/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 122 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 179

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 180 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 239

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 240 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 298

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 299 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 358

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 359 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 418

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 419 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 458


>gi|16760783|ref|NP_456400.1| bacteriophage protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|25512494|pir||AE0735 probable bacteriophage protein STY2040 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503080|emb|CAD05583.1| putative bacteriophage protein [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 467

 Score =  109 bits (273), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 122 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 179

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 180 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 239

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 240 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 299

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 300 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 358

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 359 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 418

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 419 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 458


>gi|213161040|ref|ZP_03346750.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
          Length = 421

 Score =  109 bits (273), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 110/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 76  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 133

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 134 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 193

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 194 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 252

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 253 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 312

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 313 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 372

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 373 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 412


>gi|324012808|gb|EGB82027.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           60-1]
          Length = 441

 Score =  109 bits (273), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 96  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 153

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 154 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 213

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 214 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 273

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 274 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 332

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 333 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 392

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 393 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 432


>gi|194434997|ref|ZP_03067239.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|194416779|gb|EDX32906.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|323166781|gb|EFZ52535.1| phage terminase, large subunit, PBSX family [Shigella sonnei 53G]
          Length = 447

 Score =  109 bits (273), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 102 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 159

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 160 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 219

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 220 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 279

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 280 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 338

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 339 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 398

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 399 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 438


>gi|213423381|ref|ZP_03356369.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 414

 Score =  109 bits (273), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 110/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 69  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 126

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 127 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 186

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 187 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 245

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 246 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 305

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 306 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 365

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 366 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 405


>gi|260557981|ref|ZP_05830193.1| phage terminase large subunit [Acinetobacter baumannii ATCC 19606]
 gi|260408491|gb|EEX01797.1| phage terminase large subunit [Acinetobacter baumannii ATCC 19606]
          Length = 529

 Score =  109 bits (272), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 90/239 (37%), Gaps = 31/239 (12%)

Query: 275 LDSDVTRVEVCGQF---PQQDIDSFIPLNIIEEALNREPCPDPYAPLI--------MGCD 323
           L   +    + G F    + D    IP   +E A  R    +    L          G D
Sbjct: 280 LPEPLRSQMLYGDFGAGIEDDPWQVIPTEWVEAAQARWKPLEDMRILHRGDFKMDSYGLD 339

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR---TTNNKISGLVEKYRPDAIIIDANNTG 380
           +A  GGDNT+   R G   ++       D     T+ +     V  + P  I +D    G
Sbjct: 340 VARGGGDNTIGFARYGYWYDNPNVLEGKDSPDGPTSASFAVSHVRDHAP--IHVDVIGVG 397

Query: 381 ARTCDYLEMLGYHVYRVLGQKRAVDLEF-----CRNRRTELHVKMADWLE-----FASLI 430
           A T D+L+  G HV  V  +  A   +        N R++L  +  + L+       +L 
Sbjct: 398 ASTYDFLKQSGIHVVPVDVRNAATAFDRSGQLSFYNLRSQLWWQFREALDPAYGSTVALP 457

Query: 431 NHSGLIQNLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMD 486
               L+ +L + + + +  T ++ +ES+     +  +S DY   ++    + P R  M 
Sbjct: 458 PEPKLLADLTAPR-WGLQGT-KIKVESREEIIKRIGRSPDYGSAIINAQIDTPKRHIMQ 514


>gi|293396491|ref|ZP_06640767.1| phage terminase large subunit [Serratia odorifera DSM 4582]
 gi|291420755|gb|EFE94008.1| phage terminase large subunit [Serratia odorifera DSM 4582]
          Length = 430

 Score =  109 bits (272), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/343 (15%), Positives = 107/343 (31%), Gaps = 57/343 (16%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            + N+EA    +     +   + +  +  +++   NPR  +   +      P  D    +
Sbjct: 80  VLWNEEAHAMTEAQWEVLEPTIRKEGSECWFL--FNPRLTTDFVWRNFVVAPPPDTLVRK 137

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +    I A    D+++      G     D ++ I L+ IE A++  +  
Sbjct: 138 INYDENPFLSRTIMNVIEAAKARDAEMFEHVYLGMPRTDDDEAIIKLSWIEAAVDAHKAL 197

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V   G V     +W   + +L  +  +   +  + R
Sbjct: 198 NIEPAGHRRVGFDVADSGADKCANVYAHGSVALWADEWKAREDELMKSCKRTYNVALE-R 256

Query: 369 PDAIIIDANNTGARTCDYLEMLG-------------YHVYRVLGQKRAVDLE-------- 407
             AII D+   GA +      +                 ++        + E        
Sbjct: 257 EAAIIYDSIGVGASSGSKFAEINEERESASDWNVRTVDYFKFNAGGAVFEPERDYQPGIT 316

Query: 408 ---FCRNRRTELHVKMADWL----------EFASLINHSGLI------------QNLKSL 442
              F  N + +    +AD            E         LI            +   S 
Sbjct: 317 NKDFFANIKAQAWWLVADRFRNTYNVINGKEKRESFADDQLISIDSACPLLDKLKFELST 376

Query: 443 KSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
                   G + +E+K   + +   S + +D  +  FA     
Sbjct: 377 PKRDFDKNGRVKVETKDDLKKRDIPSPNVADAFIMAFAPIETP 419


>gi|323175059|gb|EFZ60673.1| phage terminase large subunit [Escherichia coli LT-68]
          Length = 399

 Score =  109 bits (271), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 54  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 111

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 112 INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 171

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 172 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 231

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 232 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 290

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 291 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 350

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 351 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 390


>gi|289581321|ref|YP_003479787.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
 gi|289530874|gb|ADD05225.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
          Length = 602

 Score =  107 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 77/512 (15%), Positives = 152/512 (29%), Gaps = 113/512 (22%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVF----KGAISAGRGIGKTTLNAWLVLWLMST 104
           +   +W  + +E      +               +  +    G+GK+ + A + +  ++ 
Sbjct: 22  AGDETWLEDAIEDYLGITVTGAQAQICRGIAANERLLVVTANGLGKSYILAAITIVWLTV 81

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           R        + +E ++K T    V                     P  + S      +  
Sbjct: 82  RYPACSFATSGTERKMKRTYCKPVENLHGDARVPL----------PGEYKSRPERIEIDG 131

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA--SGTPDVINLGILGFLTERNANR 222
           + +H+       S +      G H  Y +AII +EA        +   +   +T+     
Sbjct: 132 EPEHFFEAA---SPQDAGELEGVHAAYTLAII-EEADKKDVDAEVLDAMKSLVTDEQDRI 187

Query: 223 FWIMTSNP---------------RRLSGKF-------YEIF------------------- 241
             I  +NP                  + K+       ++                     
Sbjct: 188 --IAIANPPKDETNSIYPILDEQDDPTSKWEVLEFSSFDSHNVQVELGNVDDEKVDGLAS 245

Query: 242 -NKPLDDWKRF-----------------QIDTRTVEGI--------DPSFHEGIIARYGL 275
            +K  DDW+ +                 ++D               +P F   +  R+  
Sbjct: 246 LHKIQDDWEDYNKEPWPGAETARTLSAPKLDADGNPVFSHSDALEDNPEFRTDLDQRWYR 305

Query: 276 DSDVTRVEVCGQFP--QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTV 333
                     G  P      +    ++ +  A  R+  P    P   G D+A +GGD T 
Sbjct: 306 -------RRAGIIPPGGASKNRPFTIDDVNAAWGRDWQPV-GRPQATGIDVARDGGDRTP 357

Query: 334 VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYH 393
           V+   G V+E  ++    D     + ++ ++E    + + IDA   G+   D +      
Sbjct: 358 VISVDGDVLEVRYEEPCHDYTAHADDVTDVLEDDPDNPMPIDAVGEGSGFADIMHQRFPE 417

Query: 394 VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSL------KSFIV 447
             R      A D    ++   E    +  WL+    IN   L + L         +   +
Sbjct: 418 TIRFKSLGVAEDSANYKDCWAEGVALLGKWLQNGGSINDRTLREELLVAARTLEYEETHI 477

Query: 448 PNTGE-----LAIESK---RVKGAKSTDYSDG 471
            + G      L +  K   + +  +S DY D 
Sbjct: 478 GSRGTNGEDVLKLTPKEKVKERLGRSPDYLDA 509


>gi|213426918|ref|ZP_03359668.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 374

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 110/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 29  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 86

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 87  INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 146

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 147 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 205

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 206 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 265

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 266 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 325

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 326 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 365


>gi|332091158|gb|EGI96248.1| phage terminase large subunit [Shigella dysenteriae 155-74]
          Length = 346

 Score =  107 bits (267), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 103/340 (30%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-Q 252
            +  +EA    +     +   + +  +  ++    NP  ++   +  F     +     +
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEGTLIRK 58

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  +  
Sbjct: 59  INYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTL 118

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
             +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      +  
Sbjct: 119 NFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALERE 178

Query: 369 PDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRAVDL 406
            D I+ D+   GA        +              +  R                  + 
Sbjct: 179 AD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 237

Query: 407 EFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIV 447
           +F  N + +    +AD        +          LI                +      
Sbjct: 238 DFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDF 297

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 298 DRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 337


>gi|328952976|ref|YP_004370310.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453300|gb|AEB09129.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
          Length = 466

 Score =  107 bits (266), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 126/382 (32%), Gaps = 58/382 (15%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ +F+          V+ P   +   +  +    GK+T  A L L      PG  +
Sbjct: 27  PDPWQQDFL----------VSRPEQALLLCSRQS----GKSTSAAALALHEALFHPGALI 72

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           + L+ S  Q    L+ + +     LP+         +   +    +  H S  I      
Sbjct: 73  LLLSPSLRQ-SQELFRKAAGLYQRLPHAP------AACRTSALRLEFDHGSRIISLPGQE 125

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
              R +SE R              ++ DEA+  PD +   +   L            S P
Sbjct: 126 ETIRGFSEVR-------------LLVIDEAALVPDELYYAVRPMLAVSRGR--LTALSTP 170

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
               G FY  + +  D W+R+ I       I   F      +  L +   R E   +F  
Sbjct: 171 AGKRGWFYHCYTEGGDQWQRYTIPATQCPRISADFLAA--EQRSLPAAWFRAEYFCEF-G 227

Query: 291 QDIDSFIPLNIIEEALNREPCP--------DPYAPLIMGCDIAEEGGDNTVVVLRRGPVI 342
           +  +   P ++++ A   +  P         P     +G D+ +    + + ++ R P +
Sbjct: 228 EAANQLFPAHLLQTAQCSQVSPLFAEITPSPPTGTFFIGLDLGQSQDYSALTIIHRSPAL 287

Query: 343 E----HLFDWSKTDLRTTNNKISGLVEKY-------RPDAIIIDANNTGARTCDYLEMLG 391
                HL    +  LRT    I   V +            +I+D    GA   D L   G
Sbjct: 288 PDPPCHLRHLQRFPLRTPYPDIVRQVRELLQQPQIGPNPLLIVDKTGVGAPVVDMLTQAG 347

Query: 392 YHVYRVLGQKRAVDLEFCRNRR 413
            + Y V         +  R+ R
Sbjct: 348 MNPYAVTIHGGEAVSQNGRDLR 369


>gi|289829424|ref|ZP_06547036.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 346

 Score =  107 bits (266), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 57/340 (16%), Positives = 110/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 58

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 59  INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 118

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 119 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 177

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 178 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 237

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 238 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 297

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 298 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 337


>gi|211731806|gb|ACJ10127.1| terminase [Bacteriophage APSE-3]
          Length = 469

 Score =  107 bits (266), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 64/349 (18%), Positives = 102/349 (29%), Gaps = 67/349 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ--- 252
             +EA    +     ++  + +  +   W    NP    G  Y+ F KP       Q   
Sbjct: 105 WVEEAETVSEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKAIIDKQGYY 162

Query: 253 ---------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
                    +       +              +    R    G+      D+ I    +E
Sbjct: 163 EDDDLYVGKVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVE 222

Query: 304 EALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A++        P    ++  D A+ G D   +  R G +IE    WS+ D+        
Sbjct: 223 AAIDAHIKLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAF 282

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLG----YHVYRVLGQKRAVD------------ 405
                YR D  I D    GA T       G      V    G   + D            
Sbjct: 283 DEAFDYRADDFIYDNIGLGAGTVKTHLRHGNDGNKMVVTGFGAGDSPDYPDEIYVPGNGE 342

Query: 406 ------------LEFCRNRRTELHVKMAD-------WLEFASLINHSGLI---------- 436
                        +  RN+R +  V +AD        +E    ++   LI          
Sbjct: 343 YLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLS 402

Query: 437 ---QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 403 QLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|161614489|ref|YP_001588454.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363853|gb|ABX67621.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 441

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 56/340 (16%), Positives = 109/340 (32%), Gaps = 52/340 (15%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 96  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 153

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A      +       G     D  + I L+ IE A++  +  
Sbjct: 154 INYDENPFLSDTMLKVIDAARRRYPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 213

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 214 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 272

Query: 369 PDAIIIDANNTGAR-------TCDYLEMLGYHVYRVLGQ---------------KRAVDL 406
              I+ D+   GA          D  +    +  RV  Q                   + 
Sbjct: 273 DADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNK 332

Query: 407 EFCRNRRTELHVKMADWLE-FASLINHSG--LIQNLKSL----------------KSFIV 447
           +F  N + +    +AD      + IN+    L+  L S+                     
Sbjct: 333 DFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDF 392

Query: 448 PNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
              G + +ESK+    +   S + +D  +  FA      D
Sbjct: 393 DRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 432


>gi|148826888|ref|YP_001291641.1| phage terminase large subunit [Haemophilus influenzae PittGG]
 gi|148718130|gb|ABQ99257.1| predicted phage terminase large subunit [Haemophilus influenzae
           PittGG]
          Length = 366

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 56/355 (15%), Positives = 114/355 (32%), Gaps = 37/355 (10%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C              E+ K +S    +   + 
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCC------------REIQKSISDSVIQMLAD- 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   L    ++       +G +   ++      +     +  G        +  +E    
Sbjct: 73  QIEMLGLRAFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGID-----VVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQI--IVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++   +          +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEMLG--YHVYRVLGQKRAVDLE-----------FCRNRRTELHVKMAD 422
           A    + + L     V            E              N + +    + D
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRD 360


>gi|212499721|ref|YP_002308529.1| terminase [Bacteriophage APSE-2]
 gi|238898754|ref|YP_002924436.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
 gi|211731690|gb|ACJ10178.1| terminase [Bacteriophage APSE-2]
 gi|229466514|gb|ACQ68288.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
          Length = 469

 Score =  106 bits (264), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 64/349 (18%), Positives = 103/349 (29%), Gaps = 67/349 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ--- 252
             +EA    +     ++  + +  +   W    NP    G  Y+ F KP       Q   
Sbjct: 105 WVEEAETVSEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKAIIDKQGYY 162

Query: 253 ---------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
                    +       +              +    R    G+      D+ I    +E
Sbjct: 163 EDDDLYVGKVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVE 222

Query: 304 EALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A++        P    ++  D A+ G D   +  R G +IE    WS+ D+        
Sbjct: 223 AAIDAHIKLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAF 282

Query: 362 GLVEKYRPDAIIIDANNTGARTC-DYLEML---GYHVYRVLGQKRAVD------------ 405
                YR D  I D    GA T   +L         V    G   + D            
Sbjct: 283 DEAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGNKIVVTGFGAGDSPDYPDEIYVPGNGE 342

Query: 406 ------------LEFCRNRRTELHVKMAD-------WLEFASLINHSGLI---------- 436
                        +  RN+R +  V +AD        +E    ++   LI          
Sbjct: 343 YLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLS 402

Query: 437 ---QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 403 QLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|294663744|gb|ADF29298.1| terminase [Pseudomonas phage JG024]
          Length = 460

 Score =  106 bits (264), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 63/351 (17%), Positives = 119/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDSCVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D +     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDREQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G VI  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGDDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLA-KL 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVD---------------- 405
           +  ++  D+   GA        L         +Y       AVD                
Sbjct: 291 KGASVTYDSIGVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +E   +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|211731737|gb|ACJ10086.1| terminase [Bacteriophage APSE-5]
          Length = 469

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 64/349 (18%), Positives = 104/349 (29%), Gaps = 67/349 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ--- 252
             +EA    +     ++  + +  +   W    NP    G  Y+ F KP  +    Q   
Sbjct: 105 WVEEAETVSEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKELIDTQGYY 162

Query: 253 ---------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
                    +       +              +    R    G+      D+ I    +E
Sbjct: 163 EDDDLYVGKVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVE 222

Query: 304 EALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A++        P    ++  D A+ G D   +  R G +IE    WS+ D+        
Sbjct: 223 AAIDAHIKLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAF 282

Query: 362 GLVEKYRPDAIIIDANNTGARTC-DYLEML---GYHVYRVLGQKRAVD------------ 405
                YR D  I D    GA T   +L         V    G   + D            
Sbjct: 283 DEAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGNKIVVTGFGAGDSPDYPDEIYVPGNGE 342

Query: 406 ------------LEFCRNRRTELHVKMAD-------WLEFASLINHSGLI---------- 436
                        +  RN+R +  V +AD        +E    ++   LI          
Sbjct: 343 YLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLS 402

Query: 437 ---QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 403 QLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|284008456|emb|CBA74928.1| phage terminase large subunit [Arsenophonus nasoniae]
          Length = 477

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 81/470 (17%), Positives = 137/470 (29%), Gaps = 104/470 (22%)

Query: 84  AGRGIGKTTLNAWLVLW--------LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLL 135
            GRG  KT   A + L          +  R  ++ I     E  +   L AE+   L L 
Sbjct: 21  GGRGGMKTVSFAKIALITASINKRRFLCLREFMNSI-----EDSVHAVLQAEIET-LRLQ 74

Query: 136 PNKHWFEMQSLSLHPAPW-YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                 +     ++ + + Y  +      I SKH   +                      
Sbjct: 75  NRFRILDNCIKGINDSIFKYGQLARNIASIKSKHDFDVA--------------------- 113

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ-- 252
              +EA    +     ++  + +  +   W    NP    G  Y+ F KP  D    +  
Sbjct: 114 -WVEEAETVSEKSLDILIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKDIIDDKGY 170

Query: 253 ----------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
                     +       +              +         G+      D+ I    +
Sbjct: 171 YEDDDLYVGKVSYLDNPWLPEELKNDAEKMKRDNYKKWLHVYGGECDANYDDAIIQPEWV 230

Query: 303 EEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           + A++        P    ++  D A+ G D   +  R G ++E    WS+ D+     K 
Sbjct: 231 DAAIDAHIKLGFKPKGIRVITFDPADSGQDEKALSKRYGVLVEDCVSWSEGDVADATIKA 290

Query: 361 SGLVEKYRPDAIIIDANNTGARTC----------DYLEMLGY------------------ 392
                 YR D  I D    GA T           + + + G+                  
Sbjct: 291 FDEAFDYRADDFIYDNIGLGAGTVKTYLRSSNDGNKMVVTGFGAGDSPDYPDEIYVPGNG 350

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMAD-------WLEFASLINHSGLI--------- 436
                L      + +  RN+R +  V +AD        +E    I+   LI         
Sbjct: 351 EYIPSLNNDDRTNRDTFRNKRAQYWVYLADRFYKTWCAVEKKEYIDPEELISLSSKIDKL 410

Query: 437 ----QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                 L   +    P    + + SK   R KG KS + +D LM +FA  
Sbjct: 411 SQLKSELVKQQRKRTPGNRLIQLISKEEMRSKGIKSPNMADTLMMSFANP 460


>gi|332884414|gb|EGK04674.1| hypothetical protein HMPREF9456_03377 [Dysgonomonas mossii DSM
           22836]
          Length = 450

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 108/302 (35%), Gaps = 33/302 (10%)

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWI--MTS--NPRRLS--GKFYEIFNKPL--DDW 248
            DE S   +     ++  +    A    I  M    NP +     +FY+     +  DD 
Sbjct: 133 IDENSQITEKCWNIVMSRIRHDVAKNGLIPKMFGACNPTKNFVYNRFYKPHRDGILPDDK 192

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC-GQFPQQDIDSFIPLNIIEEALN 307
              Q        +D  + E +         ++R  +  G++ + D D ++ +   +    
Sbjct: 193 AFIQALVTDNPFVDKFYIENLKNL----DPISRARLLDGEW-EYDDDPYVLMQYEKIVDL 247

Query: 308 REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVI--EHLFDWSKTDLRTTNNKISGLVE 365
                    P  M  D+A  G D+T + +  G +   + +    + D  T   +      
Sbjct: 248 FTNSHVSGGPRYMTIDVARLGKDDTTIRIWEGLISIYKKVIPKCRIDDLTVLARKLQTEY 307

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV---DLEFCRNRRTELHVKMAD 422
                  I D +  G    D L   G+    V   K      ++   +N R++ + K+A+
Sbjct: 308 SVPNSNTIADEDGVGGGLVDNLRCKGF----VNNSKPLPIYGEVRNYQNLRSQCYFKLAE 363

Query: 423 -------WLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGL 472
                  +L+   +++   +++ L+ +K        +L + +K   +    KSTD +D L
Sbjct: 364 IVNSNLMYLKNEPIVDRERVVKELEQIKQIDADKDTKLKVITKEMLKSILGKSTDEADNL 423

Query: 473 MY 474
           M 
Sbjct: 424 MM 425


>gi|211731828|gb|ACJ10140.1| terminase [Bacteriophage APSE-6]
          Length = 469

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 82/470 (17%), Positives = 132/470 (28%), Gaps = 104/470 (22%)

Query: 84  AGRGIGKTTLNAWLVLW--------LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLL 135
            GRG  KT   A + L          +  R  ++ I     E  +   L AEV   L L 
Sbjct: 12  GGRGGMKTVSFAKIALITASMHKRRFLCLREFMNSI-----EDSVHAVLQAEVET-LGLQ 65

Query: 136 PNKHWFEMQSLSLHPAPW-YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                       ++ + + Y  +      I SKH   +                      
Sbjct: 66  VRFRVLNSCIEGINDSIFKYGQLARNIASIKSKHDFDVA--------------------- 104

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ-- 252
              +EA    +     ++  + +  +   +  + NP    G  Y+ F KP       Q  
Sbjct: 105 -WVEEAETVSEKSLDTLIPTIRKPGSELRF--SFNPAEEDGAVYKRFVKPYKAIIDKQGY 161

Query: 253 ----------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
                     +       +              +    R    G+      D+ I    +
Sbjct: 162 YEDDDLYVGNVSYLDNPWLPVELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWV 221

Query: 303 EEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
             A++        P    ++  D A  G D   +  R G +IE    W + D+       
Sbjct: 222 GAAIDAHIKLGFKPSGIRVVTFDPAGSGQDEKALSKRYGVLIEDCVSWLEGDVADATMTA 281

Query: 361 SGLVEKYRPDAIIIDANNTGARTC-DYLEMLG---YHVYRVLGQKRAVDLEF-------- 408
                 YR D  I D    GA T   +L         V    G   + D           
Sbjct: 282 FDEAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGSKMVVTGFGAGDSPDYPHEIYVPGNG 341

Query: 409 ----------------CRNRRTELHVKMAD-------WLEFASLINHSGLI--------- 436
                            RN+R +  V +AD        +E    ++   LI         
Sbjct: 342 EYLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPDALISLSSKIAKL 401

Query: 437 ----QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                 L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 402 SQLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|238027628|ref|YP_002911859.1| Bbp25 [Burkholderia glumae BGR1]
 gi|237876822|gb|ACR29155.1| Bbp25 [Burkholderia glumae BGR1]
          Length = 486

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 80/225 (35%), Gaps = 30/225 (13%)

Query: 275 LDSDVTRVEVCGQFP---QQDIDSFIPLNIIEEALNREPCPDPYAPLI----MGCDIAEE 327
           L   +    + G F    + D    IP   +  A  R        P I    +G D+A  
Sbjct: 255 LPEPLRSKMLYGDFAAGREDDPWQVIPSEWVRLAQERWRARSR--PRIPMTALGVDVARG 312

Query: 328 GGDNTVVVLRRGPVIEHLFDWSKT---DLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           G D ++   R G   +           D      ++  L  +     + +D    GA   
Sbjct: 313 GQDQSIYTPRYGNWFDEQVCQPGLATPDGFVVAQQVFNL--REPSTLVNLDVVGVGASPF 370

Query: 385 DYL-EMLGYHVYRVLGQKRAVDLEF-----CRNRRTELHVKMADWL-----EFASLINHS 433
           D + +++G  ++ + G  R  +L+        N R  L  +M + L     E  ++    
Sbjct: 371 DIIHQVIGDKIWGISGAARTDELDMSGQFGFVNLRALLWWRMREALDPINGEDLAIPPDP 430

Query: 434 GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYT 475
            L  +L + + +     G + +ESK   + +  +S D  D  +Y 
Sbjct: 431 ALAADLCAPR-YRKAPRG-ILVESKEEIKKRIGRSPDRGDSAVYA 473


>gi|85059798|ref|YP_455500.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84780318|dbj|BAE75095.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 483

 Score =  104 bits (260), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/309 (15%), Positives = 96/309 (31%), Gaps = 44/309 (14%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQID 254
             +EA          ++  + +  +   W+   NP+ +    Y+ F   PLDD     + 
Sbjct: 116 WVEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVNPLDDICLLTVH 173

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCP 312
                         +      D D+      G+       + I    I  A++       
Sbjct: 174 YTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHMTLGF 233

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI 372
           D      +G D+A+EG D   +   +G V+  L +W + D+  ++N+++    +     I
Sbjct: 234 DAVGEKRLGFDVADEGEDCNALCFVQGSVVLDLDEWHRGDVIASSNRVNRYAIERGITCI 293

Query: 373 IIDANNTGARTCDYLEMLGYHVYRVLGQKRA------------VDLEFCRNRRTELHVKM 420
           I D+   GA    +L+ +     +      A             + +   N + +    +
Sbjct: 294 IYDSIGVGAGVKAHLKRIAAINVKGFNAGEAVKDPDALYMPGKTNKDMFANIKAQAWWAV 353

Query: 421 ADWL--------------EFASLINHSGLI-------------QNLKSLKSFIVPNTGEL 453
            +                + A L     LI             +   S       N G +
Sbjct: 354 RERFYKTWRCIEAKKQDPKAALLYPTDELISLSTTNIKRLEYLKAELSRPRVDYDNNGHV 413

Query: 454 AIESKRVKG 462
            +ESK+   
Sbjct: 414 KVESKKDMK 422


>gi|218148543|ref|YP_002364311.1| terminase, large subunit [Pseudomonas phage 14-1]
 gi|218059739|emb|CAU13815.1| terminase, large subunit [Pseudomonas phage 14-1]
          Length = 460

 Score =  104 bits (260), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 63/351 (17%), Positives = 119/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDSCVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D +     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDREQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G VI  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLA-KM 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVD---------------- 405
           +  ++  D+   GA        L         +Y       AVD                
Sbjct: 291 KGASVTYDSIGVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDIYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +E   +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|218457805|ref|YP_002418810.1| terminase, large subunit [Pseudomonas phage SN]
 gi|218379073|emb|CAT99652.1| terminase, large subunit [Pseudomonas phage SN]
          Length = 460

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 63/351 (17%), Positives = 119/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDSCVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D +     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDREQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G VI  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLA-KV 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVD---------------- 405
           +  ++  D+   GA        L         +Y       AVD                
Sbjct: 291 KGASVTYDSIGVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +E   +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|9633565|ref|NP_050979.1| P18 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118013|gb|AAF03961.1|AF157835_18 P18 [Endosymbiont phage APSE-1]
          Length = 469

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 64/349 (18%), Positives = 103/349 (29%), Gaps = 67/349 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ--- 252
             +EA    +     ++  + +  +   W    NP    G  Y+ F KP  +    Q   
Sbjct: 105 WVEEAETVSEKSLDSLIPTIRKPGSE-LWFSF-NPAEEDGAVYKRFVKPYKELIDTQGYY 162

Query: 253 ---------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
                    +       +              +    R    G+      D+ I    +E
Sbjct: 163 EDDDLYVGKVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVE 222

Query: 304 EALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A++        P    ++  D A+ G D   +  R G +IE    WS+ D+        
Sbjct: 223 AAIDAHIKLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAF 282

Query: 362 GLVEKYRPDAIIIDANNTGARTC-DYLEMLGYHVYRVLGQKRAVDLEFC----------- 409
                YR D  I D    GA T   +L         V+    A D               
Sbjct: 283 DDAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGNKMVVTGFGAGDSPDYPDEIYVPGNGE 342

Query: 410 ----------------RNRRTELHVKMAD-------WLEFASLINHSGLI---------- 436
                           RN+R +  V +AD        +E    ++   LI          
Sbjct: 343 YLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPDALISLSSKIAKLS 402

Query: 437 ---QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 403 QLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|197261331|ref|YP_002154147.1| putative terminase, large subunit [Pseudomonas phage LBL3]
 gi|197244421|emb|CAR31156.1| putative terminase, large subunit [Pseudomonas phage LBL3]
          Length = 460

 Score =  104 bits (259), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 63/351 (17%), Positives = 119/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDSCVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D +     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDREQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G VI  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLA-KM 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVD---------------- 405
           +  ++  D+   GA        L         +Y       AVD                
Sbjct: 291 KGASVTYDSIGVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDIYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +E   +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|149408318|ref|YP_001294421.1| conserved hypothetical protein ORF004 [Pseudomonas phage F8]
 gi|219523873|ref|YP_002455934.1| terminase large subunit [Pseudomonas phage PB1]
 gi|190333469|gb|ACE73724.1| terminase large subunit [Pseudomonas phage PB1]
          Length = 460

 Score =  104 bits (259), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 62/351 (17%), Positives = 117/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDAFVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D D     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDKDQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G VI  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLA-KM 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG---------YHVYRVLGQKRAVD------------- 405
           +  ++  D+   GA        L          Y  +   G     D             
Sbjct: 291 KGASVTYDSIGVGAHVGSKFAELNDSSPDFKLTYDPFNAGGAVDKPDDIYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +    +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVVHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|157265379|ref|YP_001467938.1| terminase large subunit [Thermus phage P23-45]
 gi|156905274|gb|ABU96918.1| terminase large subunit [Thermus phage P23-45]
          Length = 485

 Score =  104 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 69/395 (17%), Positives = 134/395 (33%), Gaps = 47/395 (11%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
           GR  GK+   +   ++ +  RPG     +A +  Q +      V K   L       E+Q
Sbjct: 38  GRQSGKSEAASVEAVFELFARPGSQGWIIAPTYDQAEIIFGRVVEKVERLAEVFPATEVQ 97

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMC-RTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                                +K  +T   R  S +RPD   G        +I DEA+  
Sbjct: 98  LQRRRLRLLVHHYDRPVNAPGAKRVATSEFRGKSADRPDNLRGATLD---FVILDEAAMI 154

Query: 204 PDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-----------------NKPL 245
           P  +    I   L+ R+   + ++ S P+ L+  FYE F                 N+  
Sbjct: 155 PFSVWSEAIEPTLSVRDG--WALIISTPKGLN-WFYEFFLMGWRGGLKEGIPNSGVNQTH 211

Query: 246 DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII--- 302
            D++ F   +  V      ++  +  R  +     R E   +F       F  L+++   
Sbjct: 212 PDFESFHAASWDVWPERREWY--MERRLYIPDLEFRQEYGAEFVSHSNSVFSGLDMLILL 269

Query: 303 -EEALNREPCPDPYAP---LIMGCDIAEEGGDN--TVVVLRRGPVIEHLFDWSKTDLRTT 356
             E        + Y P     +G D  +    +  +V+ L  G ++  L   +       
Sbjct: 270 PYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIV-CLERMNGATWSDQ 328

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             ++  L E Y    ++ D    G    + L+  G +   +  +  +V  +   N     
Sbjct: 329 VARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISN----- 383

Query: 417 HVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPN 449
              +A  +E    ++ N   ++  L++ + +   +
Sbjct: 384 ---LALLMEKGQVAVPNDKTILDELRNFRYYRTAS 415


>gi|211731785|gb|ACJ10115.1| terminase [Bacteriophage APSE-7]
          Length = 469

 Score =  104 bits (258), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 82/470 (17%), Positives = 133/470 (28%), Gaps = 104/470 (22%)

Query: 84  AGRGIGKTTLNAWLVLW--------LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLL 135
            GRG  KT   A + L          +  R  ++ I     E  +   L AEV   L L 
Sbjct: 12  GGRGGMKTVSFAKIALITAAMHKRRFLCLREFMNSI-----EDSVHAVLQAEVET-LGLH 65

Query: 136 PNKHWFEMQSLSLHPAPW-YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                       ++ + + Y  +      I SKH   +                      
Sbjct: 66  ARFRVLNSCIEGINASIFKYGQLARNIASIKSKHDFDVA--------------------- 104

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ-- 252
              +EA    +     ++  + +  +   W    NP    G  Y+ F KP       +  
Sbjct: 105 -WVEEAETVSEKSLDTLISTIRKPGSE-LWFSF-NPSEEDGAVYQRFVKPYKAIIDKKGY 161

Query: 253 ----------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
                     +       +              +    R    G+      D+ I    +
Sbjct: 162 YEDDDLYVGNVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYDDALIQPEWV 221

Query: 303 EEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           + A++        P    ++  D A+ G D   +  R G +IE    WS+ D+       
Sbjct: 222 DAAIDAHIKLGFPPRGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATITA 281

Query: 361 SGLVEKYRPDAIIIDANNTGARTC-DYLEMLGYHVYRVLGQKRAVDLEFC---------- 409
                 YR D  I D    GA T   +L         V+    A D              
Sbjct: 282 FDEAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGNKMVVTGFGAGDSPDYPDEVYVPSNA 341

Query: 410 -----------------RNRRTELHVKMAD-------WLEFASLINHSGLI--------- 436
                            RN+  +  V +AD        +E    ++   LI         
Sbjct: 342 EYLPSSNNDDRTHRDTFRNKHAQYWVYLADRFYKTWRAVEKGEYLDPDELISLSSKIEKL 401

Query: 437 ----QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                 L       +P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 402 SQLKSELVKQPRKRMPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|197261421|ref|YP_002154236.1| putative terminase, large subunit [Pseudomonas phage LMA2]
 gi|197244511|emb|CAR31245.1| putative terminase, large subunit [Pseudomonas phage LMA2]
          Length = 460

 Score =  104 bits (258), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 62/351 (17%), Positives = 119/351 (33%), Gaps = 62/351 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA          I   + + N+   WI   NP  ++   Y+ F  KP  D     
Sbjct: 115 ILWLEEAHYLTQEQWEVIEPTIRKENSE-IWI-IFNPNEVTDFVYQNFVVKPPKDSCVKM 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D +     + G  P+     S I L  I  A++  ++
Sbjct: 173 INWNENPFLSETMLKVIHEAYERDREQAE-HIYGGIPKTGGDKSVINLKFILAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKY 367
              +P     +G D+A++G D     L  G +I  + +W     +L  +++++  L  K 
Sbjct: 232 LGWEPAGSKRIGFDVADDGEDANATTLMHGNIIMEVDEWDGLEDELLKSSSRVYNLA-KM 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVD---------------- 405
           +  ++  D+   GA        L         +Y       AVD                
Sbjct: 291 KGTSVTYDSIGVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKN 350

Query: 406 LEFCRNRRTELHVKMA-------DWLEFASLINHSGLIQ----------------NLKSL 442
            +   N + +   ++A       + +E   +     LI                  L S 
Sbjct: 351 KDHFSNIKAQKWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSP 410

Query: 443 KSFIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAENP--PRSDMDF 487
           +   +   G   +ESK+     +  KS + +D ++ +       P+   DF
Sbjct: 411 RK-DLDMNGRFKVESKKDMREKRKIKSPNIADSVIMSAILPIRKPKGFFDF 460


>gi|157265496|ref|YP_001468054.1| phage terminase large subunit [Thermus phage P74-26]
 gi|156905391|gb|ABU97034.1| phage terminase large subunit [Thermus phage P74-26]
          Length = 485

 Score =  104 bits (258), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 69/395 (17%), Positives = 134/395 (33%), Gaps = 47/395 (11%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
           GR  GK+   +   ++ +  RPG     +A +  Q +      V K   L       E+Q
Sbjct: 38  GRQSGKSEAASVEAVFELFARPGSQGWIIAPTYDQAEIIFGRVVEKVERLAEVFPATEVQ 97

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMC-RTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                                +K  +T   R  S +RPD   G        +I DEA+  
Sbjct: 98  LQRRRLRLLVHHYDRPVNAPGAKRVATSEFRGKSADRPDNLRGATLD---FVILDEAAMI 154

Query: 204 PDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIF-----------------NKPL 245
           P  +    I   L+ R+   + ++ S P+ L+  FYE F                 N+  
Sbjct: 155 PFSVWSEAIEPTLSVRDG--WALIISTPKGLN-WFYEFFLMGWRGGLKEGIPNSGINQTH 211

Query: 246 DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII--- 302
            D++ F   +  V      ++  +  R  +     R E   +F       F  L+++   
Sbjct: 212 PDFESFHAASWDVWPERREWY--MERRLYIPDLEFRQEYGAEFVSHSNSVFSGLDMLILL 269

Query: 303 -EEALNREPCPDPYAP---LIMGCDIAEEGGDN--TVVVLRRGPVIEHLFDWSKTDLRTT 356
             E        + Y P     +G D  +    +  +V+ L  G ++  L   +       
Sbjct: 270 PYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIV-CLERMNGATWSDQ 328

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             ++  L E Y    ++ D    G    + L+  G +   +  +  +V  +   N     
Sbjct: 329 VARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISN----- 383

Query: 417 HVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPN 449
              +A  +E    ++ N   ++  L++ + +   +
Sbjct: 384 ---LALLMEKGQVAVPNDKTILDELRNFRYYRTAS 415


>gi|159904490|ref|YP_001548152.1| hypothetical protein MmarC6_0096 [Methanococcus maripaludis C6]
 gi|159885983|gb|ABX00920.1| protein of unknown function DUF264 [Methanococcus maripaludis C6]
          Length = 505

 Score =  102 bits (255), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 76/437 (17%), Positives = 138/437 (31%), Gaps = 72/437 (16%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E  E +D+   +             I+ GR  GKT +   +     S   G SV+ +A
Sbjct: 65  QEEIAEAIDSEMYDV----------ITINIGRRGGKTEVMGGVGPKFCSKYRGFSVLVVA 114

Query: 115 NSETQLKTTLWAEVSKWL-SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
               Q KT ++ ++ + L S   ++   + +      +P+     +    I+ K      
Sbjct: 115 PVYNQAKT-MYKKIKRGLESNKESRQLVKPKKEGFKESPFPLITFYNGSTIEFK------ 167

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG-ILGFLTERNANRFWIMTSNPRR 232
              S E PD      +     II DEA+   D I    +   L +       +  S P  
Sbjct: 168 ---SAETPDNLR---SEGYDLIIVDEAAFVDDEIISAVLEPMLMDSGG--ILVKISTPWG 219

Query: 233 LSGKFYEIFNK----------------PLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLD 276
               FY+ + K                    +K F+  +     +   F  G     G D
Sbjct: 220 TGNHFYDSYIKGELQAKMLEEGEGIPEDELRYKSFKFPSWVNPYLSKRFLMGKKKDLGED 279

Query: 277 SDVTRVEVCGQFPQQD-------------IDSFIPLNIIEEALNREPCPDPYAPLIMGCD 323
           + V   E C +F + D              D+F      E  +      +     ++G D
Sbjct: 280 NPVWLQEYCAEFIEDDTTVFSTAHVQACLSDAFETHYKTENLIYLIDEGERNKEYVIGLD 339

Query: 324 IAEEGGDNTVVVLRRGPV----IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +A+       +VL         + +   ++  D      K   L E +      +D    
Sbjct: 340 LAKHNDYTVFIVLDITTGPPYTLVYFERFNGIDYTDIAEKHLALSEAFNDAPACVDQTGI 399

Query: 380 GARTCDYLEMLGY-HVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASLINHSGLI 436
           G    D  + +G  ++        +          TE+  K++     +   +     L+
Sbjct: 400 GEAYMDIAKKVGLDNLTGFKFTNESK---------TEIITKLSTSFRNKEVVMPKIRVLL 450

Query: 437 QNLKSLKSFIVPNTGEL 453
             LK+   F    T +L
Sbjct: 451 TELKAFMRFRTKTTFKL 467


>gi|150021340|ref|YP_001306694.1| hypothetical protein Tmel_1462 [Thermosipho melanesiensis BI429]
 gi|149793861|gb|ABR31309.1| protein of unknown function DUF264 [Thermosipho melanesiensis
           BI429]
          Length = 421

 Score =  101 bits (251), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 105/316 (33%), Gaps = 34/316 (10%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I AGR  GKT   A  + +  +  P   VI    S  Q                   +  
Sbjct: 39  ICAGRRFGKTNYVAGKIFYYATIHPKSRVIVGGPSLDQ---------------AKIYYDL 83

Query: 142 EMQSLSLHPAPWYSDVLHCS--LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
             +++ L P   +      S    I  K+ S++    +        G        ++  E
Sbjct: 84  LTEAIELSPLKGFVKKTKDSPFPTIYLKNGSSITVRSTAHNGKYLRGRKVN---LVVLTE 140

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR---FQIDTR 256
           A+   D +   ++  + + +     I+ S P  ++  FYE + + L + K    F     
Sbjct: 141 AAFIKDSVYEQVITPM-KLDTGAPVILESTPNGMN-YFYEEYQRGLKNKKHTISFHATVY 198

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPCPDP 314
               +D    E   A+      V R E   +F   D   F P  I+ EA    +      
Sbjct: 199 DNPFLDQEEIENAKAK--TPDYVWRQEYLAEFVD-DDTVFFPWKILVEAFEDYKPEGYKD 255

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD---LRTTNNKISGLVEKYRPDA 371
                +G D+A+      ++VL        + ++ + +          ++ L  KYR   
Sbjct: 256 GRKYSIGVDLAKYRDYTVIIVLDVTEEPFKIAEFHRFNQIPYEEVIRIVNDLQAKYRA-Q 314

Query: 372 IIIDANNTGARTCDYL 387
           + +DA   G    + +
Sbjct: 315 VYLDATGVGDPISERI 330


>gi|118590957|ref|ZP_01548357.1| hypothetical protein SIAM614_19891 [Stappia aggregata IAM 12614]
 gi|118436479|gb|EAV43120.1| hypothetical protein SIAM614_19891 [Stappia aggregata IAM 12614]
          Length = 526

 Score =  101 bits (251), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/203 (21%), Positives = 80/203 (39%), Gaps = 18/203 (8%)

Query: 290 QQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
           Q      IP + ++ A  R  +         ++  D+A+ G D TV+    G   E    
Sbjct: 294 QDHEWQVIPSDWVDLAFERYDQGIDRDEPMTVLAVDVAQGGKDRTVLQPLHGRRFETNIV 353

Query: 348 WSKTDLRTTNNKISGLVEKYRPDA-IIID-ANNTGARTCDYLEMLGYH-----VYRVLGQ 400
              TD +   +  S ++ + R +A I++D     G  T  +L+          V+     
Sbjct: 354 RKGTDTKDGADVGSLIIRERRDNAMIVVDCTGGWGGDTVGFLKRENNIPAEKCVFSAQSG 413

Query: 401 KRAVDLE-FCRNRRTELHVKMADWLE----FASLINHSGLIQNLKSLKSFIVPNTGELAI 455
           +RA D      N R EL+ ++ + L         I  S  ++   +   + + N G++ I
Sbjct: 414 ERAKDSRIPFYNLRAELYWRLREALHPKSGLGLAIRRSATVKAQLTAHRWKMRN-GKILI 472

Query: 456 ESK---RVKGAKSTDYSDGLMYT 475
           ESK   + +   S D +D ++  
Sbjct: 473 ESKEEIKDRLGSSPDEADAIVEA 495


>gi|126011061|ref|YP_001039811.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
 gi|119712637|gb|ABL96858.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
          Length = 459

 Score =  101 bits (251), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 55/339 (16%), Positives = 107/339 (31%), Gaps = 57/339 (16%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQ 252
            +  +EA    +     I   +    +  + I   NP + +   Y+ F   P  D    Q
Sbjct: 115 ILWLEEAQYLTEEQWNVINPTIRREGSQIWLIW--NPDQYTDFIYQNFVVNPPADCLSKQ 172

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ-QDIDSFIPLNIIEEALN--RE 309
           I+      +  +  + I   Y  D  +    V G  P+     + I L  +  A++  ++
Sbjct: 173 INWTENPFLSDTMLKVIYDEYQRDPKLAE-HVYGGAPKMGGDKAIIQLQYVLAAIDAHKK 231

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNN--KISGLVEKY 367
                      G DIA++G D   +V   G V+    +W   +     +  K+     + 
Sbjct: 232 LGWKIEGSKRTGFDIADDGDDANAIVDAIGNVVVWAEEWDGLEDELLKSSTKVFNHALE- 290

Query: 368 RPDAIIIDANNTGARTCDYLEMLGY-----HVYRVLGQKRA----------------VDL 406
           +  +II D+   GA        L        +Y       A                 + 
Sbjct: 291 KGSSIIFDSIGVGAHAGSKFSELNEARSLEIIYEPFNAGGAVYDPDGTYMKLPHVVITNR 350

Query: 407 EFCRNRRTELHVKMADWLE-------FASLINHSGLI---------------QNLKSLKS 444
           E   N + ++  ++A           + +   H  LI               +   +   
Sbjct: 351 EHFSNVKAQMWDRVATRFRKTYEVVTYGANHPHDELISISSEHVPAKILDKLKIELASPH 410

Query: 445 FIVPNTGELAIESKR----VKGAKSTDYSDGLMYTFAEN 479
             V   G+  +ESK+     +G KS + +D  +    + 
Sbjct: 411 KDVDGMGKFKVESKKDMREKRGIKSPNIADAFIMAMIQP 449


>gi|211731761|gb|ACJ10100.1| terminase [Bacteriophage APSE-4]
          Length = 469

 Score =  100 bits (250), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 101/349 (28%), Gaps = 67/349 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ--- 252
             +EA    +     ++  + +  +   W    NP    G  Y  F KP       Q   
Sbjct: 105 WVEEAETVSEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYRRFVKPYKAIIDKQGYY 162

Query: 253 ---------IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
                    +       +              +    R    G+      D+ I    ++
Sbjct: 163 EDDEVYVGKVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYGDALIQPEWVD 222

Query: 304 EALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A++        P    ++  D A+ G D   +  R G +IE    WS+ D+        
Sbjct: 223 AAIDAHIKLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATITAF 282

Query: 362 GLVEKYRPDAIIIDANNTGARTC-DYLEMLGYHVYRVLGQKRAVDLEFC----------- 409
                YR D  I D    GA T   +L         V+    A D               
Sbjct: 283 DDAFDYRADDFIYDNIGLGAGTVKTHLRHSNDGTKMVVTGFGAGDSPDYPDEIYVPGNGE 342

Query: 410 ----------------RNRRTELHVKMAD-------WLEFASLINHSGLI---------- 436
                           RN+R +  V +AD        +E    ++   LI          
Sbjct: 343 YLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYKTWRAVERGEYLDPDALISLSSKIAKLS 402

Query: 437 ---QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L   +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 403 QLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|256422889|ref|YP_003123542.1| hypothetical protein Cpin_3879 [Chitinophaga pinensis DSM 2588]
 gi|256037797|gb|ACU61341.1| hypothetical protein Cpin_3879 [Chitinophaga pinensis DSM 2588]
          Length = 471

 Score =  100 bits (248), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 52/286 (18%), Positives = 107/286 (37%), Gaps = 38/286 (13%)

Query: 229 NPRRLSGKFYEIFNKPL------DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
           NP++     + +F KP       D  K  Q   +    IDP + + +++   +   V + 
Sbjct: 196 NPKKN--WCHTVFWKPFKAGQLPDKVKFLQALVQDNPFIDPGYIDNLMS---ITDKVKKQ 250

Query: 283 EVC-GQFP-QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGP 340
            +  G F    D ++ +  + I +    E   +      +  DIA  G D +VV++  G 
Sbjct: 251 RLLYGNFDYDDDDNALMEYDSINDIFTNEFVVE--GKKYITADIARFGSDKSVVMVWNGL 308

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
            +  +  + K       ++I  +  KY      +++D +  G    D L+      +  +
Sbjct: 309 RVVEIRKFEKMRTTKVADEIEKIRNKYGIPLSHVVVDEDGVGGGVVDKLDG----CHGFV 364

Query: 399 GQKRAVDLEF------CRNRRTELHVKMADWL---EFASLINHSG----LIQNLKSLKSF 445
                +D          +N +++ +  +A+ +   +     +       L + L+ +K +
Sbjct: 365 NNSAPIDNPQDQQQQNYKNLKSQCYYMLAERINDHKIFVRCDDYEMRELLSEELEQVKKW 424

Query: 446 IVPNTGELAIESK---RVKGAKSTDYSDGLMY-TFAENPPRSDMDF 487
              N  +L +  K   +    +S DYSD LM   F E  P      
Sbjct: 425 DADNDKKLEVMPKKVVKELLGRSPDYSDTLMMRMFFELKPEQRWQI 470


>gi|313760829|gb|ADR79391.1| terminase [APSE phage Eptesicus fuscus/P5/IT/USA/2009]
          Length = 394

 Score =  100 bits (248), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 66/342 (19%), Positives = 102/342 (29%), Gaps = 67/342 (19%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
             +EA    +     ++  + +  +   W    NP    G  Y  F KP       Q   
Sbjct: 44  WVEEAETVSEKSLDTLIPTIRKPGSE-LWFSF-NPAEEDGAVYRRFVKPYKAIIDKQGYY 101

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD-----IDSFIPLNIIEEALNREP 310
              E               LD+     E+     + +      D+ I    +E A +   
Sbjct: 102 EDDEVYVGKVS-------YLDNPWLPAELKNDAQKGECDANYEDALIQPEWVEAATDAHI 154

Query: 311 C--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR 368
                P    ++  D A+ G D   +  R G +IE    WS+ D+             YR
Sbjct: 155 KLGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAFDEAFDYR 214

Query: 369 PDAIIIDANNTGARTC-DYLEML---GYHVYRVLGQKRAVDLEF---------------- 408
            D  I D    GA T   +L         V    G   + D                   
Sbjct: 215 ADDFIYDNIGLGAGTVKTHLRHSNDGNKMVVTGFGAGDSPDYPHEIYVPGNGEYLPSSNN 274

Query: 409 --------CRNRRTELHVKMAD-------WLEFASLINHSGLI-------------QNLK 440
                    RN+R +  V +AD        +E    ++   LI               L 
Sbjct: 275 DDRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLSQLKSELI 334

Query: 441 SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
             +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 335 KQQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 376


>gi|161525001|ref|YP_001580013.1| hypothetical protein Bmul_1828 [Burkholderia multivorans ATCC
           17616]
 gi|189350256|ref|YP_001945884.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
 gi|160342430|gb|ABX15516.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334278|dbj|BAG43348.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
          Length = 531

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/332 (16%), Positives = 104/332 (31%), Gaps = 55/332 (16%)

Query: 190 TYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
                 I DE++      +    L   T    +      S P  +   F +   +     
Sbjct: 195 DRASFYIVDESAFLERPQLVDASLSATTNCRQD-----ISTPNGMGNSFAQ--RRHSGKV 247

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN- 307
           K F    R     D +++    A   LD  V   E+   +        IP   ++ A+  
Sbjct: 248 KVFTFHWRDDPRKDDAWYAKQCAE--LDPVVVAQEIDINYAASVEGVVIPSAWVQAAIGA 305

Query: 308 -REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLV 364
             +   +P      G D+A+EG D      R G ++  L  WS    D+  T  K  G+ 
Sbjct: 306 HLKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLNFLRSWSGKGGDIYETVEKTFGIC 365

Query: 365 EKYRPDAIIIDANNTGARTCDYLE----------MLGYHVYRVLGQKRAVDLE------- 407
           ++   ++   DA+  GA                     +     G     D E       
Sbjct: 366 DELGYESFDYDADGLGAGVRGDARVINEQRIAIGKRPINDEPFRGSGPVHDPEGEMVPER 425

Query: 408 ----FCRNRRTELHVKMADWLEFA-------------SLINHSGLIQNLKSL------KS 444
               +  N + +    +    +                +I+    ++ L +L       +
Sbjct: 426 KNKDYFANLKAQSWWALRLRFQATYRAVVEGKPYNPDDIISIDPELKELAALTMELSQPT 485

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
           + V   G++ I+ K   G KS + +D +M  +
Sbjct: 486 YTVNGVGKIVID-KAPDGTKSPNLADAVMIAY 516


>gi|255321082|ref|ZP_05362250.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262379515|ref|ZP_06072671.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
 gi|255301852|gb|EET81101.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262298972|gb|EEY86885.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
          Length = 558

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/344 (15%), Positives = 106/344 (30%), Gaps = 61/344 (17%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
               DE +         +   +++       I  S P  +  KF++  ++    +  F +
Sbjct: 210 MYFLDEWAFVERQ--EAVDAAISQ--NTNVHIKGSTPNGIGDKFHQ--DRFSGRYAVFTM 263

Query: 254 DTRTVEGIDP--SFHEGIIARYGL------DSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
             R     +        +I  +        D  V   EV   +        IP   ++ A
Sbjct: 264 AWRDNPDKNWQVELDGKLIYPWYEKQLATLDDIVLAQEVDIDYAASVEGVLIPSAWVQAA 323

Query: 306 LNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKIS 361
           ++       +P        D+A+EG D      R G V+++L  WS    D+  T  K  
Sbjct: 324 VDAHIKLGIEPSGERNGALDVADEGKDKNSFAARHGIVLQYLDTWSGIGDDIFGTTQKAI 383

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDLE---- 407
                 + +    DA+  GA       ++                  G     + E    
Sbjct: 384 DACLDLKLNIFFYDADGLGAGVRGDARVINELNKAKGIPEIEANPFRGSGAVHNPEQEMV 443

Query: 408 -------FCRNRRTELHVKMA-------DWLEFASLINHS--------------GLIQNL 439
                  F  N + ++   +          L+       S                ++  
Sbjct: 444 EARKNVDFFANLKAQMWWSLRLRFQNTYRALQGMQYDPDSLISLSTKDINKQELEQLKRE 503

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRS 483
            S  ++     G++ + +K+  GA S + +DG+M  F++  P +
Sbjct: 504 LSQPTYSKNGAGKILV-NKQPDGALSPNRADGVMICFSDIRPPA 546


>gi|308097723|gb|ADO14402.1| AB1gp31 [Acinetobacter phage AB1]
          Length = 313

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 48/292 (16%), Positives = 89/292 (30%), Gaps = 52/292 (17%)

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--RE 309
            I+      +  +  + I  +   D +       G     D  S I  + +E AL+  + 
Sbjct: 21  HINYNENPFLSQTALDVIADKKRRDPEGFAHIYDGMPRADDDMSIIKASWVEAALDAHKL 80

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKY 367
              D      +G D+A+ G D   +V R+G V     +W   + +L  +  +      + 
Sbjct: 81  LNLDDTGRSYLGFDVADAGKDKCALVHRKGIVAYWSDEWKAREDELLKSATRTYNEAIRL 140

Query: 368 RPDAIIIDANNTGARTCDYLEML-----------------GYHVYRVLGQKRAVDLEFCR 410
               I  D+   GA     +  L                 G H      Q +  + +F  
Sbjct: 141 -NALIHYDSTGVGAGVGAKVNELNKEKKTNVQHSKFVAGGGVHEPDKFYQPKITNKDFFA 199

Query: 411 NRRTELHVKMADWLEF-----------ASLINH--SGLI------------QNLKSLKSF 445
           N + +    +AD                 +  H    LI            +   S+   
Sbjct: 200 NAKAQAWWLVADKFRLTYQVIQAIKNGTEIPKHKPEDLISISSDMPNLHRLKVELSIPHR 259

Query: 446 IVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
                G + +ESK+    +  KS + +D  +  +A  P +  M         
Sbjct: 260 DEDRLGRVMVESKQDLAKRDVKSPNLADAFIMAYA--PVKRSMQINIADVES 309


>gi|169633984|ref|YP_001707720.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii SDF]
 gi|169152776|emb|CAP01795.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii]
          Length = 552

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 58/337 (17%), Positives = 107/337 (31%), Gaps = 61/337 (18%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
               DE +         +   +++       I  S P  +  +F++  ++    +  F +
Sbjct: 210 MYFLDEWAFVEQQ--EAVDAAISQ--NTNVHIKGSTPNGIGDRFHQ--DRFSGRYAVFTM 263

Query: 254 DTRTVEGIDPSFHE--GIIARYGL------DSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
             R     + +      +I  +        D  V   EV   +        IP   ++ A
Sbjct: 264 PWRDNPDKNWTVTYNGKVIYPWYEKQLATLDDVVLAQEVDINYAASVEGVLIPSTWVQAA 323

Query: 306 LN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKIS 361
           ++  ++   +P    I G D+A+EG D      R G V+ +L  WS    D+  T  K  
Sbjct: 324 IDAHKKLQIEPTGDRIGGLDVADEGKDKNSFAARHGVVMTYLATWSGKGDDIFGTTQKAM 383

Query: 362 GLVEKYRPDAIIIDANNTGAR-------TCDYLEMLG---YHVYRVLGQKRAVDLE---- 407
            L  +   D +  DA+  GA          +    LG    +V    G     D E    
Sbjct: 384 DLCFEKSIDTLFYDADGLGAGCRGDARVINEKRRELGLSEINVESFRGSGSVHDPEGEMV 443

Query: 408 -------FCRNRRTELHVKMA-------DWLEFASLINHS--------------GLIQNL 439
                  F  N + +    +          LE                       L+   
Sbjct: 444 EKRLNKDFFANLKAQSWWSLRLRFQETFRALEGRDYDPDMIISLSSEDIDAKELALLTTE 503

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
            S  ++     G++ + +K+  G  S + +D +M  F
Sbjct: 504 LSQPTYTKNGVGKILV-NKQPDGTASPNRADSVMICF 539


>gi|298480040|ref|ZP_06998239.1| PBSX family phage terminase [Bacteroides sp. D22]
 gi|298273849|gb|EFI15411.1| PBSX family phage terminase [Bacteroides sp. D22]
          Length = 476

 Score = 96.7 bits (239), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 55/281 (19%), Positives = 105/281 (37%), Gaps = 33/281 (11%)

Query: 216 TERNANRFWIMTSNPRRLSGKFYEIFNKP-----LDDWKRFQID-TRTVEGIDPSFHEGI 269
            E    R   +T NP++     Y+ F KP     L ++  +     +    IDP + EG+
Sbjct: 184 NELGLRRKLFITCNPKKN--WMYDTFYKPDKKGELPEYMYYLACLVQENPFIDPDYIEGL 241

Query: 270 IARYGLDSDVTRVEVC-GQFP-QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
                    V R  +  G +    + ++    + I E    +         I G DIA  
Sbjct: 242 KTTK---DKVKRERLLKGNWEYDDNPNALCSHDAICEIFGNKISIKTGTNYITG-DIARF 297

Query: 328 GGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAIIIDANNTGARTCD 385
           G D   + +  G  I  L  +  +        I    +KYR      I+D +  G    D
Sbjct: 298 GADYARLAVWDGWHIIELQCFPVSKTTDIQTWIINKQKKYRIPNHKCIVDEDGVGGGVVD 357

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL---------EFASLINHSGLI 436
             ++ G+     +      + E  +N +T+   K+AD +         +  S  +   +I
Sbjct: 358 NCDIQGF-----VNNSTPFNGENYQNLQTQCGYKLADHINATEVGIDEDLISTADKEEII 412

Query: 437 QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
           + L+ L+++   + G+L ++ K   ++    S D+ D  + 
Sbjct: 413 RELEQLQTWKADSDGKLKLKPKEEIKMDIGCSPDWRDMFLM 453


>gi|167763812|ref|ZP_02435939.1| hypothetical protein BACSTE_02192 [Bacteroides stercoris ATCC
           43183]
 gi|167697928|gb|EDS14507.1| hypothetical protein BACSTE_02192 [Bacteroides stercoris ATCC
           43183]
          Length = 476

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 55/281 (19%), Positives = 105/281 (37%), Gaps = 33/281 (11%)

Query: 216 TERNANRFWIMTSNPRRLSGKFYEIFNKP-----LDDWKRFQID-TRTVEGIDPSFHEGI 269
            E    R   +T NP++     Y+ F KP     L ++  +     +    IDP + EG+
Sbjct: 184 NELGLRRKLFITCNPKKN--WMYDTFYKPDKKGELPEYMYYLACLVQENPFIDPDYIEGL 241

Query: 270 IARYGLDSDVTRVEVC-GQFP-QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
                    V R  +  G +    + ++    + I E    +         I G DIA  
Sbjct: 242 KTTK---DKVKRERLLKGNWEYDDNPNALCSHDAICEIFGNKISIKTGTNYITG-DIARF 297

Query: 328 GGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAIIIDANNTGARTCD 385
           G D   + +  G  I  L  +  +        I    +KYR      I+D +  G    D
Sbjct: 298 GADYARLAVWDGWHIIELQCFPVSKTTDIQTWIINKQKKYRIPNHKCIVDEDGVGGGVVD 357

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL---------EFASLINHSGLI 436
             ++ G+     +      + E  +N +T+   K+AD +         +  S  +   +I
Sbjct: 358 NCDIQGF-----VNNSTPFNGENYQNLQTQCGYKLADHINATEVGIDEDLISTADKEEII 412

Query: 437 QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
           + L+ L+++   + G+L ++ K   ++    S D+ D  + 
Sbjct: 413 RELEQLQTWEADSDGKLKLKPKEEIKMDIGCSPDWRDMFLM 453


>gi|168260952|ref|ZP_02682925.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|205349913|gb|EDZ36544.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
          Length = 471

 Score = 95.6 bits (236), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 65/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  +  +  +  W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTI-RKTFSEIWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGART--------------------------CDYLEMLGYHVYR 396
           L  +   D  + D +  GA                             D L   G     
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEVFSGKKITATMFKGSESPFDEDALYQAGAWADE 343

Query: 397 -VLGQKRAVDLEFCRNRRTELHVKMADWLEFA---------SLINH-------------- 432
            V G       +  RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|163716617|gb|ABY40529.1| putative TerL [Burkholderia phage Bups phi1]
          Length = 531

 Score = 95.2 bits (235), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 63/343 (18%), Positives = 106/343 (30%), Gaps = 57/343 (16%)

Query: 190 TYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
                 + DE++      +    L   T    +      S P  +   F +   +     
Sbjct: 195 DRASFYVVDESAFLERPQLVDASLSATTNCRQD-----ISTPNGMGNSFAQ--RRHSGKI 247

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K F    R     D +++   +A   LD  V   E+   +        IP   ++ AL  
Sbjct: 248 KVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAWVQAALGA 305

Query: 309 EPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLV 364
                 +P      G D+A+EG D      R G ++EHL  WS    D+  T +++ G+ 
Sbjct: 306 HVKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTVDRVLGIC 365

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDLE------- 407
           +    +    DA+  GA       +L                  G     D E       
Sbjct: 366 DVRDYEVFDYDADGLGAGVRGDARVLNEQRVAAGKRSIRNEPFRGSGPVYDPEGEMVKER 425

Query: 408 ----FCRNRRTELHVKMADWL----------------EFASLINHSGLIQNLK---SLKS 444
               +  N + +    +                    E  S+         L    S  +
Sbjct: 426 KNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALSMELSQPT 485

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
           F V   G++ I+ K   G KS + +D +M   A  P    +D 
Sbjct: 486 FTVNGVGKIVID-KAPDGTKSPNLADAVMI--AYQPAVRGIDI 525


>gi|260868683|ref|YP_003235085.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|293446697|ref|ZP_06663119.1| phage terminase large subunit [Escherichia coli B088]
 gi|257765039|dbj|BAI36534.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|291323527|gb|EFE62955.1| phage terminase large subunit [Escherichia coli B088]
 gi|323177130|gb|EFZ62720.1| phage terminase, large subunit, PBSX family [Escherichia coli 1180]
          Length = 471

 Score = 94.8 bits (234), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|237704849|ref|ZP_04535330.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|226901215|gb|EEH87474.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|315288241|gb|EFU47640.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           110-3]
          Length = 471

 Score = 94.8 bits (234), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|324019922|gb|EGB89141.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           117-3]
          Length = 471

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKCIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|294492319|gb|ADE91075.1| phage terminase, large subunit, PBSX family [Escherichia coli
           IHE3034]
          Length = 471

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 64/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  N               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPNDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|307544683|ref|YP_003897162.1| hypothetical protein HELO_2093 [Halomonas elongata DSM 2581]
 gi|307216707|emb|CBV41977.1| K06909 [Halomonas elongata DSM 2581]
          Length = 531

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 51/338 (15%), Positives = 109/338 (32%), Gaps = 57/338 (16%)

Query: 194 AIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
             I DE++      +    L   T    +      S P  +   F +   +       F 
Sbjct: 199 FYIVDESAFLERPHLVDASLSATTNCRQD-----VSTPNGMGNPFAQ--RRHSGKISVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
              R     D +++   +    LD      E+   +        IP   ++ A++  ++ 
Sbjct: 252 FHWRDDPRKDDAWYAKQVDE--LDPVTVAQEIDINYSASVEGVLIPSAWVQAAVDAHKKL 309

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
             +     +   D+A+EG D      R G +++ + +W+   +D+  T  K     +++ 
Sbjct: 310 GIEITGERLGALDVADEGKDQNAYAGRHGILLDLVDEWTGKGSDIFGTVQKAFDHTDEHG 369

Query: 369 PDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQK-----------RAVDLE 407
                 DA+  G+       ++             V    G             +  + +
Sbjct: 370 GSRFDYDADGLGSGVRGDARVINEQRAEQKRPKLKVNPFRGSGGVIEPDKEMVPKRKNKD 429

Query: 408 FCRNRRTELHVKM--------ADWLEFASLINHS------------GLIQNLKSLKSFIV 447
           F  N + +    +           +E                     L+  L S  ++ V
Sbjct: 430 FFANLKAQAWWALRLRFQRTYRAVVEGMEFDPDDIISIDSRLPILSKLMLEL-SQPTYHV 488

Query: 448 PNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDM 485
             TG++ ++ K  +G KS + +D +M  +A N   +D 
Sbjct: 489 NGTGKVVVD-KAPEGTKSPNLADAVMILYAPNKSVTDR 525


>gi|157159763|ref|YP_001457081.1| PBSX family phage terminase large subunit [Escherichia coli HS]
 gi|300935792|ref|ZP_07150755.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
 gi|157065443|gb|ABV04698.1| phage terminase, large subunit, pbsx family [Escherichia coli HS]
 gi|300459025|gb|EFK22518.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
          Length = 471

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINDGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|91211665|ref|YP_541651.1| terminase large subunit [Escherichia coli UTI89]
 gi|117624554|ref|YP_853467.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|218559279|ref|YP_002392192.1| Terminase large subunit [Escherichia coli S88]
 gi|91073239|gb|ABE08120.1| terminase large subunit [Escherichia coli UTI89]
 gi|115513678|gb|ABJ01753.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|148566126|gb|ABQ88401.1| phage terminase large subunit [Enterobacteria phage CUS-3]
 gi|218366048|emb|CAR03793.1| Terminase large subunit [Escherichia coli S88]
 gi|307626097|gb|ADN70401.1| terminase large subunit [Escherichia coli UM146]
 gi|323948780|gb|EGB44679.1| phage terminase large subunit [Escherichia coli H252]
          Length = 471

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 137/480 (28%), Gaps = 79/480 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             L   L  ++     N G+L     +E K+  G  S + +D LM         +  D+ 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYS 462


>gi|167725769|ref|ZP_02409005.1| hypothetical protein BpseD_42528 [Burkholderia pseudomallei DM98]
          Length = 517

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 63/343 (18%), Positives = 105/343 (30%), Gaps = 57/343 (16%)

Query: 190 TYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
                 + DE++      +    L   T    +      S P  +   F +   +     
Sbjct: 181 DRASFYVVDESAFLERPQLVDASLSATTNCRQD-----ISTPNGMGNSFAQ--RRHSGKI 233

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K F    R     D +++   +A   LD  V   E+   +        IP   ++ AL  
Sbjct: 234 KVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAWVQAALGA 291

Query: 309 EPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLV 364
                 +P      G D+A+EG D      R G ++EHL  WS    D+  T ++  G+ 
Sbjct: 292 HVKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTVDRALGIC 351

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDLE------- 407
           +    +    DA+  GA       +L                  G     D E       
Sbjct: 352 DVRDYEVFDYDADGLGAGVRGDARVLNEQRVAAGKRSIRNEPFRGSGPVYDPEGEMVKER 411

Query: 408 ----FCRNRRTELHVKMADWL----------------EFASLINHSGLIQNLK---SLKS 444
               +  N + +    +                    E  S+         L    S  +
Sbjct: 412 KNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALSMELSQPT 471

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
           F V   G++ I+ K   G KS + +D +M   A  P    +D 
Sbjct: 472 FTVNGVGKIVID-KAPDGTKSPNLADAVMI--AYQPAVRGIDI 511


>gi|41057280|ref|NP_958178.1| gene 2 protein [Enterobacteria phage Sf6]
 gi|191165541|ref|ZP_03027382.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218695968|ref|YP_002403635.1| Terminase large subunit [Escherichia coli 55989]
 gi|331678314|ref|ZP_08378989.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
 gi|33334159|gb|AAQ12192.1| gene 2 protein [Shigella phage Sf6]
 gi|190904464|gb|EDV64172.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218352700|emb|CAU98482.1| Terminase large subunit [Escherichia coli 55989]
 gi|324114096|gb|EGC08069.1| phage terminase large subunit [Escherichia fergusonii B253]
 gi|331074774|gb|EGI46094.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
          Length = 470

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|13559866|ref|NP_112076.1| terminase large subunit [Enterobacteria phage HK620]
 gi|13517602|gb|AAK28891.1|AF335538_43 terminase large subunit [Salmonella phage HK620]
          Length = 470

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGENIL 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|325497784|gb|EGC95643.1| gene 2 protein [Escherichia fergusonii ECD227]
          Length = 470

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|293604595|ref|ZP_06686998.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
 gi|292817011|gb|EFF76089.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
          Length = 463

 Score = 92.9 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 54/321 (16%), Positives = 99/321 (30%), Gaps = 49/321 (15%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF--QI 253
             +E  G  +     I   + +  A  + +   NP  L   F +     L         I
Sbjct: 135 WIEEGEGLTEEQWSIIDPTIRKEGAEVWVLW--NP-HLITDFVQAKLPALLGADCIIRHI 191

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REPC 311
           +      +  +           D D  R    GQ    D  S I  + IE A++   +  
Sbjct: 192 NYPDNPFLSATAKRKAERLKEADPDAYRHIYLGQPLSSDDASVIKFHWIEAAVDAHLKLG 251

Query: 312 PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYRP 369
            +      +G D+A+ G D     +  G + + L +W   + +L  +  +    V   R 
Sbjct: 252 IELGGARTVGYDVADSGADKNACSVFDGAICDELDEWAAPEDELNQSTKRAWAHV---RN 308

Query: 370 DAIIIDANNTGARTCDYLE----MLGYHVYRVLGQKRAVDLEF---------CRNRRTEL 416
             ++ D+   GA     L       GYH +   G   + D E+           N + + 
Sbjct: 309 GILVYDSIGVGAHVGSTLADAGIRTGYHKFNAGGAVISPDKEYAPKIKNKEKFENLKAQA 368

Query: 417 HVKMADWLE--------------------FASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
              +AD L                      + +     L   L + +       G   +E
Sbjct: 369 WQDVADRLRNTYNAVTKGMVFPASELISISSGISKLEQLKIELSAPRK-RYSKRGLDMVE 427

Query: 457 SKR---VKGAKSTDYSDGLMY 474
           +K     +G  S + +D  + 
Sbjct: 428 TKEDMARRGIPSPNLADSFIM 448


>gi|222032743|emb|CAP75482.1| Terminase large subunit [Escherichia coli LF82]
          Length = 470

 Score = 92.9 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADSLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|168239626|ref|ZP_02664684.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197287704|gb|EDY27095.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 470

 Score = 92.9 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYAAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILVPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEVIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|323936486|gb|EGB32774.1| phage terminase large [Escherichia coli E1520]
          Length = 470

 Score = 92.9 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDL------------ 406
           L  +   D  + D +  GA     T +             G +   D             
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDGPYQAGAWADE 343

Query: 407 -----------EFCRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                      +  RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIDEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|300897414|ref|ZP_07115839.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
 gi|300358826|gb|EFJ74696.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
          Length = 470

 Score = 92.1 bits (227), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 134/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGSDHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|324114526|gb|EGC08494.1| hypothetical protein ERIG_00518 [Escherichia fergusonii B253]
          Length = 540

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 57/396 (14%), Positives = 122/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ + + G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINSVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|238027169|ref|YP_002911400.1| hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
 gi|237876363|gb|ACR28696.1| Hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
          Length = 531

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/332 (17%), Positives = 101/332 (30%), Gaps = 55/332 (16%)

Query: 190 TYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
                 + DE++      +    L   T    +      S P  +   F +   +     
Sbjct: 195 DRASFYVVDESAFLERPQLVDASLSATTNCRQD-----ISTPNGMGNSFAQ--RRHSGKI 247

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K F    R     D +++   +A   LD  V   E+   +        IP   ++ AL  
Sbjct: 248 KVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAWVQAALGA 305

Query: 309 EPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLV 364
                  P      G D+A+EG D      R G ++EHL  WS    D+  T ++  G+ 
Sbjct: 306 HVKLGISPSGARRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTVDRALGIC 365

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDL-------- 406
           +    +    DA+  GA       +L                  G     D         
Sbjct: 366 DVRGYEVFDYDADGLGAGVRGDARVLNEQRAAAGKRSIRSEPFRGSGPVYDPDGEMVKER 425

Query: 407 ---EFCRNRRTELHVKMADWL----------------EFASLINHSGLIQNLK---SLKS 444
              ++  N + +    +                    E  S+         L    S  +
Sbjct: 426 KNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALSMELSQPT 485

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
           F V   G++ I+ K   G KS + +D +M  +
Sbjct: 486 FTVNGVGKIVID-KAPDGTKSPNLADAVMIAY 516


>gi|260856407|ref|YP_003230298.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
 gi|257755056|dbj|BAI26558.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
          Length = 470

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 62/466 (13%), Positives = 133/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       + I    +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +   +        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHTKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDL------------ 406
           L  +   D  + D +  GA     T +             G +   D             
Sbjct: 284 LAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDGPYQAGAWADE 343

Query: 407 -----------EFCRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                      +  RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|330910791|gb|EGH39301.1| phage terminase, large subunit [Escherichia coli AA86]
          Length = 540

 Score = 91.7 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 57/397 (14%), Positives = 127/397 (31%), Gaps = 67/397 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
              R     D  ++     +  +D+ V    E+   +        IP   ++ A++    
Sbjct: 252 FHWRDDPRKDEEWYRRECEK--IDNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIK 309

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKY 367
               P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+ 
Sbjct: 310 LGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQD 369

Query: 368 RPDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQ 400
             +    D +  GA         + L                           V    GQ
Sbjct: 370 NLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQ 429

Query: 401 KRAVDLEFCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLK 440
              ++ +F  N + +   ++    +                     +++ +   LI  L 
Sbjct: 430 AARLNKDFFANAKAQSWWRLRKLFQNTYRAVVEGMAYNPDEIISISSAMASKDKLIIEL- 488

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
           S  ++ +   G++ ++ K+  G KS + +D +M ++A
Sbjct: 489 SQPTYSINGVGKIVVD-KQPDGTKSPNLADSVMISYA 524


>gi|319789040|ref|YP_004150673.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
 gi|317113542|gb|ADU96032.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
          Length = 419

 Score = 91.7 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 70/419 (16%), Positives = 146/419 (34%), Gaps = 58/419 (13%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            +Q+E ++ +D+H  +             I   R  GK+ + ++      +T+P  +++ 
Sbjct: 6   PYQIEIVKGIDSHKFSV------------IKMARQTGKSFVVSYWATRRATTKPNHAIVV 53

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           ++ +E Q              L  +K    ++++ L    ++ D     L ++  + S +
Sbjct: 54  VSPTERQ------------SKLFVDKVKLHIKAMRLTGVKFFEDTELKKLEVNFPNGSQI 101

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNP 230
                   PD   G        +I DE +   +   +   +   +T +  +   +  S P
Sbjct: 102 --IALPANPDGIRGFSGD----VIMDEVAFFKNWQEVYRAVFPIITRK-KDYKLVAISTP 154

Query: 231 RRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF 288
              +  FY ++  ++    W R+ ++               +     + D  R E   +F
Sbjct: 155 FGKNDLFYYLWSISENNPKWFRYSLNIFEAVAKGLKVDVEELRAGIKNEDAWRTEYLVEF 214

Query: 289 PQQDIDSFIPLNIIEEA-LNREPCPDPY-----APLIMGCDIAEEGGDNTVVV----LRR 338
             +  D+ +P  +I++  + +E             L  G D+     D TV+     L  
Sbjct: 215 IDEA-DAVLPYELIQKCEMPKEELLVEDIKELKGELYCGVDVGRR-KDLTVITLLEKLGD 272

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYRV 397
              +  + + SK   R     IS     +    + ID    G +  + L+   G  V  V
Sbjct: 273 VLYVRRIEELSKKPFREQLELISHYA--HYARRLAIDETGLGMQLAEELKERFGSKVIPV 330

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
                A + E    +   L  K  D      +     L ++L S++   V N G +  E
Sbjct: 331 YF--SAKNKEELAEK---LRAKFQD--RLIRVPADPDLREDLHSVRK-TVTNAGNVRYE 381


>gi|268589862|ref|ZP_06124083.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
 gi|291314845|gb|EFE55298.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
          Length = 470

 Score = 91.7 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 67/487 (13%), Positives = 138/487 (28%), Gaps = 79/487 (16%)

Query: 66  CLNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
            +N +  P  E  +  +   GRG GK+        W +       ++  A     ++   
Sbjct: 3   QINPIFMPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILC 49

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
             E+   +S    +   +      +   +               +       +  +  + 
Sbjct: 50  ARELQNSISDSVIRLLEDTIEREGYNNEFEIQRTMIKHLGTGAEFMFYGIKNNPTKIKSL 109

Query: 185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-K 243
            G           +EA          ++  + + N+   W+   NP+ +    Y+ F   
Sbjct: 110 EGVD-----VCWVEEAEAVTKESWDILIPTIRKPNSE-IWVSF-NPKNILDDTYQRFVVN 162

Query: 244 PLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
           P DD      +              +      +  + R    G+       + I    +E
Sbjct: 163 PPDDICLLTANYTDNPHFPDVLRLEMEECKRKNPTLYRHIWLGEPVSASDMAIIKREWLE 222

Query: 304 EALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
            A +  ++        +I   D ++ GGD     +R G V++ + +    D+    +  +
Sbjct: 223 AATDAHKKLGWKAKGAIIATHDPSDVGGDAKGYAMRHGSVVKRISEGLLMDVNDGADWAT 282

Query: 362 GLVEKYRPDAIIIDANNTGART--------------------------CDYLEMLGYHVY 395
               +   D  + D +  GA                             D L   G    
Sbjct: 283 EKAIQDGADHFLWDGDGLGAALRRQVTDAFTGKQTTVTMFKGSESPFDEDALYQSGAWAD 342

Query: 396 RVLGQKRAVDL-EFCRNRRTELHVKMADWL-------EFASLINHSGLIQ---------- 437
            V+    +  + +  RN+R + +  +AD L       E     N   +I           
Sbjct: 343 EVVSGDNSRTIGDVFRNKRAQFYYALADRLYLTYRAVEHGEYANPDDMISFDKEAIGEQM 402

Query: 438 ------NLKSLKSFIVPNTGELAIESKRVK----GAKSTDYSDGLMYTFAENPPRSDMDF 487
                  L  ++       G+L + +K       G  S + +D LM +        D   
Sbjct: 403 LEKLFAELTQIQR-KFNGNGKLELMTKVDMKVKLGIPSPNLADSLMMSMYCPVIIHDDTE 461

Query: 488 GRCPSYQ 494
              PS  
Sbjct: 462 IYVPSSS 468


>gi|85716479|ref|ZP_01047450.1| prophage MuMc02, terminase, ATPase subunit, putative [Nitrobacter
           sp. Nb-311A]
 gi|85696668|gb|EAQ34555.1| prophage MuMc02, terminase, ATPase subunit, putative [Nitrobacter
           sp. Nb-311A]
          Length = 250

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 50/262 (19%), Positives = 78/262 (29%), Gaps = 38/262 (14%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ E +            NP   +   +  +    GKTT+ A + L       G  V
Sbjct: 24  PDPWQAELLR----------LNPKRALLLCSRQS----GKTTVTALMALHRAIYETGALV 69

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           + ++ S  Q    L  ++ K    L         ++                        
Sbjct: 70  VIVSPSNRQSGEML-RQIKKLHGSLKGAPELVGDAVLKVELA--------------NGSR 114

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
            +    +E+      G        +I DEAS   D +   +   L  R A+   I  + P
Sbjct: 115 IIALPGTEKTIRGIAG-----VSLVIIDEASRVDDELLAAVRPMLATR-ADGSLIALTTP 168

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
               G FYE ++     W R ++       I   F    +   G        E    F  
Sbjct: 169 AGKRGFFYEAWHSDDQTWHRVRVAASDCPRISKEFLADELRSLG--PARYSEEYELAFVD 226

Query: 291 QDIDSFIPLNIIEEALNREPCP 312
               +F P  +IE A   E  P
Sbjct: 227 DAASAF-PTAVIERAFTTEVEP 247


>gi|298381518|ref|ZP_06991117.1| phage terminase large subunit [Escherichia coli FVEC1302]
 gi|298278960|gb|EFI20474.1| phage terminase large subunit [Escherichia coli FVEC1302]
          Length = 470

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 61/466 (13%), Positives = 133/466 (28%), Gaps = 79/466 (16%)

Query: 67  LNSVNNPNPEVFKGAI-SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
           +N +  P  E  +  +   GRG GK+        W +       ++  A     ++    
Sbjct: 4   INPIFEPFIEAHRYKVAKGGRGSGKS--------WAI-----ARLLVEAARRQPVRILCA 50

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E+   +S    +   +      + A +            +  +       +  +  +  
Sbjct: 51  RELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLE 110

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KP 244
           G           +EA          ++  + +  +   W+   NP+ +    Y+ F   P
Sbjct: 111 GID-----ICWVEEAEAVTKESWDILIPTIRKPFSE-IWVSF-NPKNILDDTYQRFVVNP 163

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
            DD     ++              +      +  + R    G+       +      +E 
Sbjct: 164 PDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIFKREWLEA 223

Query: 305 ALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A +  ++        ++   D ++ G D      R G V++ + +    D+    +  + 
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATS 283

Query: 363 LVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF---------- 408
           L  +   D  + D +  GA     T +             G +   D +           
Sbjct: 284 LAIEDGSDHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADE 343

Query: 409 -------------CRNRRTELHVKMADWLEFA---------SLINH-------------- 432
                         RN+R + +  +AD L            +  +               
Sbjct: 344 VVQGDNVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKML 403

Query: 433 SGLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
             L   L  ++     N G+L     +E K+  G  S + +D LM 
Sbjct: 404 EKLFAELTQIQR-KFNNNGKLELMTKVEMKQKLGIPSPNLADALMM 448


>gi|167753387|ref|ZP_02425514.1| hypothetical protein ALIPUT_01661 [Alistipes putredinis DSM 17216]
 gi|167658012|gb|EDS02142.1| hypothetical protein ALIPUT_01661 [Alistipes putredinis DSM 17216]
          Length = 472

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/259 (16%), Positives = 92/259 (35%), Gaps = 31/259 (11%)

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVC-GQFP-QQDIDSFIPLNIIEEALNREPCPDP 314
               I+  + E + +       V +  +  G +    + ++    + I E    +     
Sbjct: 230 DNPFIEKDYIEALKST---TDKVKKERLLKGNWDYDDNPNALCSYDNIREIFYPKIH-TR 285

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAI 372
                +  DIA  G D   +++  G  I     + ++        I  L  K+R     I
Sbjct: 286 TGIKYITADIARFGSDRARILVWDGWAIIEQVSFDRSATTEIAACIESLAAKHRIPRYRI 345

Query: 373 IIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH 432
           I D +  G    D   + G+     +   + ++ E   N +T+   K+A+ +   ++   
Sbjct: 346 IADEDGVGGGVVDMCRISGF-----VNNSQCLNGENFSNLQTQCGYKLANKINSFAISFD 400

Query: 433 SGL--------IQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPP 481
             L         + L+ L+++ V N  +L ++ K   +    +S D+ D L+        
Sbjct: 401 CELSDGQKDEITEELEQLQTWNVDNDRKLFLKPKDEIKQDIGRSPDWRDALLM------- 453

Query: 482 RSDMDFGRCPSYQYEGVDL 500
           R   D+ +      E + L
Sbjct: 454 RVWFDYKQIIPLSKEDLGL 472


>gi|238765385|ref|ZP_04626308.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
 gi|238696377|gb|EEP89171.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
          Length = 501

 Score = 90.9 bits (224), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/402 (14%), Positives = 121/402 (30%), Gaps = 64/402 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F     S     W        + ++      + +  + +             
Sbjct: 106 ALFWKARKFVETLPSEFRGSWSEKKHAPYMRVEFPDTGAVIKGEAGDNIGR-----GDRT 160

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DE++     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 161 TLYFVDESAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHGGKIPVFT 214

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
              R+    D  +          +  V   E+   +        IP   ++ A++     
Sbjct: 215 FHWRSDPRKDDEW-YRKECEKIDNPVVVAQELDLNYQASAEGILIPSEWVQAAIDAHIHL 273

Query: 313 D--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNN--KISGLVEKYR 368
           D  P    +   D+A+EG D     +R G +++ + +WS        +  K+ G  ++Y 
Sbjct: 274 DIQPSGARLGAMDVADEGRDKNGFAIRYGFLLQDVKEWSGEGSDIYASVVKVFGYCDEYG 333

Query: 369 PDAIIIDANNTGAR------TCDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 334 LDEFRFDEDGLGAGVRGDARVINELRQSERLGPITATPFRGSGAVFDPDDEAVIGDNGKP 393

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSL 442
             ++ +F  N + +    +                         +++ N   LI  L S 
Sbjct: 394 ARLNKDFFANAKAQGWWHLRKLFRNTFRAMKGMDYNPDEIISINSTMENKDRLIMEL-SQ 452

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
            ++     G++ I+ K+ +G KS + +D +M  +A      D
Sbjct: 453 PTWSKNAVGKIVID-KQPEGTKSPNLADAVMINYAPMDSSLD 493


>gi|300824951|ref|ZP_07105051.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300522580|gb|EFK43649.1| conserved hypothetical protein [Escherichia coli MS 119-7]
          Length = 540

 Score = 90.9 bits (224), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/396 (14%), Positives = 121/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  KI G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKIFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|254160843|ref|YP_003043951.1| hypothetical protein ECB_00733 [Escherichia coli B str. REL606]
 gi|253972744|gb|ACT38415.1| conserved hypothetical protein [Escherichia coli B str. REL606]
          Length = 540

 Score = 90.9 bits (224), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 57/396 (14%), Positives = 122/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L  +                        V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNVARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|168467237|ref|ZP_02701079.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
 gi|195630466|gb|EDX49092.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
          Length = 539

 Score = 90.6 bits (223), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 54/394 (13%), Positives = 117/394 (29%), Gaps = 62/394 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F     +     W        + ++      + +  + +             
Sbjct: 143 ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YRKECEKIDNPIIVAQELDLNYQASAEGILIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART---------------CDYL-----EMLGYHVYRV-------LGQK 401
            D    D +  GA                  D +        G   Y          G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGSGRVFYPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMAD-------WLEFASLINHS-----------GLIQNLKSLK 443
             ++ +F  N + +    +          L+                     +    S  
Sbjct: 431 SRLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIISISSTMENKDRLLMELSQP 490

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
           ++     G++ ++ K+  G KS + +D +M  +A
Sbjct: 491 TWSKNAVGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|194430118|ref|ZP_03062621.1| gp33 TerL [Escherichia coli B171]
 gi|215487586|ref|YP_002330017.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|260845222|ref|YP_003223000.1| putative terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|194411828|gb|EDX28147.1| gp33 TerL [Escherichia coli B171]
 gi|215265658|emb|CAS10061.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|257760369|dbj|BAI31866.1| predicted terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|309702924|emb|CBJ02255.1| putative phage gp33 TerL [Escherichia coli ETEC H10407]
 gi|323159191|gb|EFZ45181.1| gp33 TerL [Escherichia coli E128010]
          Length = 540

 Score = 90.2 bits (222), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 57/396 (14%), Positives = 121/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|168820654|ref|ZP_02832654.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205342611|gb|EDZ29375.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
          Length = 539

 Score = 90.2 bits (222), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 52/394 (13%), Positives = 116/394 (29%), Gaps = 62/394 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F     +     W        + ++      + +  + +             
Sbjct: 143 ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKISVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YRKECEKIDNPIIVAQELDLNYQASAEGILIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART---------------CDYLEMLGYHVYRV------------LGQK 401
            D    D +  GA                  D +    +                  G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGSGSVFYPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMAD-------WLEFASLINHS-----------GLIQNLKSLK 443
             ++ +F  N + +    +          L+                     +    S  
Sbjct: 431 ARLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIISISSTMENKDRLLMELSQP 490

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
           ++     G++ ++ K+  G KS + +D +M  +A
Sbjct: 491 TWSKNAVGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|218555117|ref|YP_002388030.1| hypothetical protein ECIAI1_2647 [Escherichia coli IAI1]
 gi|218361885|emb|CAQ99485.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 540

 Score = 90.2 bits (222), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 57/396 (14%), Positives = 121/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLMENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|291283815|ref|YP_003500633.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763688|gb|ADD57649.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
          Length = 540

 Score = 90.2 bits (222), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 57/395 (14%), Positives = 122/395 (30%), Gaps = 63/395 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL----------------EFASLINHSGLIQNL---KSL 442
             ++ +F  N + +   ++                    E  S+ +   L   L    S 
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIALSQ 490

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 491 PTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|62181180|ref|YP_217597.1| hypothetical protein SC2610 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62128813|gb|AAX66516.1| orf, partial conserved hypothetical protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322715669|gb|EFZ07240.1| hypothetical protein SCA50_2790 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 540

 Score = 89.8 bits (221), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 125/396 (31%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  ++     +   +  V   E+   +        IP + ++ A++     
Sbjct: 252 FHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSDWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLKS 441
             ++ +F  N + +    +                          +++ +   LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEIISISSTMESKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ ++ K+  G +S + +D +M ++A
Sbjct: 490 QPTYSINGVGKIVVD-KQPDGTRSPNLADSVMISYA 524


>gi|194445851|ref|YP_002040314.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
 gi|194404514|gb|ACF64736.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
          Length = 540

 Score = 89.8 bits (221), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 125/396 (31%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  ++     +   +  V   E+   +        IP + ++ A++     
Sbjct: 252 FHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSDWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLKS 441
             ++ +F  N + +    +                          +++ +   LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEIISISSTMESKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ ++ K+  G +S + +D +M ++A
Sbjct: 490 QPTYSINGVGKIVVD-KQPDGTRSPNLADSVMISYA 524


>gi|188494674|ref|ZP_03001944.1| gp33 TerL [Escherichia coli 53638]
 gi|188489873|gb|EDU64976.1| gp33 TerL [Escherichia coli 53638]
          Length = 539

 Score = 89.8 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 121/395 (30%), Gaps = 64/395 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECEKIDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART------CDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGSGSVFHPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSL 442
             ++ +F  N + +    +                         +++ N   L+  L S 
Sbjct: 431 ARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIISISSTMENKDRLLMEL-SQ 489

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++    TG++ ++ K+  G KS + +D +M  +A
Sbjct: 490 PTWSKNATGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|167553969|ref|ZP_02347711.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205321713|gb|EDZ09552.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 539

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 52/394 (13%), Positives = 116/394 (29%), Gaps = 62/394 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F     +     W        + ++      + +  + +             
Sbjct: 143 ALFWKVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECEKIDNPIIVAQELDLNYQASTEGILIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART---------------CDYLEMLGYHVYRV------------LGQK 401
            D    D +  GA                  D +    +                  G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGSGSVFYPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMAD-------WLEFASLINHS-----------GLIQNLKSLK 443
             ++ +F  N + +    +          L+                     +    S  
Sbjct: 431 SRLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIISISSTMENKDRLLMELSQP 490

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
           ++     G++ ++ K+  G KS + +D +M  +A
Sbjct: 491 TWSKNAVGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|224582844|ref|YP_002636642.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467371|gb|ACN45201.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 540

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 125/396 (31%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  ++     +   +  V   E+   +        IP + ++ A++     
Sbjct: 252 FHWRSDPRKDDEWYRRECEKI-DNPVVVAQELDLNYSASAEGILIPSDWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLKS 441
             ++ +F  N + +    +                          +++ +   LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEIISISSTMESKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ ++ K+  G +S + +D +M ++A
Sbjct: 490 QPTYSINGVGKIVVD-KQPDGTRSPNLADSVMISYA 524


>gi|332088044|gb|EGI93169.1| gp33 TerL [Shigella boydii 5216-82]
          Length = 539

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 120/395 (30%), Gaps = 64/395 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECEKIDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART------CDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGSGSVFHPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSL 442
             ++ +F  N + +    +                         +++ N   L+  L S 
Sbjct: 431 ARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIISISSTMENKDRLLMEL-SQ 489

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++    TG++ ++ K+  G KS + +D +M  +A
Sbjct: 490 PTWSKNATGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|323173153|gb|EFZ58784.1| gp33 TerL protein [Escherichia coli LT-68]
          Length = 539

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 120/395 (30%), Gaps = 64/395 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECEKIDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART------CDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGSGSVFHPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSL 442
             ++ +F  N + +    +                         +++ N   L+  L S 
Sbjct: 431 ARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIISISSTMENKDRLLMEL-SQ 489

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++    TG++ ++ K+  G KS + +D +M  +A
Sbjct: 490 PTWSKNATGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|332759085|gb|EGJ89395.1| gp33 TerL [Shigella flexneri 4343-70]
          Length = 519

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/396 (14%), Positives = 121/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 122 ALFWKARKFVETLPVEFRGSWDEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 176

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DE++     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 177 TLYLVDESAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 230

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 231 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 289

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 290 GIQPTGKRLGAMDVADEGRDKNSFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 349

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 350 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 409

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E                     LI  L S
Sbjct: 410 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMDYNPDEIISISSSMALKDKLIIEL-S 468

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M ++A
Sbjct: 469 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMISYA 503


>gi|191172603|ref|ZP_03034142.1| gp33 TerL [Escherichia coli F11]
 gi|190907076|gb|EDV66676.1| gp33 TerL [Escherichia coli F11]
 gi|324014340|gb|EGB83559.1| hypothetical protein HMPREF9533_01599 [Escherichia coli MS 60-1]
          Length = 540

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/396 (14%), Positives = 120/396 (30%), Gaps = 65/396 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +   + G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVENVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKS 441
             ++ +F  N + +   ++            E  +                  LI  L S
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
             ++ +   G++ I+ K+  G +S + +D +M  +A
Sbjct: 490 QPTYSINGVGKIVID-KQPDGTRSPNLADSVMINYA 524


>gi|333006277|gb|EGK25786.1| gp33 TerL [Shigella flexneri K-218]
          Length = 540

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 123/395 (31%), Gaps = 63/395 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWDEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DE++     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDESAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R     D  ++     +   +  V   E+   +        IP   ++ A++     
Sbjct: 252 FHWRDDPRKDEEWYRRECEKI-DNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+  
Sbjct: 311 GIQPTGKRLGAMDVADEGRDKNSFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDN 370

Query: 369 PDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQK 401
            +    D +  GA         + L                           V    GQ 
Sbjct: 371 LEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGSGAVFDPDDEAVRGDNGQA 430

Query: 402 RAVDLEFCRNRRTELHVKMADWL----------------EFASLINHSGLIQNL---KSL 442
             ++ +F  N + +   ++                    E  S+ +   L   L    S 
Sbjct: 431 ARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMDYNPDEIISISSSMALKDKLIIELSQ 490

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++ +   G++ I+ K+  G +S + +D +M ++A
Sbjct: 491 PTYSINGVGKIVID-KQPDGTRSPNLADSVMISYA 524


>gi|320179507|gb|EFW54461.1| Phage terminase, large subunit [Shigella boydii ATCC 9905]
          Length = 539

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 120/395 (30%), Gaps = 64/395 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECDKIDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART------CDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGSGSVFHPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSL 442
             ++ +F  N + +    +                         +++ N   L+  L S 
Sbjct: 431 ARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIISISSTMENKDRLLMEL-SQ 489

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            ++    TG++ ++ K+  G KS + +D +M  +A
Sbjct: 490 PTWSKNATGKILVD-KQPDGTKSPNLADSVMIAYA 523


>gi|224583103|ref|YP_002636901.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467630|gb|ACN45460.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 492

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/384 (14%), Positives = 108/384 (28%), Gaps = 79/384 (20%)

Query: 180 RPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL------TERN---ANRFWIMTSNP 230
             +   G+ N     +  +EA          ++  +       E      +  W+   NP
Sbjct: 104 NVENIKGYANFDAALV--EEAENVSKDSWETLIPTVRKEFYSAEYGRVVESEIWVA-YNP 160

Query: 231 RRLSGKFYEIF--NKPLDDW--------KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +      ++ F  N+   D+           QI+         +    +      + ++ 
Sbjct: 161 KNRLSDTHQRFVTNRIYPDYDENGNRYCIVKQINYTANPWFPETLRRDMEIMKKANHELY 220

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRR 338
           R    G+       + I    +E A +            +I   D ++ G D     +R 
Sbjct: 221 RHVYLGEPVGASEMAIIKFAWLEAATDAHIKLGWKAKGAVIAAHDPSDTGPDAKGYAVRH 280

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR----TCDYLEMLGYHV 394
           G V++ + +    D+    +  S L      D  + D +  GA       DY       V
Sbjct: 281 GSVVKRVCEGLLMDINEGADWASSLAVIDDVDHFLFDGDGLGAGLRRQITDYFSGKKVTV 340

Query: 395 YRVLGQKRAVDLEF-----------------------CRNRRTELHVKMADWL------- 424
               G +   D +                         RN+R + +  +AD L       
Sbjct: 341 TMFKGSESPFDEDAPYQAGAWTDEVVQGDNVRTIGDVFRNKRAQFYYTLADRLYRTYRAV 400

Query: 425 EFASLINHSG----------------LIQNLKSLKSFIVPNTGEL----AIESKRVKGAK 464
           E     +                   L   L  ++       G+L     +E K+  G  
Sbjct: 401 EHGEYADPDEMLSFDKEAIGENILNKLFAELTQIQR-KFNGNGKLELMTKVEMKQKLGIP 459

Query: 465 STDYSDGLMYTFAENPPRSDMDFG 488
           S + +D LM         +  D+ 
Sbjct: 460 SPNLADALMMCMHCPESVAQPDYS 483


>gi|110804738|ref|YP_688258.1| putative bacteriophage protein [Shigella flexneri 5 str. 8401]
 gi|110614286|gb|ABF02953.1| putative bacteriophage protein [Shigella flexneri 5 str. 8401]
          Length = 255

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 72/238 (30%), Gaps = 49/238 (20%)

Query: 295 SFIPLNIIEEALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SK 350
           + I L+ IE A++  +    +P     +G D+A+ G D    V R G V+    +W   +
Sbjct: 10  AIIKLSWIEAAVDAHKTLNFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKE 69

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG------------YHVYRVL 398
            +L  +  +      +   D I+ D+   GA        +              +  R  
Sbjct: 70  DELLKSCQRTYQAALEREAD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFN 128

Query: 399 GQ----------KRAVDLEFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ---- 437
                           + +F  N + +    +AD        +          LI     
Sbjct: 129 AGAGVHEPDDEYNGIPNKDFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSR 188

Query: 438 --------NLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
                      +         G + +ESK+    +   S + +D  +  FA      D
Sbjct: 189 CPLLEKLKLELTTPHRDFDRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 246


>gi|167993618|ref|ZP_02574712.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
 gi|205328294|gb|EDZ15058.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
          Length = 539

 Score = 87.9 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/404 (13%), Positives = 127/404 (31%), Gaps = 67/404 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
              R+    D  ++     +  +D+ V    E+   +        IP + ++ A++    
Sbjct: 252 FHWRSDPRKDDEWYRRECEK--IDNPVVVAQELDLNYSASAEGVLIPSDWVQAAVDAHIR 309

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKY 367
               P    +   D+A+EG D      R G ++E++ +WS   +D+  +  ++ G  E+ 
Sbjct: 310 LGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVERVFGFCEQD 369

Query: 368 RPDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQ 400
             +    D +  GA         + L                           V    GQ
Sbjct: 370 NLEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGSGAVFDPDDEAVRGDNGQ 429

Query: 401 KRAVDLEFCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLK 440
              ++ +F  N + +    +                          +++ +   LI  L 
Sbjct: 430 AARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEIISISSTMESKDKLIIEL- 488

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
           S  ++ +   G++ ++ K+  G +S + +D  M ++A      D
Sbjct: 489 SQPTYSINGVGKIVVD-KQPDGTRSPNLADSAMISYAPMDSSLD 531


>gi|294650848|ref|ZP_06728195.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292823266|gb|EFF82122.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 552

 Score = 87.9 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 54/337 (16%), Positives = 106/337 (31%), Gaps = 61/337 (18%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
               DE +         +   +++       I  S P  +  +F++  ++    +  F +
Sbjct: 210 MYFLDEWAFVERQ--EAVDAAISQ--NTNVHIKGSTPNGIGDRFHQ--DRFSGRYAVFSM 263

Query: 254 DTRTVEGIDP--SFHEGIIARYGL------DSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
             R     +    ++   I  +        D  V   EV   +        IP   ++ A
Sbjct: 264 PWRANPDKNWTVEYNGKQIHPWYEKQLATLDDVVLAQEVDINYAASVEGVLIPSTWVQLA 323

Query: 306 LNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKIS 361
           ++       +P    I G D+A+EG D      R G V+ +L  WS    D+  T  K  
Sbjct: 324 IDAHIKLGIEPTGDRIAGLDVADEGKDKNSFASRHGIVMTYLDTWSGKGDDIFGTTQKAM 383

Query: 362 GLVEKYRPDAIIIDANNTGAR------TCDYL-EMLGYHVYRVLGQKRA----------- 403
            L      D +  DA+  GA         + L    G     V   + +           
Sbjct: 384 DLSIDQSIDTLFYDADGLGAGCRGDARVVNELRREQGLSEVDVQPFRGSGAVHEPDEQMV 443

Query: 404 ---VDLEFCRNRRTELHVKMADWLEF-------------------ASLINHSGL--IQNL 439
               + +F  N + +    +    +                    +  I+   L  +   
Sbjct: 444 EMRFNKDFFANLKAQSWWSLRLRFQETFRALEGREYDRDMIISFSSEHIDPKELAMLTTE 503

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
            S  ++     G++ + +K+  G  S + +D +M  F
Sbjct: 504 LSQPTYTKNGVGKILV-NKQPDGTASPNRADSVMICF 539


>gi|322835667|ref|YP_004215693.1| terminase large subunit [Rahnella sp. Y9602]
 gi|321170868|gb|ADW76566.1| terminase large subunit [Rahnella sp. Y9602]
          Length = 539

 Score = 87.5 bits (215), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/404 (15%), Positives = 120/404 (29%), Gaps = 67/404 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W +      + ++      + +  + +             
Sbjct: 143 ALFWKARKFVEMLPVEFRGGWSAKKHAPYMRVEFPTTGAVLKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IEASLSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGRIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
              R+    D +++    A+  +D+ V    E+   +        IP   I  A+N    
Sbjct: 252 FHWRSDPRKDEAWYAKECAK--IDNPVVVAQELDLNYSASAEGVLIPNEWIRAAINAHIK 309

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKY 367
               P    +   D+A+EG D      R G ++  + +WS   +D+  ++ K  GL +K+
Sbjct: 310 LGIQPTGKRLGAMDVADEGRDKNAFSARYGFLLTEVEEWSGVGSDIYKSSEKAFGLCDKH 369

Query: 368 RPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDLE---------- 407
             +    D +  GA        +                  G     D E          
Sbjct: 370 GLEEFRFDEDGLGAGVRGDARAINEIRKAEGARYILATPFRGSASVFDPEAEAVPGDNGQ 429

Query: 408 -------FCRNRRTELHVKMADWLE--------------------FASLINHSGLIQNLK 440
                  F  N + +    +                            + N   LI  L 
Sbjct: 430 PARINKDFFANAKAQSWWHLRKLFRNVYRAVEEKMDYNPDEIISISGDIKNLDKLIIEL- 488

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
           S  ++ +   G++ I  K+  G KS + SD +M  +A      D
Sbjct: 489 SQPTYSINGVGKI-IVDKQPDGTKSPNLSDSVMINYAPMDTTMD 531


>gi|238790716|ref|ZP_04634478.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
 gi|238721211|gb|EEQ12889.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
          Length = 538

 Score = 87.5 bits (215), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 58/356 (16%), Positives = 107/356 (30%), Gaps = 63/356 (17%)

Query: 172 MCRTYSEERPDTFVGH-HNTYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSN 229
              T S    +   G          I DE++      +    L   T    +      S 
Sbjct: 176 FPETESAMTGEAGDGIGRGDRTSFYIVDESAFLERPYLVDASLSATTNCRQD-----VST 230

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P  ++  F E   +     K F    R     D ++++  +    LD      E+   + 
Sbjct: 231 PNGMANSFAE--RRHSGKIKVFTFHWRDDPRKDDAWYQKQVEN--LDPVTVAQEIDINYS 286

Query: 290 QQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
                  IP   ++ A+N        P    +   DIA+EG D      R G ++E + +
Sbjct: 287 ASVEGVLIPSAWVQAAINAHEVLGIVPTGQRLGALDIADEGKDTNSFAGRHGFLLESIEE 346

Query: 348 WSKT--DLRTTNNKISGLVEKYRPDAIIIDANNTGAR------TC--DYLEMLGYHVYRV 397
           WS    D+  T  K   + +    +    D +  GA              E    H+   
Sbjct: 347 WSGKGDDIFGTVQKAFDICDAQNLETFRFDTDGLGAGARGDARVINEQREEQRRRHIVAT 406

Query: 398 -------------------LGQKRAVDLEFCRNRRTELHVKMADWL-------------- 424
                               GQ+  ++ +F  N + +    +                  
Sbjct: 407 PFRGSGGVTDPDDEAVPGDNGQQGRLNKDFFANAKAQGWWSLRTRFQKTYRAVKENMEFD 466

Query: 425 --EFASLINHSGLIQNLK---SLKSFIVPNTGELAIESKRVKGAKSTDYSD-GLMY 474
             E  S+      +  L    S  ++ V   G++ ++ K   G KS + +D  ++ 
Sbjct: 467 PDEIISIPKDLKNLTKLTSELSQPTYSVNGVGKIVVDKKPD-GTKSPNLADSAMIL 521


>gi|227113418|ref|ZP_03827074.1| Terminase large subunit [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 472

 Score = 87.5 bits (215), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 49/337 (14%), Positives = 94/337 (27%), Gaps = 61/337 (18%)

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQID 254
             +EA          ++  + +  +   W+   NP+ +    Y+ F   P DD     ++
Sbjct: 116 WVEEAEAVTKESWDILIPTIRKPGSE-IWVSF-NPKNILDDTYQRFVVTPPDDICLLTVN 173

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--P 312
                         +      +  + R    G+       + I    +E A +       
Sbjct: 174 YTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASEMAIIKREWLEAATDAHIKLGW 233

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDA 371
                ++   D ++ G D+    +R G V++ +       D+    +  + L      D 
Sbjct: 234 KAKGAIVAAHDPSDTGPDDKGYAMRHGSVVKRIASPPAPLDVNDGADWATDLAIADGADH 293

Query: 372 IIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF------------------- 408
            + D +  GA       D        V    G +   D +                    
Sbjct: 294 FLFDGDGLGAGLRRQVTDSFTGKKVTVTMFKGSESPFDEDSPYQAGAWFDEVVDGDNIRT 353

Query: 409 ----CRNRRTELHVKMADWL-----------------------EFASLINHSGLIQNLKS 441
                RN+R + +  +AD L                       E         L   L  
Sbjct: 354 IGDVFRNKRAQFYYTLADRLYLTYRAIVHGEYANPDDMLSFDKEAIGDQMLEKLFAELTQ 413

Query: 442 LKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMY 474
           ++       G+L     +E K   G  S + +D LM 
Sbjct: 414 IQR-KFNGNGKLELMTKVEMKSKLGIPSPNLADSLMM 449


>gi|260906962|ref|ZP_05915284.1| hypothetical protein BlinB_16637 [Brevibacterium linens BL2]
          Length = 249

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 79/258 (30%), Gaps = 40/258 (15%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
            P  WQ   +                +  +  +   R +GKTT  A+  L      PG  
Sbjct: 23  DPELWQERLLRT--------------QEARVLVLCARQVGKTTATAYKALHAAMFNPGRD 68

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           V+ ++ S+ Q    L             +     + +   P    S+     L   S+  
Sbjct: 69  VLIVSPSQRQSDEML------------RRVASLYRGMKEAPKLSRSNTSEMGLSNGSR-- 114

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             +    SE     F G        +I DEAS   D +   +L  +         +  S 
Sbjct: 115 -VVSLPGSEGGIRGFAGVK-----LLILDEASRVDDDVFASVLPMVASDGQ---MVALST 165

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P    G F+E+  +  + W+R ++     +   P     + A  G  S V   +   +F 
Sbjct: 166 PWGRRGWFHELHQETRNGWERHKVTVYESDQYTPPRIAEVKASLG--SFVFSSDYLCEF- 222

Query: 290 QQDIDSFIPLNIIEEALN 307
                       +  A +
Sbjct: 223 GDTDSQLFSTENVRAAFS 240


>gi|315426011|dbj|BAJ47659.1| prophage MuMc02, terminase, ATPase subunit [Candidatus
           Caldiarchaeum subterraneum]
          Length = 439

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 63/333 (18%), Positives = 112/333 (33%), Gaps = 25/333 (7%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ- 119
            +  H        +P  F+  +   RG G T   A        T P  +++ ++ S  Q 
Sbjct: 18  DIRLHPWQKRFIDDPSRFRIILKH-RGAGATFTIAAEACAEALTHPASTILLISYSLRQS 76

Query: 120 LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEE 179
           L+  ++  V   LS L NK      S+    A   +  +    G                
Sbjct: 77  LE--IFRHVRTILSRLENKRLKHGHSIYRLAAKIGARTVELGNGSRI--------ISLPN 126

Query: 180 RPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
            P++  G+      A+  DEA+      NL      T    N    + S P+   G F+E
Sbjct: 127 NPESLRGYRAD---AVYVDEAAFFRGDTNLKTAIMFTTVARNGRVTLVSTPKGKRGWFHE 183

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
            +      W +  +       I     E +  R  +     R E+  +F   ++++FIP 
Sbjct: 184 AWTTDNT-WSKHLVKLGDSPHITMHDLEEL--RKTMSPLEWRQEMMCEFLD-EVNAFIPY 239

Query: 300 NIIEEALNRE-PCPDPYAPLIMGCDIAEEGGDNTVV--VLRRGPVIE--HLFDWSKTDLR 354
             I E +    P       + +G D      D+TV+  V+  G      ++ +  +    
Sbjct: 240 EKILECVEDYVPARVVGGRVYVGVDFGRF-RDSTVIIAVVEDGERFRVCYVEELRQKPFA 298

Query: 355 TTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
                I+       P  + +D+   GA   + L
Sbjct: 299 AQLEAINRANMVLHPAIVAVDSTGMGAPLAETL 331


>gi|297520464|ref|ZP_06938850.1| hypothetical protein EcolOP_22727 [Escherichia coli OP50]
          Length = 313

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 90/270 (33%), Gaps = 56/270 (20%)

Query: 262 DPSFHEGIIARYGLDSD---VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYA 316
           DP   E    R     D   V   E+   +        IP   ++ A++        P  
Sbjct: 30  DPRKDEEWYRRECEKIDNPVVVAQELDLNYSASAEGVLIPSEWVQAAVDAHIKLGIQPTG 89

Query: 317 PLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYRPDAIII 374
             +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+   +    
Sbjct: 90  KRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDNLEEFRF 149

Query: 375 DANNTGART------CDYLEMLGYH---------------------VYRVLGQKRAVDLE 407
           D +  GA         + L  +                        V    GQ   ++ +
Sbjct: 150 DEDGLGAGVRGDARAINELRNVARRPSILATPFRGSGAVFDPDDEAVRGDNGQAARLNKD 209

Query: 408 FCRNRRTELHVKMADWL--------EFASLINH------------SGLIQNLKSLKSFIV 447
           F  N + +   ++            E  +                  LI  L S  ++ +
Sbjct: 210 FFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEIISISSSMALKDKLIIEL-SQPTYSI 268

Query: 448 PNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
              G++ I+ K+  G +S + +D +M  +A
Sbjct: 269 NGVGKIVID-KQPDGTRSPNLADSVMINYA 297


>gi|327191373|gb|EGE58399.1| prophage MuMc02, terminase, ATPase subunit, putative [Rhizobium
           etli CNPAF512]
          Length = 248

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/262 (17%), Positives = 86/262 (32%), Gaps = 38/262 (14%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
            P  WQ   +            NP   +   +  +    GK+T+ A+LV+      P   
Sbjct: 22  EPDPWQANLLRA----------NPRRSMLLCSRQS----GKSTVAAFLVIQTALFVPAAQ 67

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           ++ ++ ++ Q    L+  +  +LS LP       +S                    S   
Sbjct: 68  IVVVSPTQRQ-SNELFRTIVGFLSRLPGAPRPTAESKQGTEL--------------SNGA 112

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             +    +E+      G        ++ DEA+   D +   +   +  +  +   +  + 
Sbjct: 113 RVLSLPGTEKTIRGIAGVD-----LVVMDEAARVEDALLTAVRPMMATK-PDARLVALTT 166

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P    G FYE +      W+R ++       I   F +  +   G        E   +F 
Sbjct: 167 PAGKRGWFYEAWVSDDPSWERVRVPASACPRITQQFLDEELKALGA--IKFSEEYGLEFH 224

Query: 290 QQDIDSFIPLNIIEEALNREPC 311
             +  +  PL IIE A  +E  
Sbjct: 225 DPEE-AVFPLAIIEAAFTQEVR 245


>gi|315576663|gb|EFU88854.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 519

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 67/430 (15%), Positives = 137/430 (31%), Gaps = 62/430 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS----LLPNKHWFEMQ 144
           GK+ L++ + +WL           +A  +      +   V+  L      +  K    + 
Sbjct: 92  GKSWLSSRIAVWLA---DHNRRCYVAGGKKDTTDIIMQHVTDTLQTVDESIARKLLEPVD 148

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
            L           +  S G   +  S        +  +  +G    Y    I DE++   
Sbjct: 149 KLERLQTGLSKRKISFSGGGSIEGISLGEHFKGNKSGNQAIGRGGDY----IIDESAFVS 204

Query: 205 DVIN--LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRTVEG 260
           +     LG   F      N      SNP    G+FY+   +            D RT   
Sbjct: 205 NETYAELGRRNFANVDGKNYLSFEISNP-HNKGRFYDKLTQENIPKGMLVVWADVRTAFE 263

Query: 261 IDP-SFHEGIIARYGLDSDVTRVE------VCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            D     E +I      S+  + +         + P ++ D        EE        +
Sbjct: 264 EDRVKSIEQVI-----SSEFFQNKSTCQRYFLCELPDENEDGMFGTPQTEE-----EHTE 313

Query: 314 PYAPLIMGCDIAEEGGDN-----TVVVLRRGPVIEHLFDWSK---TDLRTTNNKISGL-- 363
                 +G D A +G D      + +  +    +    +  K    D  T+   I+ L  
Sbjct: 314 KNWEYFLGVDSAYKGKDKIKATLSALDAQGQVHVIDTIEIEKGDWQDGVTSKKIITQLLM 373

Query: 364 -VEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAV---------DLEFCRN 411
            +E +    + +D    G    + L  +   + ++ +                  ++  N
Sbjct: 374 IIEHFEVKGVCVDV-GYGVYIVEGLAHINGDFELHGINFGAGTTKERVEKKHYSAKYGAN 432

Query: 412 RRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSFIVPNTGELAIESK---RVKGAKS 465
           +R E+H+ + + ++  ++     + +   +   L S  + + G+ AI  K   + K   S
Sbjct: 433 KRAEMHIDLQENIDNRNIFFTEKVYEEVIDELVLVSSKIKSNGKTAIVPKEEIKAKLGHS 492

Query: 466 TDYSDGLMYT 475
            D  D ++ +
Sbjct: 493 PDTLDSVLLS 502


>gi|255975409|ref|ZP_05425995.1| predicted protein [Enterococcus faecalis T2]
 gi|255968281|gb|EET98903.1| predicted protein [Enterococcus faecalis T2]
          Length = 519

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 67/430 (15%), Positives = 137/430 (31%), Gaps = 62/430 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS----LLPNKHWFEMQ 144
           GK+ L++ + +WL           +A  +      +   V+  L      +  K    + 
Sbjct: 92  GKSWLSSRIAVWLA---DHNRRCYVAGGKKDTTDIIMQHVTDTLQTVDESIARKLLEPVD 148

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
            L           +  S G   +  S        +  +  +G    Y    I DE++   
Sbjct: 149 KLERLQTGLSKRKISFSGGGSIEGISLGEHFKGNKSGNQAIGRGGDY----IIDESAFVS 204

Query: 205 DVIN--LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRTVEG 260
           +     LG   F      N      SNP    G+FY+   +            D RT   
Sbjct: 205 NETYAELGRRNFANVDGKNYLSFEISNP-HNKGRFYDKLTQENIPKGMLVVWADVRTAFE 263

Query: 261 IDP-SFHEGIIARYGLDSDVTRVE------VCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            D     E +I      S+  + +         + P ++ D        EE        +
Sbjct: 264 EDRVKSIEQVI-----SSEFFQNKSTCQRYFLCELPDENEDGMFGTPQTEE-----EHTE 313

Query: 314 PYAPLIMGCDIAEEGGDN-----TVVVLRRGPVIEHLFDWSK---TDLRTTNNKISGL-- 363
                 +G D A +G D      + +  +    +    +  K    D  T+   I+ L  
Sbjct: 314 KNWEYFLGVDSAYKGKDKIKATLSALDAQGQVHVIDTIEIEKGNWQDGVTSKKIITQLLM 373

Query: 364 -VEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAV---------DLEFCRN 411
            +E +    + +D    G    + L  +   + ++ +                  ++  N
Sbjct: 374 IIEHFEVKGVCVDV-GYGVYIVEGLAHINGDFELHGINFGAGTTKERVEKNHYSAKYGAN 432

Query: 412 RRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSFIVPNTGELAIESK---RVKGAKS 465
           +R E+H+ + + ++  ++     + +   +   L S  + + G+ AI  K   + K   S
Sbjct: 433 KRAEMHIDLQENIDNRNIFFTEKVYEEVIDELVLVSSKIKSNGKTAIVPKEEIKAKLGHS 492

Query: 466 TDYSDGLMYT 475
            D  D ++ +
Sbjct: 493 PDTLDSVLLS 502


>gi|29376621|ref|NP_815775.1| hypothetical protein EF2112 [Enterococcus faecalis V583]
 gi|257090386|ref|ZP_05584747.1| predicted protein [Enterococcus faecalis CH188]
 gi|307276045|ref|ZP_07557178.1| hypothetical protein HMPREF9521_01673 [Enterococcus faecalis
           TX2134]
 gi|29344085|gb|AAO81845.1| hypothetical protein EF_2112 [Enterococcus faecalis V583]
 gi|256999198|gb|EEU85718.1| predicted protein [Enterococcus faecalis CH188]
 gi|306507375|gb|EFM76512.1| hypothetical protein HMPREF9521_01673 [Enterococcus faecalis
           TX2134]
          Length = 519

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 67/430 (15%), Positives = 137/430 (31%), Gaps = 62/430 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS----LLPNKHWFEMQ 144
           GK+ L++ + +WL           +A  +      +   V+  L      +  K    + 
Sbjct: 92  GKSWLSSRIAVWLA---DHNRRCYVAGGKKDTTDIIMQHVTDTLQTVDESIARKLLEPVD 148

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
            L           +  S G   +  S        +  +  +G    Y    I DE++   
Sbjct: 149 KLERLQTGLSKRKISFSGGGSIEGISLGEHFKGNKSGNQAIGRGGDY----IIDESAFVS 204

Query: 205 DVIN--LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRTVEG 260
           +     LG   F      N      SNP    G+FY+   +            D RT   
Sbjct: 205 NETYAELGRRNFANVDGKNYLSFEISNP-HNKGRFYDKLTQENIPKGMLVVWADVRTAFE 263

Query: 261 IDP-SFHEGIIARYGLDSDVTRVE------VCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            D     E +I      S+  + +         + P ++ D        EE        +
Sbjct: 264 EDRVKSIEQVI-----SSEFFQNKSTCQRYFLCELPDENEDGMFGTPQTEE-----EHTE 313

Query: 314 PYAPLIMGCDIAEEGGDN-----TVVVLRRGPVIEHLFDWSK---TDLRTTNNKISGL-- 363
                 +G D A +G D      + +  +    +    +  K    D  T+   I+ L  
Sbjct: 314 KNWEYFLGVDSAYKGKDKIKATLSALDAQGQVHVIDTIEIEKGDWQDGVTSKKIITQLLM 373

Query: 364 -VEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAV---------DLEFCRN 411
            +E +    + +D    G    + L  +   + ++ +                  ++  N
Sbjct: 374 IIEHFEVKGVCVDV-GYGVYIVEGLAHINGDFELHGINFGAGTTKERVEKNHYSAKYGAN 432

Query: 412 RRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSFIVPNTGELAIESK---RVKGAKS 465
           +R E+H+ + + ++  ++     + +   +   L S  + + G+ AI  K   + K   S
Sbjct: 433 KRAEMHIDLQENIDNRNIFFTEKVYEEVIDELVLVSSKIKSNGKTAIVPKEEIKAKLGHS 492

Query: 466 TDYSDGLMYT 475
            D  D ++ +
Sbjct: 493 PDTLDSVLLS 502


>gi|315575102|gb|EFU87293.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315582529|gb|EFU94720.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
          Length = 407

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/320 (16%), Positives = 106/320 (33%), Gaps = 51/320 (15%)

Query: 195 IINDEASGTPDVIN--LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKR 250
            I DE++   +     LG   F      N      SNP    G+FY+   +         
Sbjct: 83  YIIDESAFVSNETYAELGRRNFANVDGKNYLSFEISNP-HNKGRFYDKLTQENIPKGMLV 141

Query: 251 FQIDTRTVEGIDP-SFHEGIIARYGLDSDVTRVE------VCGQFPQQDIDSFIPLNIIE 303
              D RT    D     E +I      S+  + +         + P ++ D        E
Sbjct: 142 VWADVRTAFEEDRVKSIEQVI-----SSEFFQNKSTCQRYFLCELPDENEDGMFGTPQTE 196

Query: 304 EALNREPCPDPYAPLIMGCDIAEEGGDN-----TVVVLRRGPVIEHLFDWSK---TDLRT 355
           E        +      +G D A +G D      + +  +    +    +  K    D  T
Sbjct: 197 E-----EHTEKNWEYFLGVDSAYKGKDKIKATLSALDAQGQVHVIDTIEIEKGDWQDGVT 251

Query: 356 TNNKISGL---VEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAV------ 404
           +   I+ L   +E +    + +D    G    + L  +   + ++ +             
Sbjct: 252 SKKIITQLLMIIEHFEVKGVCVDV-GYGVYIVEGLAHINGDFELHGINFGAGTTKERVEK 310

Query: 405 ---DLEFCRNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSFIVPNTGELAIESK 458
                ++  N+R E+H+ + + ++  ++     + +   +   L S  + + G+ AI  K
Sbjct: 311 NHYSAKYGANKRAEMHIDLQENIDNRNIFFTEKVYEEVIDELVLVSSKIKSNGKTAIVPK 370

Query: 459 ---RVKGAKSTDYSDGLMYT 475
              + K   S D  D ++ +
Sbjct: 371 EEIKAKLGHSPDTLDSVLLS 390


>gi|315034678|gb|EFT46610.1| conserved hypothetical protein [Enterococcus faecalis TX0027]
          Length = 519

 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 68/431 (15%), Positives = 138/431 (32%), Gaps = 64/431 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS----LLPNKHWFEMQ 144
           GK+ L++ + +WL           +A  +      +   V+  L      +  K    + 
Sbjct: 92  GKSWLSSRIAVWLA---DHNRRCYVAGGKKDTTDIIMQHVTDTLQTVDESIARKLLEPVD 148

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
            L           +  S G   +  S        +  +  +G    Y    I DE++   
Sbjct: 149 KLERLQTGLSKRKISFSGGGSIEGISLGEHFKGNKSGNQAIGRGGDY----IIDESAFVS 204

Query: 205 DVIN--LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRTVEG 260
           +     LG   F      N      SNP    G+FY+   +            D RT   
Sbjct: 205 NETYAELGRRNFANVDGKNYLSFEISNP-HNKGRFYDKLTQENIPKGMLVVWADVRTAFE 263

Query: 261 IDP-SFHEGIIARYGLDSDVTRVE------VCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            D     E +I      S+  + +         + P ++ D        EE        +
Sbjct: 264 EDRVKSIEQVI-----SSEFFQNKSTCQRYFLCELPDENEDGMFGTPQTEE-----EHTE 313

Query: 314 PYAPLIMGCDIAEEGGDN-----TVVVLRRGPVIEHLFDWSK---TDLRTTNNKISGL-- 363
                 +G D A +G D      + +  +    +    +  K    D  T+   I+ L  
Sbjct: 314 KDWEYFLGVDSAYKGKDKIKATLSALDAQGQVHVIDTIEIEKGDWQDGVTSKKIITQLLM 373

Query: 364 -VEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAV---------DLEFCRN 411
            +E +    + +D    G    + L  +   + ++ +                  ++  N
Sbjct: 374 IIEHFDVKGVCVDV-GYGVYIVEGLAHINGDFELHGINFGAGTTKERVEKNHYSAKYGAN 432

Query: 412 RRTELHVKMADWLEFASLI----NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
           +R E+H+ + + ++  ++      +  +I  L  + S  + + G+ AI  K   + K   
Sbjct: 433 KRAEMHIDLQENIDNRNIFFTEKVYEEVIDELVLISS-KIKSNGKTAIVPKEEIKAKLGH 491

Query: 465 STDYSDGLMYT 475
           S D  D ++ +
Sbjct: 492 SPDTLDSVLLS 502


>gi|53793591|ref|YP_112491.1| terminase large subunit [Flavobacterium phage 11b]
 gi|53748181|emb|CAH56642.1| terminase large subunit [Flavobacterium phage 11b]
          Length = 432

 Score = 83.2 bits (204), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 52/314 (16%), Positives = 114/314 (36%), Gaps = 38/314 (12%)

Query: 196 INDEASGTPDVINLGILG----FLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD----- 246
             DE +         +       L +       + T NP +    + + + K  +     
Sbjct: 126 FIDECNQITYKAWQIVKSRIRYKLNQYGIEPKMLGTCNPAKNW-VYAQFYLKDKNGTLDN 184

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS-FIPLNIIEEA 305
           D K  Q        +  S+   +++   LD +  +    G +   +  +  I    I+  
Sbjct: 185 DKKFIQALPTDNPHLPASYLTSLLS---LDENSKQRLYYGNWEYDNDPAKLIDYEKIQNC 241

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
                 P  +  + +  DIA  G D  V+ +  G  +  +F  +K+ +      + GL  
Sbjct: 242 FTNTFIP--FGEMYISADIARFGSDKMVICVWSGFRVVEIFSMAKSSITEIAEAVRGLSI 299

Query: 366 KYRP--DAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE----FCRNRRTELHVK 419
           K++     +I D +           +        +   RA++++      +N +T+ + K
Sbjct: 300 KHKVPLSNVICDED-----GVGGGVVDVLGCTGFINNSRAMEVDNQVVQYQNLKTQCYYK 354

Query: 420 MAD-------WLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
           +A+       ++       +  + + L+ +K   + + G+L + SK   +    +S DYS
Sbjct: 355 LAEVIQSNNLYIHSEDATVNDEITKELEQVKRDKIDSDGKLQLISKDKVKQAIGRSPDYS 414

Query: 470 DGLMY-TFAENPPR 482
           D LM   + E  P+
Sbjct: 415 DALMMRMYFEFKPK 428


>gi|312126991|ref|YP_003991865.1| hypothetical protein Calhy_0759 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777010|gb|ADQ06496.1| conserved hypothetical protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 444

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 57/335 (17%), Positives = 108/335 (32%), Gaps = 39/335 (11%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           AGR  GK+T+    V+   +T+        A S  Q K   + E  +      N    + 
Sbjct: 54  AGRRFGKSTVTLIDVVHECATKTKQVWYITAPSIDQAK-IYFQEFEQ---RAANNSLLDA 109

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                  +P+    L     I  +         +        G        +   EA+  
Sbjct: 110 LVKDFKWSPFPEITLINGSKILGRS--------TSRNGVYLRGKGADG---VAITEAAFI 158

Query: 204 PDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTV 258
            D +    I   + +RN       T N        Y++F + L+D    +K F       
Sbjct: 159 KDKVYHDVIRAMVLDRNGVLRLETTPN---GMNYVYKLFQEGLNDSTGYYKSFHATVYDN 215

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI----PLNIIEEALNREPCPDP 314
           E +D    E I     +     R+E   +F +   DSFI     L  + +    +  P  
Sbjct: 216 ERLDREELERIRRE--IPELAWRIEYLAEFVE--DDSFIFPWNLLCEVFDDYELKKEPQN 271

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR---TTNNKISGLVEKYRPDA 371
                +G D+A+      ++VL        + ++ +   R        ++ L  KY    
Sbjct: 272 GHRYSIGVDLAKYQDYTVIIVLDITREPYQIVEYHRYQGRLYTDVVAHVNELQAKY-NAR 330

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
           + +DA   G    + +     +    +  +++ + 
Sbjct: 331 VYLDATGVGDPIAEQVR----NCEPFVFSEKSRNK 361


>gi|333010190|gb|EGK29625.1| phage terminase large subunit domain protein [Shigella flexneri
           K-272]
 gi|333021147|gb|EGK40404.1| phage terminase large subunit domain protein [Shigella flexneri
           K-227]
          Length = 235

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 63/223 (28%), Gaps = 47/223 (21%)

Query: 308 REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVE 365
           +    +P     +G D+A+ G D    V R G V+    +W   + +L  +  +      
Sbjct: 5   KTLNFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAAL 64

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLG------------YHVYRVLGQ----------KRA 403
           +   D I+ D+   GA        +              +  R                 
Sbjct: 65  EREAD-IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGI 123

Query: 404 VDLEFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKS 444
            + +F  N + +    +AD        +          LI                +   
Sbjct: 124 PNKDFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPH 183

Query: 445 FIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
                 G + +ESK+    +   S + +D  +  FA      D
Sbjct: 184 RDFDRNGRVMVESKKDLAKREIPSPNVADAFIMAFAPIDTSLD 226


>gi|48697520|ref|YP_024878.1| gp33 TerL [Burkholderia phage BcepB1A]
 gi|47717490|gb|AAT37736.1| gp33 TerL [Burkholderia phage BcepB1A]
          Length = 532

 Score = 79.4 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 52/338 (15%), Positives = 105/338 (31%), Gaps = 60/338 (17%)

Query: 196 INDEASGTPDV-INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
             DEA+   +       L   T    +      S+   L+  F E   +     K   + 
Sbjct: 203 FVDEAAHLENAQAVDTALAATTNCRID-----ISSVNGLNNPFAE--KRFSGRVKVKTMH 255

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--P 312
            R     D  +++    ++  ++ V   E+   +        IPL  I+ A++ +     
Sbjct: 256 WRDDPRKDDEWYKKQKQKF--NALVVAQEIDIDYSASAEGVLIPLEWIDAAIDADVKLGL 313

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR---TTNNKISGLVEKYRP 369
                     D+A+EG D      R G  +++   WS        TT   I  ++ +   
Sbjct: 314 TVTGQRFSSLDVADEGKDMNAFGSRLGIRMDYAESWSGKGSNIYGTTLRTIGLVIAQNGR 373

Query: 370 DAIIIDANNTGARTCDYLEMLGY--------HVYRVLGQKRAV----------------D 405
           D    D++  G       E +           +  +  +  +                 +
Sbjct: 374 DFQF-DSDGLGVGVRGDAEAINALPERKAYPKIDAIAFRGSSSVREPDKQVPGAYKGVKN 432

Query: 406 LEFCRNRRTELHVKMADWLE-------------------FASLINHSGLIQNLKSLKSFI 446
           ++F +NR+ + +  +    E                    +S I     I+       + 
Sbjct: 433 VDFFQNRKAQEYWALRMRFEATYRAVVEKLEYDPDEIISISSRIPDLQKIRMELHQPLYK 492

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              TG++ I+ K   G  S +Y+D  M  +A    +  
Sbjct: 493 PSTTGKIMIQ-KTPDGMVSPNYADMTMMLYAPQQTKRG 529


>gi|269941618|emb|CBI50024.1| phage protein [Staphylococcus aureus subsp. aureus TW20]
          Length = 599

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 82/446 (18%), Positives = 132/446 (29%), Gaps = 100/446 (22%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           A RG+GKT L+A   L      PG  +I  A +++Q    L             K   E+
Sbjct: 82  ASRGLGKTFLSAVYCLTRCILYPGTKIIITAPTKSQGINVL------------EKIENEL 129

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            S  +H      +  +    I   + S +    S    D   GH       ++ DE    
Sbjct: 130 LSPLIHREIESINTGNQKPMIAFHNGSWIRVVASN---DNARGHRAN---LLLVDEFVKV 183

Query: 204 P-DVINLGILGFLTERNANRFW---------------IMTSNPRRLSGKFYEIFN----- 242
             D+I+      LT +    F                +  S+    S   Y+        
Sbjct: 184 DEDLIDTVFKKMLTSQREPAFLHKAKYKNYPREENTQMYLSSAWMKSHWAYDSMRSFTKQ 243

Query: 243 ----KPLDDWKRF--QIDTRTVEGIDPSFHEGIIAR-------------------YGLDS 277
               K  DD K F   I   T        H+ + A                    +G   
Sbjct: 244 MLKKKSEDDLKSFVCHIPYYTGVMEKLYSHKQMKAEAQAEGFNKMKFAMEMEAVWWGETE 303

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGG---DNTVV 334
                     F ++   +F P  ++ +A    P  +P    ++  D+A  GG   D +V 
Sbjct: 304 SAFFNFNTIDFNRKLSQAFYPKEVLVQADINNPIKEPKEKRLLAVDVARMGGNSNDASVF 363

Query: 335 VLRR---------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
            L R            + ++ D    D +T   +I  L + +  D I++D  N GA   D
Sbjct: 364 SLIRLLPKGKQQYERQLNYMEDMEGIDFQTQAIRIRQLYDDFDCDYIVLDLKNVGAGILD 423

Query: 386 YLE------MLGYHVYRVLG------QKRAVDLEF--------CRNRR-TELHVKMADWL 424
            L         G     +               E           N R  E+   +AD  
Sbjct: 424 NLRIPLTDIDRGVEYEPLNVSNDDDLASTCKYPEAPRVIHVINATNERNMEMANLLADNF 483

Query: 425 EFASLINHSGLIQNLKSLKSFIVPNT 450
                     LI+  ++ + F     
Sbjct: 484 MRGKF---RLLIREEQAEELFRQDKK 506


>gi|57867562|ref|YP_189190.1| prophage, terminase, ATPase subunit [Staphylococcus epidermidis
           RP62A]
 gi|57638220|gb|AAW55008.1| prophage, terminase, ATPase subunit, putative [Staphylococcus
           epidermidis RP62A phage SP-beta]
          Length = 599

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 82/446 (18%), Positives = 132/446 (29%), Gaps = 100/446 (22%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           A RG+GKT L+A   L      PG  +I  A +++Q    L             K   E+
Sbjct: 82  ASRGLGKTFLSAVYCLTRCILYPGTKIIITAPTKSQGINVL------------EKIENEL 129

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            S  +H      +  +    I   + S +    S    D   GH       ++ DE    
Sbjct: 130 LSPLIHREIESINTGNQKPMIAFHNGSWIRVVASN---DNARGHRAN---LLLVDEFVKV 183

Query: 204 P-DVINLGILGFLTERNANRFW---------------IMTSNPRRLSGKFYEIFN----- 242
             D+I+      LT +    F                +  S+    S   Y+        
Sbjct: 184 DEDLIDTVFKKMLTSQREPAFLHKAKYKNYPREENTQMYLSSAWMKSHWAYDSMRSFTRQ 243

Query: 243 ----KPLDDWKRF--QIDTRTVEGIDPSFHEGIIAR-------------------YGLDS 277
               K  DD K F   I   T        H+ + A                    +G   
Sbjct: 244 MLKKKSEDDLKSFVCHIPYYTGVMEKLYSHKQMKAEAQAEGFNKMKFAMEMEAVWWGETE 303

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGG---DNTVV 334
                     F ++   +F P  ++ +A    P  +P    ++  D+A  GG   D +V 
Sbjct: 304 SAFFNFNTIDFNRKLSQAFYPKEVLVQADINNPIKEPKEKRLLAVDVARMGGNSNDASVF 363

Query: 335 VLRR---------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
            L R            + ++ D    D +T   +I  L + +  D I++D  N GA   D
Sbjct: 364 SLIRLLPKGKQQYERQLNYMEDMEGIDFQTQAIRIRQLYDDFDCDYIVLDLKNVGAGILD 423

Query: 386 YLE------MLGYHVYRVLG------QKRAVDLEF--------CRNRR-TELHVKMADWL 424
            L         G     +               E           N R  E+   +AD  
Sbjct: 424 NLRIPLTDIDRGVEYEPLNVSNDDDLASTCKYPEAPRVIHVINATNERNMEMANLLADNF 483

Query: 425 EFASLINHSGLIQNLKSLKSFIVPNT 450
                     LI+  ++ + F     
Sbjct: 484 MRGKF---RLLIREEQAEELFRQDKK 506


>gi|326784324|ref|YP_004324722.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
 gi|310003555|gb|ADO97951.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
          Length = 549

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 66/377 (17%), Positives = 126/377 (33%), Gaps = 51/377 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +   P ++V  LAN     +  L          L   +    + L  
Sbjct: 85  GKSTIVTSYLLWYVLFNPNVNVAILANKAATAREML--------QRLQLSYENLPKWLQQ 136

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G      ST          +            I  DE +  P    
Sbjct: 137 GILQWNRGSLELENGSKIMAASTSASAVRGMSFN-----------VIFLDEFAFIPNHIA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DQFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDAERGSNEYVPTEVHWSEVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD-------- 313
           D  + E  I          RVE   +F    +D+ I  + +      EP           
Sbjct: 244 DEVWKEQTIKNTSEQQ--FRVEFECEFL-GSVDTLISPSKLRIMPYHEPMNQNRGLAVFE 300

Query: 314 ---PYAPLIMGCDIAEE-GGDNTVV-VLRRGPVIEHLFDWSKTD---LRTTNNKISGLVE 365
              P    I+  D++   G D +   V+    +   +    K +        N I  + +
Sbjct: 301 QAIPEHNYILTVDVSRGVGNDYSAFTVMDTTTIPYKMVARYKNNEIKPIVLPNIIVDVAK 360

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L VKM+
Sbjct: 361 AYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLGVKMS 420

Query: 422 DWLEFASLINHSGLIQN 438
             ++     N   LI++
Sbjct: 421 TAVKQVGCSNLKALIED 437


>gi|158337379|ref|YP_001518554.1| hypothetical protein AM1_4258 [Acaryochloris marina MBIC11017]
 gi|158307620|gb|ABW29237.1| conserved domain protein [Acaryochloris marina MBIC11017]
          Length = 476

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 71/443 (16%), Positives = 133/443 (30%), Gaps = 77/443 (17%)

Query: 38  WGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWL 97
           W + G  L+ F     WQ + ++ ++     S +     + K     GR +G + L    
Sbjct: 41  WIKSGGSLKQFILWD-WQKDVVDWIEEPQSLSDSPKLSVIIK-----GRQLGLSQL---C 91

Query: 98  VLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDV 157
             W +                      W + S W+ ++ ++   +   L+       S  
Sbjct: 92  CSWFLY-------------------KAW-QNSAWVGVIISRTQSDSSLLASRMREMASTA 131

Query: 158 LHCSLGIDSKHYSTMCRT----YSEERPDTFVGHHNTYGMAIINDEASGTPDV--INLGI 211
                  DS     +       +     D   G        I+ DEA+   ++       
Sbjct: 132 GLVDFSTDSLLKLEISGGGTLHFRSAAVDAVRGI--DSVSGILFDEAAFQTNLKLSLSAA 189

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFN-----------------KPLDDW------ 248
              +++  ++   I+ S P   SG F++  N                  P++ W      
Sbjct: 190 TPAMSQVGSDARIILCSTPNGASGHFFDTLNGFDNCVSDIERIRSGELPPVNKWQREDGN 249

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
               I  ++V G +PS+ E +     L       E      +          ++  A   
Sbjct: 250 IAIAIHWKSVYGDNPSYLEDLEKSLSLPKAQIAQEYDLSLTESSS-VVFSFAVVRAAATG 308

Query: 309 EPCPD--PYAPLIMGCDIAEEGGDN--TVVVLRRGP--VIEHLFDWSKTDLRTTNNKISG 362
           E  P         +G D A  G D   +V + + G    +  L+      L     +I  
Sbjct: 309 EYEPQFTEDELYYVGVDPAGSGADYFCSVFLKKTGETFTVSKLYRKRTGTLEVHMGRIDE 368

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
            ++   P  + ++ N  G    + LE     V                N +  L  ++  
Sbjct: 369 FIKASNPIKVTVETNGLGQFVYESLESRYGSVIERFNTT--------ANSKGALIGRLQL 420

Query: 423 WLEFASL--INHSGLIQNLKSLK 443
            LE   +     S L Q L S +
Sbjct: 421 ALERGHISYPAGSPLEQELLSFR 443


>gi|113200627|ref|YP_717790.1| terminase large subunit [Synechococcus phage syn9]
 gi|76574526|gb|ABA47091.1| terminase large subunit [Synechococcus phage syn9]
          Length = 549

 Score = 77.8 bits (190), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 57/377 (15%), Positives = 126/377 (33%), Gaps = 51/377 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L          L   +    + L  
Sbjct: 85  GKSTIVTSYLLWYVLFNANVNVAILANKAATAREML--------QRLQLSYENLPKWLQQ 136

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G      ST          +            I  DE +  P    
Sbjct: 137 GILQWNRGSLELENGSKILAASTSASAVRGMSFN-----------VIFLDEFAFVPNHVA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DQFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDAERKANEYIPTEVHWSEVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA----- 316
           D ++ E  I          RVE   +F    +D+ I  + +   +  +P  +        
Sbjct: 244 DAAWKEQTIKNTSEQQ--FRVEFECEFL-GSVDTLISPSKLRTMVYGDPIAEKNGLSMYE 300

Query: 317 ------PLIMGCDIAEE--GGDNTVVVLRRGPVIEHLFDWSKTDLRT---TNNKISGLVE 365
                   ++  D++    G  +  +V+    +   L    + +        N I  +  
Sbjct: 301 KTIQGHTYVITADVSRGVSGDYSAFLVIDTTTIPYKLVAKYRNNDIKPILFPNIIVDVAR 360

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    ++++ N+ G +  D     LE     +  + G+      +    ++T++ +KM+
Sbjct: 361 NYNHAFVLVEVNDVGGQVADIIQYDLEYDNLLMCAMRGRAGQQLGQGFSGKKTQMGIKMS 420

Query: 422 DWLEFASLINHSGLIQN 438
              +     N   L+++
Sbjct: 421 SATKQVGCSNLKALLED 437


>gi|262276634|ref|ZP_06054439.1| P-loop protein [alpha proteobacterium HIMB114]
 gi|262225214|gb|EEY75661.1| P-loop protein [alpha proteobacterium HIMB114]
          Length = 409

 Score = 77.5 bits (189), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 46/302 (15%), Positives = 102/302 (33%), Gaps = 32/302 (10%)

Query: 78  FKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN 137
           F+  I+ GR  GKT L    +L          +  ++ +    K  +W ++ K       
Sbjct: 17  FRVLIT-GRRFGKTHLCLVEILRQARHCDNGKIFYVSPTYRMSKEIMWKQIKKL------ 69

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                     +    W   +    L I   +   +    +++  D   G        ++ 
Sbjct: 70  ----------VKELRWDKYINETELTIVLVNNCQISLKGADKSADNLRGV---GLNFLVL 116

Query: 198 DEASGTPDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL---DDWKRFQI 253
           DE +  P+      +   ++++ AN   +    P+      Y++F +      +WK ++ 
Sbjct: 117 DEFADIPEEAWTEVLRPTISDKYANGKVLFVGTPKGYGNWSYDMFQRGQAGDPEWKSWKY 176

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            T     ++P   E   A+  LD+   R E    F        +  N       +    D
Sbjct: 177 TTIEGGQVEPHEIEQ--AKKDLDARSFRQEYEASFETYA--GVVYYNFDRAKNVKPVPYD 232

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI 372
             A + +G D   +     +  +++G            ++ +   ++I+    +Y P  +
Sbjct: 233 QNAVIHIGMDFNIDPMSACLFYVKQGISYFFKEIVIYSSNTQEMIDEIT---RQYDPKRV 289

Query: 373 II 374
           I+
Sbjct: 290 IV 291


>gi|61806303|ref|YP_214662.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
 gi|61563847|gb|AAX46902.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
          Length = 550

 Score = 77.1 bits (188), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 57/376 (15%), Positives = 123/376 (32%), Gaps = 49/376 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L          L   +    + +  
Sbjct: 86  GKSTIVTAYLLWYVLFNANVNVAILANKAPTAREML--------GRLQLSYENLPKWMQQ 137

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN 208
               W    L    G      ST          +            I  DE +  P+ I 
Sbjct: 138 GILGWNKGSLELENGSKILASSTSASAVRGMSFN-----------IIFLDEFAFVPNHIA 186

Query: 209 LGILGFL---TERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGID 262
                 +        +   I+ S P  ++ +FY++++   +  +++   ++    V G D
Sbjct: 187 EQFFASVYPTISSGKSTKVIIISTPHGMN-QFYKLWHDAERGANNYVATEVHWSQVPGRD 245

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--------- 313
             + +  I          RVE   +F    +D+ I  + +     ++P  +         
Sbjct: 246 DKWKQQTIEN--TSEAQFRVEFECEFL-GSVDTLITPSKLRIMPYKDPIQENRGLAVYEH 302

Query: 314 --PYAPLIMGCDIAEE-GGDNTVVVLRRGPVIEHLFDWSKTDL----RTTNNKISGLVEK 366
                  I+  D++   G D +   +     + +       +         N I  +   
Sbjct: 303 VQENHNYIITVDVSRGVGNDYSAFCVIDTTTVPYKVVARYKNNQIKPLVFPNLIVDVATN 362

Query: 367 YRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
           Y    ++ + N+ G +  D     LE     +  + G+      +    ++T+L +KM+ 
Sbjct: 363 YNGAYVLCEVNDIGGQVADIIQYDLEYENLLMVSMRGRAGQQLGQGFSGKKTQLGIKMST 422

Query: 423 WLEFASLINHSGLIQN 438
            ++     N   LI++
Sbjct: 423 AVKQVGCSNLKALIED 438


>gi|326782611|ref|YP_004323017.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
 gi|310002825|gb|ADO97224.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
          Length = 549

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 60/377 (15%), Positives = 123/377 (32%), Gaps = 51/377 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L          L   +    + L  
Sbjct: 85  GKSTIVTSYLLWYVLFNDNVNVAILANKAATAREML--------QRLQLSYENLPKWLQQ 136

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G      ST          +            I  DE +  P    
Sbjct: 137 GILQWNRGSLELENGSKIMAASTSASAVRGMSFN-----------VIFLDEFAFIPNHIA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DQFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDAERGTNEYIPTEVHWSEVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE---------EALNREPCP 312
           D  + E  I          RVE   +F    +D+ I  + +          E        
Sbjct: 244 DDVWKEQTIKNTSEQQ--FRVEFECEFL-GSVDTLISPSKLRIMPYHDPMKENRGLAIFE 300

Query: 313 D--PYAPLIMGCDIAEE-GGDNTVVV-LRRGPVIEHLFDWSKTD---LRTTNNKISGLVE 365
              P    ++  D++   G D +    +    +   +    + +        N +  + +
Sbjct: 301 QSIPDHNYVITVDVSRGVGNDYSAFCVMDTTTIPYKMVARYRNNEIKPIILPNIVVDVAK 360

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L VKM+
Sbjct: 361 NYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLGVKMS 420

Query: 422 DWLEFASLINHSGLIQN 438
             ++     N   LI++
Sbjct: 421 TAVKQVGCSNLKALIED 437


>gi|170023468|ref|YP_001719973.1| hypothetical protein YPK_1222 [Yersinia pseudotuberculosis YPIII]
 gi|169750002|gb|ACA67520.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 534

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 54/402 (13%), Positives = 122/402 (30%), Gaps = 65/402 (16%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F     +     W +      + I+     ++ +  + +             
Sbjct: 143 ALFWKARKFIETLPAEFRGSWDNKKHAPYMRIEFPDSGSIIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DE++     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TMYFVDESAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHGGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
              R+    D ++          +  +   E+   +        IP   ++ A+    + 
Sbjct: 252 FHWRSDPRKDDAW-YKKECEKIDNPVIVAQELDLNYNAAAEGILIPSEWVQAAIGAHTKL 310

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYR 368
              P    I   D+A+EG D      R G +++ L  WS   +D+  T      L ++  
Sbjct: 311 GITPSGARIGALDVADEGIDLNAFSSRTGVLLDRLKAWSGKGSDIYATTQDAMILSDEND 370

Query: 369 PDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKR---------------- 402
            D ++ D++  GA       ++             +    G                   
Sbjct: 371 CDYLLYDSDGLGAGCRGDGRVINETRQKAGQRQVEIKPFRGSGEVIYPDKPVFKADTKRD 430

Query: 403 -AVDLEFCRNRRTELHVKMADWLEFA--------------------SLINHSGLIQNLKS 441
              + ++  NR+ +    +    +                      +L     LI  L S
Sbjct: 431 ARTNKDYFANRKAQGWWALRMRFQEVYRAVVKGMPFDPDEIISIDENLPEKEKLIAEL-S 489

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRS 483
             ++ +   G++ ++ K   G +S +++D +M  +A    R 
Sbjct: 490 QPTYTINGAGKVTVD-KAPSGTRSPNHADTVMICYAPEKIRR 530


>gi|326783331|ref|YP_004323723.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
 gi|310005278|gb|ADO99667.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
          Length = 549

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 64/393 (16%), Positives = 127/393 (32%), Gaps = 64/393 (16%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +   P ++V  LAN     +  L          L   +    + L  
Sbjct: 85  GKSTIVTAYLLWYVLFNPNVNVAILANKAATAREML--------GRLQLSYENLPKWLQQ 136

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G      ST          +            I  DE +  P    
Sbjct: 137 GILQWNRGSLELENGSKILAASTSASAVRGMSFN-----------VIFLDEFAFVPNHIA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DQFFSSVYPTVSS-GKSTKVIIISTPHGMN-MFYKLWHDAEQGKNEYLPTEVHWSQVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA-----------LNREP 310
           D ++ E  I          +VE   +F    +D+ I  + +              L    
Sbjct: 244 DAAWKEQTIKNTSEQQ--FKVEFECEFL-GSVDTLISPSKLRTMPYVDPVAQNKGLAIYE 300

Query: 311 CPDPYAPLIMGCDIAEE-GGDNTV-VVLRRGPVIEHLFDWSKTD---LRTTNNKISGLVE 365
             +     I+  D++   G D +  VV+    +   +    + +        N I  + +
Sbjct: 301 RVEAEHNYIITVDVSRGIGNDYSAFVVVDTTTMPYKVVARYRNNEIKPIIFPNIIIDVAK 360

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L VKM+
Sbjct: 361 NYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLGVKMS 420

Query: 422 DWLEFAS-------------LINHSGLIQNLKS 441
             ++                LI     I  L +
Sbjct: 421 SAVKQVGCSNLKALIEEDKLLIPDYETIAELTT 453


>gi|294508906|ref|YP_003566117.1| hypothetical protein PSR_11004 [Salinibacter ruber M8]
 gi|294342043|emb|CBH22709.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 255

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 50/261 (19%), Positives = 79/261 (30%), Gaps = 40/261 (15%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
            P  WQ   +           ++    +   A  +    GKTT +A L L          
Sbjct: 7   DPDPWQEALL----------TSDWERALLNCARQS----GKTTASAALALETALEATDSL 52

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           V+ LA +  Q K  L   V             + QS           + + S  I     
Sbjct: 53  VLILAPARRQSKEFL-RSVRSLYRDAAPDGGLDKQS------ELRLRLENESRIIALPGK 105

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
               R Y+ +               +I DEA+  PD   +     L        ++  S 
Sbjct: 106 EGTVRGYTAD--------------LVIADEAARVPDAAYVATRPMLAVTGGR--FVGLST 149

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P    G FYE +  P  +W++ ++  +    +  +F E      G      R E   +F 
Sbjct: 150 PAGQRGWFYEAWTDPGQEWEQVKVTGQDCPRMTEAFLEQERREMG--DWQFRSEYMCEFT 207

Query: 290 QQDIDSFIPLNIIEEALNREP 310
               D       IE +L  E 
Sbjct: 208 D-TEDQLFATEHIESSLTSEV 227


>gi|323186590|gb|EFZ71927.1| gp33 TerL protein [Escherichia coli 1357]
          Length = 503

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 50/369 (13%), Positives = 105/369 (28%), Gaps = 58/369 (15%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMNNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC- 311
              R+    D  +          +  +   E+   +        IP   ++ A++     
Sbjct: 252 FHWRSDPRKDDEW-YHKECEKIDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIRL 310

Query: 312 -PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNNKISGLVEKYR 368
              P    +   D+A+EG D     LR G ++  + +WS   +D+  +  K+ GL + + 
Sbjct: 311 GIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKGSDIYDSVVKVFGLCDDFG 370

Query: 369 PDAIIIDANNTGART------CDYLEM---------------------LGYHVYRVLGQK 401
            D    D +  GA         + L                           V    G+ 
Sbjct: 371 ADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGSGSVFHPENEAVPGDNGKP 430

Query: 402 RAVDLEFCRNRRTELHVKMADWLE-----FASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
             ++ +F  N + +    +             +      I ++ S     + N   L +E
Sbjct: 431 ARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIISISST----MENKDRLLME 486

Query: 457 ------SKR 459
                 SK+
Sbjct: 487 LSQPTWSKK 495


>gi|326782863|ref|YP_004323261.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
 gi|310004122|gb|ADO98516.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
          Length = 547

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 62/377 (16%), Positives = 120/377 (31%), Gaps = 51/377 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L          L   +      +  
Sbjct: 83  GKSTIVTAYLLWYVLFNANVNVAILANKAATAREML--------QRLQLSYENLPNWMQQ 134

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G      ST          +            I  DE +  P    
Sbjct: 135 GILQWNRGSLELENGSKIMAASTSASAVRGMSFN-----------VIFLDEFAFIPNHIA 183

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 184 DQFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDAERGTNEYVPTEVHWSEVPGR 241

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE-----------EALNREP 310
           D  + E  I          RVE   +F    +D+ I  + +              L    
Sbjct: 242 DDVWKEQTIKNTSESQ--FRVEFECEFL-GSVDTLIAPSKLRIMPYHDPITSNRGLAVYE 298

Query: 311 CPDPYAPLIMGCDIAEE-GGDNTVVV-LRRGPVIEHLFDWSKTD---LRTTNNKISGLVE 365
              P    I+  D++   G D +    +    +   +    K +        N I  + +
Sbjct: 299 QVIPEHNYIITVDVSRGVGNDYSAFCVIDTTTIPYKMVARYKNNEIKPIVLPNIIVDIAK 358

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L VKM+
Sbjct: 359 NYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLGVKMS 418

Query: 422 DWLEFASLINHSGLIQN 438
              +     N   LI+ 
Sbjct: 419 TATKQVGCSNLKALIEE 435


>gi|326783550|ref|YP_004323947.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
 gi|310005053|gb|ADO99443.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
          Length = 549

 Score = 74.8 bits (182), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 64/377 (16%), Positives = 126/377 (33%), Gaps = 51/377 (13%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L          L   +    + L  
Sbjct: 85  GKSTIVTSYLLWYVLFNQNVNVAILANKAATSREML--------QRLQLSYENLPKWLQQ 136

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G           + S  R  +F          I  DE +  P    
Sbjct: 137 GILQWNRGSLELENGSKI---MAASTSSSAVRGMSFN--------VIFLDEFAFVPNHIA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DQFFSSVYPTISS-GQSTKVIIISTPHGMN-MFYKLWHDAERSKNEYIPTEVHWSEVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---------- 311
           D  + E  IA         +VE   +F    +D+ I  + +      +P           
Sbjct: 244 DAKWKEQTIANTSEQQ--FKVEFECEFL-GSVDTLISPSKLRVMPYHDPIAQNKGLAVYK 300

Query: 312 -PDPYAPLIMGCDIAEE--GGDNTVVVLRRGPVIEHLFDWSKTD---LRTTNNKISGLVE 365
             +P    I+  D+A       +   V+    V   +    + +        N I  + +
Sbjct: 301 RAEPDHNYIITVDVARGTSNDYSAFCVMDTTTVPYEMVARYRNNEIKPIVFPNIIVDVAK 360

Query: 366 KYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L VKM+
Sbjct: 361 NYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLGVKMS 420

Query: 422 DWLEFASLINHSGLIQN 438
             ++     N   LI+ 
Sbjct: 421 TAVKQVGCSNLKALIEE 437


>gi|18138498|ref|NP_542602.1| probable terminase [Halorubrum phage HF2]
 gi|32453919|ref|NP_861683.1| hypothetical protein HalHV1gp095 [Halovirus HF1]
 gi|18000439|gb|AAL55022.1| probable terminase [Halorubrum phage HF2]
 gi|32346487|gb|AAO61393.1| hypothetical protein [Halovirus HF1]
          Length = 563

 Score = 74.8 bits (182), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 74/464 (15%), Positives = 127/464 (27%), Gaps = 82/464 (17%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
           GR IG + +    +L     +P      L+ ++ Q      + +S   +L+ N       
Sbjct: 75  GRRIGVSYIIGICILIEALLKPDTFYPILSKTKGQSN----SRISDIKTLIKNAK----- 125

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
            + +       D +    G   K Y+    +   E P             +  DE +   
Sbjct: 126 -IDIPLEKDNQDEIVLPNGSRIKAYTGDPDSARGEDPPK----------TVFIDEMAFLE 174

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE---------------------IFNK 243
           D          T    +   +  S P+  + +F +                      F  
Sbjct: 175 DQSATLDAYLPTISLGSSQMVQVSTPKAQNDEFMDANERGTPDGRNDFGILALKQPTFKN 234

Query: 244 PLDDWKRFQIDTRTVEGIDPSFHEGIIA-RYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
             +      +  + VE +   F       +   D +    E   + P  D   F  +  I
Sbjct: 235 ADEIQTDVSLFEQDVEPVRGDFDLMAAETQRASDPNGFAQEYLCR-PVSDEYRFFSMPTI 293

Query: 303 EEALNREPCPD---------PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW----- 348
           E+A+ R    D             L+MG DI     D  +VV        +L        
Sbjct: 294 EDAMGRGAADDYSYGLRRYDTPNTLVMGVDIGFNSDDTAIVVFEHEGPRRYLRYHEVVND 353

Query: 349 -----------SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYR 396
                      S+ +      +IS +        +I+D    G    D +    G     
Sbjct: 354 RVLEQAGITPSSRQNPAAVAERISQVYNGMGVSNVIMDMTGVGQGFHDEVRRRIGRGYTG 413

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
                +    +   N    LH  +  WL          L + L ++      +  +    
Sbjct: 414 FNFSAKDKVEKMMGNMNYALHNDL-VWL-----PEDDSLREQLGAIVKQQKEDWQKPKFT 467

Query: 457 SKRVKGAKSTDYSDGLMYT--FAENPPRSDMDFGRCPSYQYEGV 498
            K      + D  D L      A  PP    D  R    Q E V
Sbjct: 468 GKE----HAPDGKDDLAMATVLAAFPPNFKSDKSRN-LQQREDV 506


>gi|326784562|ref|YP_004324947.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
 gi|310004595|gb|ADO98987.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
          Length = 550

 Score = 74.4 bits (181), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 61/378 (16%), Positives = 128/378 (33%), Gaps = 51/378 (13%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+T+    +LW +  +  ++V  LAN     +  L          L   +    + L 
Sbjct: 85  TGKSTIVTSYLLWYVLFKANVNVAILANKAATSREML--------QRLQLSYENLPKWLQ 136

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP--- 204
                W    L    G           + S  R  +F          I  DE +  P   
Sbjct: 137 QGILQWNRGSLELENGSKI---MAASTSSSAVRGMSFN--------VIFLDEFAFVPNHI 185

Query: 205 -DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEG 260
            D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G
Sbjct: 186 ADQFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDAERGKNEYIPTEVHWSAVPG 243

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--------- 311
            D ++ +  IA         +VE   +F    +D+ I  + +      +P          
Sbjct: 244 RDAAWKDQTIANTSEQQ--FKVEFECEFL-GSVDTLISPSKLRTMPYEDPIIQNRGLAVY 300

Query: 312 --PDPYAPLIMGCDIAEEGG-DNTVVVLRRGPVI--EHLFDWSKTDL--RTTNNKISGLV 364
              +     I+  D+A     D +   +     +  E +  +   D+      N I  + 
Sbjct: 301 KQVEKDHNYIVTVDVARGVSQDYSAFCIIDTTTVPYELVAKYRNNDIKPIIFPNVIVDVA 360

Query: 365 EKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           + Y    ++ + N+ G +  D     LE        + G+      +    ++T+L VKM
Sbjct: 361 KNYNNAYVLCEVNDIGGQVADIIQFDLEYENLLQVAMRGRAGQQLGQGFSGKKTQLGVKM 420

Query: 421 ADWLEFASLINHSGLIQN 438
           +  ++     N   L++ 
Sbjct: 421 STAVKAVGCSNLKALLEE 438


>gi|218296727|ref|ZP_03497433.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
 gi|218242816|gb|EED09350.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
          Length = 425

 Score = 74.4 bits (181), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 73/377 (19%), Positives = 127/377 (33%), Gaps = 46/377 (12%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+               G + + L+  E Q +    AE +K       +    M+S  
Sbjct: 28  TGKSFALTLEAALHAVEHRGSTWVLLSAGERQSREL--AEKAKAHLDAMKQVGTLMES-R 84

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD-- 205
                     L   L   S+             P T  G    Y   ++ DE +   D  
Sbjct: 85  FFEGGESVTQLEIRLPNLSRLIFLPA------NPRTARG----YTGNVVLDEFAFHQDSE 134

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE----GI 261
            I   +   +T R  +    + S P    GKF+E++ K    W R ++           +
Sbjct: 135 AIWAAMYPIIT-RRPDLKIRVMSTPNGPRGKFWELWEKGGPAWSRHKVTIYDAVAQGLPV 193

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP--LI 319
           DP      +A    D  + + E   +F   +  +F+P ++I EA  RE    P+ P    
Sbjct: 194 DPEELRAGLA----DDFIWQQEYLCEFLSAEE-AFLPWSLILEAEAREDPRGPWNPDQAY 248

Query: 320 MGCDIAEEGGDNTVVVL--RRGPV--IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIID 375
           +G D+     D TV V+  R G V  +  L    +        ++  L+ + R   +  D
Sbjct: 249 LGVDVGRH-RDLTVFVVLERVGDVYWVRLLETLHRAPFAQQEARLHALLPQVRRACL--D 305

Query: 376 ANNTGARTCDYLEM-LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF--ASLINH 432
           A   G    +      GY V  V                 +L  ++  + E     +   
Sbjct: 306 ATGLGEMLAENARRAFGYKVEPVKFTPEVK---------ADLAQRLRLFFEDRRVRIPED 356

Query: 433 SGLIQNLKSLKSFIVPN 449
             L ++L S++  + P+
Sbjct: 357 RALREDLHSVRRIVTPS 373


>gi|182682964|ref|YP_001837088.1| terminase, large subunit [Enterobacteria phage EPS7]
 gi|182630676|gb|ACB97608.1| terminase, large subunit [Enterobacteria phage EPS7]
          Length = 438

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 60/329 (18%), Positives = 115/329 (34%), Gaps = 48/329 (14%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
            +N++ +P        +S  R +GK+ + A+ + +L    P + V+ +A + + L    W
Sbjct: 45  IINALEDPRHRFVTACVS--RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGW 100

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
           +++                   +      ++  +           ++ +  S  + D+ V
Sbjct: 101 SQIR----------------GLIKKYGLQTERENAKDKEIELANGSLFKLASAAQADSAV 144

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFL--TERNANRFWIMTSNPRRLSGKFYEIF-- 241
           G        II DEA+   DV        L  T    N   +  S PR   G +++ F  
Sbjct: 145 GRSYD---FIIFDEAA-ISDVGGAAFDIQLRPTLDKPNSKALFISTPRG--GNWFKEFYE 198

Query: 242 ---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
              N+ L +W       R     D +  E   AR  +  +  R E    F   +   F  
Sbjct: 199 KGFNETLPNWVSIHGTYRDNPRADLNDIEE--ARRTVSKNYFRQEYEADFSVFEGQIFDT 256

Query: 299 LNIIE-----EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR----GPVIEHLFDWS 349
            N IE     + +      D     ++G D+     D T V+  +      V   L ++ 
Sbjct: 257 FNAIEHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAVLTIKYHYDTDVYYVLEEYQ 314

Query: 350 KTD--LRTTNNKISGLVEKYRPDAIIIDA 376
           + +         I   +++Y  D I +D+
Sbjct: 315 QAEKTTAQHATYIQHCIDRYNVDRIFVDS 343


>gi|46401884|ref|YP_006983.1| terminase, large subunit [Enterobacteria phage T5]
 gi|45775062|gb|AAS77194.1| terminase, large subunit [Enterobacteria phage T5]
 gi|59897286|gb|AAX12081.1| ORF144 [Enterobacteria phage T5]
          Length = 438

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 56/329 (17%), Positives = 113/329 (34%), Gaps = 48/329 (14%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
            +N++ +P        +S  R +GK+ + A+ + +L    P + V+ +A + + L    W
Sbjct: 45  IINALEDPRHRFVTACVS--RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGW 100

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
           +++                   +      ++  +           ++ +  S  + D+ V
Sbjct: 101 SQIR----------------GLIKKYGLQTERENAKDKEIELANGSLFKLASAAQADSAV 144

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFL--TERNANRFWIMTSNPRRLSGKFYEIF-- 241
           G        II DEA+   DV        L  T    N   +  S PR   G +++ F  
Sbjct: 145 GRSYD---FIIFDEAA-ISDVGGDAFRVQLRPTLDKPNSKALFISTPRG--GNWFKEFYA 198

Query: 242 ---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
              +  L +W       R     D +  E   AR  +  +  R E    F   +   F  
Sbjct: 199 YGFDDTLPNWVSIHGTYRDNPRADLNDIEE--ARRTVSKNYFRQEYEADFSVFEGQIFDT 256

Query: 299 LNIIE-----EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR------GPVIEHLFD 347
            N I+     + +      D     ++G D+     D T V+  +         +   + 
Sbjct: 257 FNAIDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAVLTIKYHYDTDTYYVLEEYQ 314

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDA 376
            ++         I   +++Y+ D I +D+
Sbjct: 315 QAEKTTAQHAAYIQHCIDRYKVDRIFVDS 343


>gi|326633035|ref|YP_004306624.1| terminase large subunit [Enterobacteria phage SPC35]
 gi|321272229|gb|ADW80121.1| terminase large subunit [Enterobacteria phage SPC35]
          Length = 438

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 55/329 (16%), Positives = 113/329 (34%), Gaps = 48/329 (14%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
            +N++ +P        +S  R +GK+ + A+ + +L    P + V+ +A + + L    W
Sbjct: 45  IINALEDPRHRFVTACVS--RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGW 100

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
           +++                   +      ++  +           ++ +  S  + D+ V
Sbjct: 101 SQIR----------------GLIKKYGLQTERENAKDKEIELANGSLFKLASAAQADSAV 144

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFL--TERNANRFWIMTSNPRRLSGKFYEIF-- 241
           G        II DEA+   DV        L  T    N   +  S PR   G +++ F  
Sbjct: 145 GRSYD---FIIFDEAA-ISDVGGDAFRVQLRPTLDKPNSKALFISTPRG--GNWFKEFYA 198

Query: 242 ---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
              +  L +W       R     D +  E   AR  +  +  R E    F   +   F  
Sbjct: 199 YGFDDTLPNWVSIHGTYRDNPRADLNDIEE--ARRTVSKNYFRQEYEADFSVFEGQIFDT 256

Query: 299 LNIIE-----EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR------GPVIEHLFD 347
            N I+     + +      D     ++G D+     D T V+  +         +   + 
Sbjct: 257 FNAIDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAVLTIKYHYDTDTYYVLEEYQ 314

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDA 376
            ++         I   +++Y+ D + +D+
Sbjct: 315 QAEKTTAQHAAYIQHCIDRYKVDRVFVDS 343


>gi|116624478|ref|YP_826634.1| hypothetical protein Acid_5400 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227640|gb|ABJ86349.1| hypothetical protein Acid_5400 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 260

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 82/260 (31%), Gaps = 27/260 (10%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            W    +          V +   +  +  ++  R  GK+T+ A   +       G   I 
Sbjct: 25  EWARRALGFEADAAQARVLDTRSK--RVLLNCTRQWGKSTVTAARAVHEAVKNAGSLTIA 82

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           +  +  Q  T  +  V K  +        EM+              + S  +        
Sbjct: 83  VTPTARQ--TGEF--VRKAATFAS---GLEMRVKGDGHNEMSLAFPNGSRIVGLPGTEAT 135

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
            R +S                 ++ DEAS   D + + +   L   +A   W+M S P  
Sbjct: 136 VRGFSA-------------VTLLLIDEASRVGDDLYMAMRPMLA-VSAGTLWLM-STPHG 180

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
             G FYE +    + W+R  +           + E      G    + R E C +F  + 
Sbjct: 181 KRGFFYEAWANGGETWERVSVKAEDCPRFKAEYLEEERQVMGER--IYRQEYCCEF-GET 237

Query: 293 IDSFIPLNIIEEALNREPCP 312
             +    ++IE A + E  P
Sbjct: 238 SGAVFDRDLIEAAFSDEVTP 257


>gi|114320225|ref|YP_741908.1| hypothetical protein Mlg_1066 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226619|gb|ABI56418.1| hypothetical protein Mlg_1066 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 463

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 71/473 (15%), Positives = 133/473 (28%), Gaps = 64/473 (13%)

Query: 15  LFDLMWSDEIKLS-FSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           + D+M    +    F         W      L GF        E           S    
Sbjct: 5   IRDVMTDPALFGGQFGGDT-----WAAWRALLSGFYGLPLDDAEAQHWHALTDRESAPQS 59

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK--- 130
             +     +  GR  GK+   A L ++    +     +  A            EV+    
Sbjct: 60  AHDELWLVV--GRRGGKSNAAALLAVYEACFKDHRDAL--AP----------GEVATTRV 105

Query: 131 -WLSLLPNKHWFEMQSLSLHPAPWYSDVL-----HCSLGIDSKHYSTMCRTYSEERPDTF 184
                   +  F   S  +H  P    ++           +         ++   R  TF
Sbjct: 106 MAADRAQARSVFRYISGLMHANPMLERLIVREDRESIELSNRAVIEVGTASFRTTRGYTF 165

Query: 185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
                       +D+++     I   +   L   N     I  S+P    G+ +E + + 
Sbjct: 166 AAVIADEVAFWRSDDSANPDSEIIAAVRPGLATLNGK--LIALSSPYARRGELWENYRRH 223

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIE 303
                   +       ++PS  E ++             E   +F + D+++F+   ++E
Sbjct: 224 YGKASPILVAQAPSRTMNPSLPERVVTEAMERDPASAAAEYLAEF-RTDVETFLQREVVE 282

Query: 304 EALNREPCPDPYA---PLIMGCDIAEEGGDN--TVVVLRRGPV-IEHLFDWSKTDLRTTN 357
            A    P   PY          D A  G D     +  R G   +  +    K       
Sbjct: 283 AATRPTPLELPYNKRVTYTAFVDPAGGGADEFTAAIGHREGERVVVDVLRARKGTPAEIV 342

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            + + L++ YR    I D    G+   D     G  V     Q      +  R+    ++
Sbjct: 343 AEYADLLKSYRITRAISDRY-AGSWPADEFSRHGITVE----QAAKPKSDLYRDMLASMN 397

Query: 418 VKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAK-STDYS 469
                      L     L+  L             +++E +  +G + S D++
Sbjct: 398 SAR------VELPPDDRLMTQL-------------ISLERRTARGGRDSIDHA 431


>gi|51512091|gb|AAU05290.1| terminase large subunit [Enterobacteria phage T5]
          Length = 438

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 55/329 (16%), Positives = 112/329 (34%), Gaps = 48/329 (14%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
            +N++ +P        +S  R +GK+ + A+ + +L    P + V+ +A + + L    W
Sbjct: 45  IINALEDPRHRFVTACVS--RRVGKSFI-AYTLGFLKLLEPNVKVLVVAPNYS-LANIGW 100

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
           +++                   +      ++  +           ++ +  S  + D+ V
Sbjct: 101 SQIR----------------GLIKKYGLQTERENAKDKEIELANGSLFKLASAAQADSAV 144

Query: 186 GHHNTYGMAIINDEASGTPDVINLGILGFL--TERNANRFWIMTSNPRRLSGKFYEIF-- 241
           G        II DEA+   DV        L  T    N   +  S PR   G +++ F  
Sbjct: 145 GRSYD---FIIFDEAA-ISDVGGDAFRVQLRPTLDKPNSKALFISTPRG--GNWFKEFYA 198

Query: 242 ---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
              +  L +W       R     D +  E   AR  +  +  R E    F   +   F  
Sbjct: 199 YGFDDTLPNWVSIHGTYRDNPRADLNDIEE--ARRTVSKNYFRQEYEADFSVFEGQIFDT 256

Query: 299 LNIIE-----EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR------GPVIEHLFD 347
            N  +     + +      D     ++G D+     D T V+  +         +   + 
Sbjct: 257 FNATDHVKDLKGMRHFFKDDEAFETLLGIDVGY--RDPTAVLTIKYHYDTDTYYVLEEYQ 314

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDA 376
            ++         I   +++Y+ D I +D+
Sbjct: 315 QAEKTTAQHAAYIQHCIDRYKVDRIFVDS 343


>gi|307308946|ref|ZP_07588629.1| hypothetical protein SinmeBDRAFT_4513 [Sinorhizobium meliloti
           BL225C]
 gi|306900580|gb|EFN31193.1| hypothetical protein SinmeBDRAFT_4513 [Sinorhizobium meliloti
           BL225C]
          Length = 408

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 71/202 (35%), Gaps = 24/202 (11%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN--KHWFEMQS 145
            GKT + A  V W +     + V     SE+ +K  +W+ +    + + +  K  F++ +
Sbjct: 208 WGKTYVAAIAVWWSLVCFDDVKVTIFGPSESLIKNGMWSNLQALHARMASSFKDLFDVSA 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
             +                         R  S +      G H      +  D+A G  +
Sbjct: 268 TRVSRKTAAP------------SCFAEYRLVSADNASAARGIHAVNN-FVFVDDADGVSE 314

Query: 206 VINLGILGFLTERNANRFWI--MTSN--PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI 261
           V+   ++  + + N     +  M +N  P+  +    E+FN+ L   +   +        
Sbjct: 315 VVIAYLMNIMIDPNPKLCLLSTMFANETPKLETVTEAELFNEALSSLRAM-VSGEV--RT 371

Query: 262 DPSFHEGIIARYGLDSDVTRVE 283
           DP + E I  RY L++      
Sbjct: 372 DPVWLEAI--RYQLENAEYLAR 391


>gi|331650684|ref|ZP_08351739.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331040472|gb|EGI12647.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 414

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 98/325 (30%), Gaps = 45/325 (13%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 89  ALFWKARKFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIKGEAGDNIGR-----GDRT 143

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              + DEA+     +   I   L++    R  I  S+   ++  F +   +       F 
Sbjct: 144 TLYLVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMANPFAQ--KRHGGKIPVFT 197

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
              R     D  ++     +  +D+ V    E+   +        IP   ++  ++    
Sbjct: 198 FHWRDDPRKDEEWYRRECEK--IDNPVVVAQELDLNYSASAEGVLIPSEWVQATVDAHIK 255

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKY 367
               P    +   D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+ 
Sbjct: 256 LGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQD 315

Query: 368 RPDAIIIDANNTGART------CDYLEMLGYH---------------------VYRVLGQ 400
             +    D +  GA         + L  +                        V    GQ
Sbjct: 316 NLEEFRFDEDGLGAGVRGDARAINELRNVARRPSILATPFRGSGAVFDPDDEAVRGDNGQ 375

Query: 401 KRAVDLEFCRNRRTELHVKMADWLE 425
              ++ +F  N + +   ++    +
Sbjct: 376 AARLNKDFFANAKAQSWWRLRKLFQ 400


>gi|61806000|ref|YP_214360.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|61374509|gb|AAX44506.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|265525210|gb|ACY76007.1| terminase large subunit gp17 [Prochlorococcus phage P-SSM2]
          Length = 547

 Score = 72.1 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 62/378 (16%), Positives = 124/378 (32%), Gaps = 51/378 (13%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+T     +L        ++V  LAN  +  +  L          L   +    + + 
Sbjct: 82  TGKSTTCISYLLHYAVFNDNVNVAVLANKASTARDLL--------GRLQLAYENLPRWMQ 133

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP--- 204
                W    L    G      ST          +            I  DE +  P   
Sbjct: 134 QGIISWNKGSLELENGSKISANSTSSSAVRGGSYN-----------VIFLDEFAFIPNHI 182

Query: 205 -DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEG 260
            D     +   +T    +   I+ S PR ++  FY +++   K   ++    +    V G
Sbjct: 183 ADDFFASVYPTITS-GQSTKVIIVSTPRGMN-HFYRMWHDSEKGKSEYVATDVHWSEVPG 240

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI----PLNIIEEA-------LNRE 309
            D  + E  IA         ++E   +F    +++ I      N++ EA       L+  
Sbjct: 241 RDEEWKEQTIANTSEQQ--FKIEFECEFL-GSVNTLINPAKLRNLVYEAPKTRNAGLDIY 297

Query: 310 PCPDPYAPLIMGCDIAEE-GGDNTV-VVLRRGPVIEHLFDWSKTD---LRTTNNKISGLV 364
             P      I+  D+A   G D +  +V         +    + +        N I  + 
Sbjct: 298 ETPVKEHNYIITVDVARGLGNDYSAFIVFDTTEFPYKVVAKYRNNEIKPMLFPNIILDVA 357

Query: 365 EKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           + Y    ++I+ N+ G +        LE     +  + G+   +  +    ++T+L V+M
Sbjct: 358 KGYNNAYLLIEVNDIGDQVASILQYDLEYENVLMASMRGRAGQIVGQGFSGKKTQLGVRM 417

Query: 421 ADWLEFASLINHSGLIQN 438
              ++     N   ++++
Sbjct: 418 TSAVKKLGCSNLKTMMED 435


>gi|255929035|ref|YP_003097347.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
 gi|255705321|emb|CAR63310.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
          Length = 550

 Score = 72.1 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 47/358 (13%), Positives = 103/358 (28%), Gaps = 59/358 (16%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            +Q E +     +  N    P               GK+T     +L+       +++  
Sbjct: 62  DFQKEILRDFHENRFNIAKLPRQ------------TGKSTTVVAYLLYYAIFYDSVNIGI 109

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           LAN  +  +  L          L   +    + +      W    +    G      ST 
Sbjct: 110 LANKASTARELL--------GRLQLAYENLPKWMQHGILVWNKGNVELENGSKILAASTS 161

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI----NLGILGFLTERNANRFWIMTS 228
                    +            +  DE +  P+ +       +   +T    +   I+ S
Sbjct: 162 ASAVRGMSFN-----------ILFLDEFAFVPNHVAEQFFASVYPTITS-GKSTKVIIIS 209

Query: 229 NPRRLSGKFYEIF---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
            P  ++  FY+++    +  +D+   ++    V G D  + E  I            E  
Sbjct: 210 TPNGMN-HFYKMWEDARRGKNDYVTNEVHWSQVPGRDAKWKEETIKN--TSPRQFAQEFE 266

Query: 286 GQFPQQDIDSFIPLNIIE-----------EALNREPCPDPYAPLIMGCDIAE--EGGDNT 332
             F     D+ I    ++             L+           I+  D+A    G  + 
Sbjct: 267 CDFL-GSADTLISPAKLQNIPFHDPIQSNAGLDVYERVQKDHEYIITVDVARGIGGDYSA 325

Query: 333 VVVLRRGPVIEHLFDWSKTDLRT---TNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            +V     +   +    + +        + I  + ++Y    ++++ N+ G      L
Sbjct: 326 FIVFDITTMPYKIVAKYRNNEIKPVLFPSVIFQVCKEYNNPYVLVEVNDIGDSIAATL 383


>gi|329849103|ref|ZP_08264131.1| phage terminase, large subunit, PBSX family [Asticcacaulis
           biprosthecum C19]
 gi|328844166|gb|EGF93735.1| phage terminase, large subunit, PBSX family [Asticcacaulis
           biprosthecum C19]
          Length = 430

 Score = 71.3 bits (173), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 69/435 (15%), Positives = 133/435 (30%), Gaps = 43/435 (9%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
            +E + A+   +        F+ A   GRG  K+   A   ++     PG  V+ +   +
Sbjct: 24  ILEPIPAYRFLTKKPLGSFRFRAA-YGGRGAAKSWEFANAAIYHSLNTPGARVVFVREIQ 82

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS 177
             L  + +  V   L     +  F   +   H     +++L   L             + 
Sbjct: 83  GSLADSAFTLVRNRLEAYGLEGAFRQANGRFHHVENGAEILFLGL-------------WR 129

Query: 178 EERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
             +P+             I +EAS         ++  +     +  W +  NP   +   
Sbjct: 130 GNKPEGIKSL--EGATLTIWEEASEGRQRSLDVLIPTVLRTPQSELWCLW-NPMLPTDPV 186

Query: 238 YEIFNKPLDDWKRF--QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
              F   ++  K    +++  +      +  E +      D         G +     ++
Sbjct: 187 DRFFRGDVEPQKTICRRVNWDSNPHFPEALREQMALDRKKDPLRAAWIWDGAYMPSAQNA 246

Query: 296 FIPLNIIEEAL--NREPCPDPYAPLIMGCDIAEEGGDNT--VVVLRRGPVIEHLFDWSKT 351
                +++ A    R+   +    +++G D A  GGD    VV  R G     + D    
Sbjct: 247 LWTRELLDRAWVQGRDKVMEAVGRVVVGVDPAGGGGDEVGIVVAGRYGAEGYIVLDDRSV 306

Query: 352 DLRTT---NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEF 408
             R+      ++   V+ Y  D ++++ N  G      L      V  V  + R V    
Sbjct: 307 AARSPEGWATEVLRAVDAYAADCVVVEKN-FGG----DLVASNLRVNGVHCRIREVTASR 361

Query: 409 CRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDY 468
            +  R E    + +  +         L   L       +   G            KS D 
Sbjct: 362 GKQVRAEPIAALYEQHKVYHRRPFPALEGQLL-----QMTPNGYAV-------KGKSPDR 409

Query: 469 SDGLMYTFAENPPRS 483
            D L++   E   RS
Sbjct: 410 LDALVWALTELSRRS 424


>gi|291336011|gb|ADD95601.1| large terminase protein [uncultured phage MedDCM-OCT-S09-C7]
          Length = 526

 Score = 71.3 bits (173), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 58/355 (16%), Positives = 110/355 (30%), Gaps = 47/355 (13%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           + A R  GK+  +   +LW +   P ++V  LAN                      +   
Sbjct: 80  VLASRQSGKSITSCAYLLWFLLFNPEVTVAVLANKG-----------------AIAREMI 122

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR-TYSEERPDTFVGHHNTYGMAIINDEA 200
                 L   P++       L   S  ++   +   +     +  G        +  DE 
Sbjct: 123 ARMVTMLESVPFFLQPGVKILNKGSIEFANDSKVVAAATSSSSIRGL---SINLLYLDEF 179

Query: 201 SGTPDV--INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD---WKRFQIDT 255
           +   D           +T    +   I+TS    +   FY+I+   + D   +K F I+ 
Sbjct: 180 AFVDDAETFYTATYPVVTS-GKDSKVIITSTANGVGNMFYKIYESAVHDQSEYKHFLINW 238

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP----- 310
             V G D  + +  IA     S+    +  G       ++ I  N +   +++EP     
Sbjct: 239 FDVPGRDEEWKKETIAN---TSEAQFEQEYGNSFLGTGNTLINSNTLLGLMSKEPDWNKD 295

Query: 311 ------CPDPYAPLIMGCDI--AEEGGDNTVVVLRRGPVIEHLFDWSKTDL---RTTNNK 359
                  P      I   D+        +T  ++             + ++       + 
Sbjct: 296 GVKVYEKPKEGHTYITTVDVSKGRGIDYSTFTIMDISVKPFRQVCTYRDNMISPMLFPDL 355

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYHVYRVLGQKRAVDLEFCRNRR 413
           I+   + Y    +II+ N  G      L   + Y    V G  +A D+     +R
Sbjct: 356 IAKYTKPYNESLVIIENNAEGGMVATQLHYDIEYPNVFVQGMSKAEDIGVTMTKR 410


>gi|229605025|ref|YP_002875724.1| hypothetical protein P087_gp56 [Lactococcus phage P087]
 gi|227826008|gb|ACP41732.1| hypothetical protein [Lactococcus phage P087]
          Length = 578

 Score = 71.3 bits (173), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 71/460 (15%), Positives = 137/460 (29%), Gaps = 87/460 (18%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
           G G GK+ +++   L  +    G  +   A +   L + ++ E+   ++  P       +
Sbjct: 105 GTGFGKSFVSSQCNL--VRANRGELITAFAPNRE-LNSVIFKEMVSAVNHSPKLKKVLFE 161

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP-DTFVGHHNTYGMAIINDEASGT 203
           + S   A           G+  K ++     + +        G H++  M    DE +  
Sbjct: 162 AESKEEA--------LQRGVSQKRFAFPSGGFVDLTIAKNATGVHSSSYM----DEYALL 209

Query: 204 PDVINLGILG----FLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--------DDWK-- 249
                    G    ++ +         TSNP  ++  + ++   PL         DW+  
Sbjct: 210 TKEEYNLAEGRAYAYVDKDGKPGKIFKTSNPHIMNFSYDDMIRNPLPPHEAVLWGDWRLN 269

Query: 250 ----------RFQIDTRTVEGIDPSFHEGIIARYGLD--------SDVT------RVEVC 285
                       Q+D       D          Y LD        S         R+   
Sbjct: 270 IGEGKFMELVYSQLDDEHKYLKDKFPLNREERDYLLDQAIQQVIWSPFFNDEDNLRILYL 329

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL 345
            +F      +F         ++  P     +    G D+A  G D  +  L      +  
Sbjct: 330 SEFGVNTESAFFTTT---PKIDDSPIDWDNSTFYAGNDVAIRGTDACIYALLEYNPNKSY 386

Query: 346 FDWSKTDL------------RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYH 393
                 +                   +   ++      + IDA+  G    + L      
Sbjct: 387 SRIVAFNNVKPQLWIDHETPMEMAQNVIRQLKHDNARLLAIDASGVGEGQFNLLTTDDAE 446

Query: 394 ----VYRVLGQKRAV------DLEFCRNRRTELHVKMADWLEFASLINHSG----LIQNL 439
               V  V     A       +     N+R+EL +   ++++  +L   S     L   +
Sbjct: 447 TSCPVVPVRFGDGASKWRKDKNAVRSHNKRSELFLDFKEFIDTDTLRVTSEVWEFLQAEM 506

Query: 440 KSLKSFIVPNTGELAIESK---RVK-GAKSTDYSDGLMYT 475
           +++         ++ IE K   + + G KSTDY D  M  
Sbjct: 507 QAVTKMSNDENKKIKIEPKDAIKKRLGGKSTDYLDSSMLA 546


>gi|116625333|ref|YP_827489.1| hypothetical protein Acid_6278 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228495|gb|ABJ87204.1| hypothetical protein Acid_6278 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 260

 Score = 70.9 bits (172), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 72/225 (32%), Gaps = 25/225 (11%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+T+ A   +    T+     I ++ +  Q  T  +  V K  +        +M+   
Sbjct: 58  WGKSTVTAARAVHEAVTKADSLTIAVSPTARQ--TGEF--VRKAEAFAGM---LKMKVKG 110

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
                      + S  +         R +S                 ++ DEAS   D +
Sbjct: 111 DGSNEMSLAFPNGSRIVGLPGTEATVRGFSA-------------VALLLVDEASRVEDDL 157

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
            + +   L        W+M S P    G FYE +      W+R  +           + E
Sbjct: 158 YMAMRPMLAVSG-GTLWLM-STPWGKRGFFYEAWANGGPTWERVSVKAEDCPRFGAEYLE 215

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
                 G    + R E C +F +    +    ++IE A + +  P
Sbjct: 216 EERRVMGER--IYRQEYCCEFGESSS-AVFDRDLIEAAFSDDFGP 257


>gi|86372240|gb|ABC95184.1| GP17-terminase [Stenotrophomonas phage Smp14]
          Length = 536

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 48/326 (14%), Positives = 107/326 (32%), Gaps = 48/326 (14%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GKTT+ A ++LW         +  LAN   Q +  L    ++   +     WF    + +
Sbjct: 92  GKTTVVAAILLWYAIFNEEYRIAILANKGDQSREIL----ARLQLMYEELPWF----MQV 143

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI- 207
             + W  +  +  LG  S+ ++      +     +  G        +  DE +   + + 
Sbjct: 144 GVSVW--NKGNIKLGNRSEVFT------AATGGSSIRG---KSVNLMYLDEFAFVENDVD 192

Query: 208 -NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR---TVEGIDP 263
                   +T        I+TS P  ++  FY+I+    +    +  +          D 
Sbjct: 193 FYTSTYPVVTS-GTKTKVIITSTPNGMN-LFYKIWTDSTNGKNNYVHNEAFWHDHPKRDQ 250

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC------------ 311
           ++ +  +            E   +F Q   D+ +    +E+   ++              
Sbjct: 251 AWKDEQLRNMSERQ--FEQEFLCKF-QGSSDTLLSPAKLEQLTYQDHIRELGGNRDFKIY 307

Query: 312 --PDPYAPLIMGCDIAEE-GGDNTVV-VLRRGPVIEHLFDWSKTDLR---TTNNKISGLV 364
             P   A  ++  D++E  G D +V+ V              ++++       +  + + 
Sbjct: 308 EDPIKDASYVVTVDVSEGIGKDYSVISVFDTTEAPFRQVAMLRSNIIAPLILADLANRIG 367

Query: 365 EKYRPDAIIIDANNTGARTCDYLEML 390
             Y    +I++ N+ G      L   
Sbjct: 368 HLYNQAVLIVECNSIGNTVVTALWED 393


>gi|30044056|ref|NP_835653.1| similar to terminase DNA packaging enzyme, large subunit
           [Rhodothermus phage RM378]
          Length = 508

 Score = 70.1 bits (170), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 55/335 (16%), Positives = 100/335 (29%), Gaps = 54/335 (16%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           G T       L  M       V+  AN E   K  L          +   +    + L +
Sbjct: 66  GVTWCAVAYALHQMIFNSNYKVLIAANKEATAKNVL--------ERIKFAYEQLPRFLQI 117

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD--V 206
               W     +      S   +   ++ S           +     +I +EA+   +   
Sbjct: 118 KKRTWNKT--YIEFSNYSSARAVSSKSDSGR---------SESITLLIVEEAAFISNMEE 166

Query: 207 INLGILGFLTERNANRFWIMTSNPRRLS-GKFYE----IFNKPLDDWKRFQIDTRTVEGI 261
           +   +   L             N      G +YE       +   ++K F I        
Sbjct: 167 LWASVQQTLATGGK-----CIVNSTYNGVGNWYERTIRAAKEGKSEFKYFGIKWSDHPER 221

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP---- 317
           D  + E       L   V   E+    PQ   ++ IP ++I E    +P    Y      
Sbjct: 222 DEKWFEEQKRL--LPPRVFAQEILCI-PQGSGENVIPFHLIREEEFIDPFVVKYGGDYWE 278

Query: 318 -------LIMGCDIA-EEGGDNTVVVLR------RGPVIEHLFDWS--KTDLRTTNNKIS 361
                    +  D A   G D + V ++      +   IE + +++  KT L      I 
Sbjct: 279 WYRKPGYYFISVDPASGRGEDRSAVGVQVLWVDPQTLTIEQVAEFASDKTSLPVMRQVIK 338

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
            + ++++P  I I+ N  G     ++E     +  
Sbjct: 339 QIYDEFKPQLIFIETNGIGMGLYQFMEAYTPSIVG 373


>gi|213029404|ref|ZP_03343851.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 282

 Score = 69.8 bits (169), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 70/193 (36%), Gaps = 8/193 (4%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 75  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 132

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 133 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 192

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKYR 368
              P     +G D+A+ G D    V R G VI    +W   + +L  +  +      + R
Sbjct: 193 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAME-R 251

Query: 369 PDAIIIDANNTGA 381
              I+ D+   GA
Sbjct: 252 DADIVYDSIGVGA 264


>gi|331648285|ref|ZP_08349374.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331042834|gb|EGI14975.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 219

 Score = 69.8 bits (169), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 72/205 (35%), Gaps = 51/205 (24%)

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWS--KTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
            D+A+EG D      R G ++E++ +WS   +D+  +  K+ G  E+   +    D +  
Sbjct: 1   MDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVEKVFGFCEQDNLEEFRFDEDGL 60

Query: 380 GART------CDYLEMLGYH---------------------VYRVLGQKRAVDLEFCRNR 412
           GA         + L  +                        V    GQ   ++ +F  N 
Sbjct: 61  GAGVRGDARAINELRNVARRPSILATPFRGSGAVFDPDDEAVRGDNGQAARLNKDFFANA 120

Query: 413 RTELHVKMADWL--------EFASLINH------------SGLIQNLKSLKSFIVPNTGE 452
           + +   ++            E  +                  LI  L S  ++ +   G+
Sbjct: 121 KAQSWWRLRKLFQNTWRAVAEGMAYNPDEIISISSSMALKDKLIIEL-SQPTYSINGVGK 179

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFA 477
           + I+ K+  G +S + +D +M  +A
Sbjct: 180 IVID-KQPDGTRSPNLADSVMINYA 203


>gi|256819733|ref|YP_003141012.1| hypothetical protein Coch_0896 [Capnocytophaga ochracea DSM 7271]
 gi|256581316|gb|ACU92451.1| hypothetical protein Coch_0896 [Capnocytophaga ochracea DSM 7271]
          Length = 450

 Score = 69.4 bits (168), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 104/295 (35%), Gaps = 38/295 (12%)

Query: 217 ERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR---------TVEGIDPSFHE 267
           E N     ++T+NP +       ++ +    +K   ++ R           + +   + +
Sbjct: 162 EYNLKGKLLITANPSKNF-----LYKEFYTPYKEGTLNKRRAFIQALPYDNKMLPKEYIQ 216

Query: 268 GIIAR-YGLDSDVTRVEVC-GQFP-QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDI 324
            +     G +    +  +  G +    D +S    + I    N +  P       +  DI
Sbjct: 217 NLENTLRGAE----KQRLLNGLWEYDDDPNSLCDYDKILAIFNNDQLPKESTTY-LTADI 271

Query: 325 AEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY---RPDAIIIDANNTGA 381
           A  G D  V+ + +G  +  ++  + +        I+ L  KY   + + I  D +  G 
Sbjct: 272 ARFGSDLCVIGVWQGWELIEVYTLATSATTEIQALINTLRMKYNIPKGNCIA-DEDGVGG 330

Query: 382 RTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQ---- 437
              D   ++G+       ++        +N +T+   K+A+ +    +   + + +    
Sbjct: 331 GVVDNTGIVGFKNNSTPFEENG-QPTNYKNLQTQCLYKLAERINSNGIYISAEVSERTKE 389

Query: 438 --NLKSLKSFIVPNTG-ELAIESK---RVKGAKSTDYSDGLMY-TFAENPPRSDM 485
               +  +       G  L++ +K   +    +S DY D L+   + +  P+   
Sbjct: 390 MIIEEIEQIKSDNKDGQRLSVINKDTVKQAIGRSPDYRDMLLMREYFDLKPKRIF 444


>gi|291334534|gb|ADD94186.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C1220]
 gi|291335526|gb|ADD95137.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C491]
 gi|291335665|gb|ADD95272.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C846]
          Length = 354

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 100/270 (37%), Gaps = 38/270 (14%)

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEE----RPDTFVGHHNTYGMAIINDEASG 202
            L P  W        L I+  + ST+    +E     R  +  G        ++ DEA+ 
Sbjct: 12  KLVPKVWIRTKNETDLRIELINGSTIELKGTENAMALRGRSLSG--------VVLDEAAF 63

Query: 203 T-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF----NKPLDDWKRFQIDTRT 257
              +V    I   L ++    + +  S P   +  FY+++    +   ++W+R+   T  
Sbjct: 64  MDAEVWFEVIRPALADKEG--WALFISTPDGTASWFYDLWCYVPDDETNEWQRWSYTTID 121

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
              +     E   A+  LD+   R E    F  +++   + ++  +E +++E       P
Sbjct: 122 GGNVSKHEVEAARAQ--LDTRTFRQEFEASF--ENLTGLVAISFSDENISQEAKDISIQP 177

Query: 318 LIMGCDIAEEGGD--NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIII- 374
           L++G D      D  + +  ++ G  +    +   T   TT +    +  +Y  D  II 
Sbjct: 178 LLLGVD---FNVDPMSGICAVKNGETLYVFDEVMLTGGATTWDFAEEVTRRYGVDRRIIA 234

Query: 375 --DANN-----TGARTCDY--LEMLGYHVY 395
             D        +G    D+  L   G+ V 
Sbjct: 235 CPDPTGGARKTSGVGVTDHAILRRSGFTVQ 264


>gi|326804661|ref|YP_004327532.1| Gp17 terminase subunit for DNA packaging, nuclease and ATPase
           [Salmonella phage Vi01]
 gi|301795311|emb|CBW38029.1| Gp17 terminase subunit for DNA packaging, nuclease and ATPase
           [Salmonella phage Vi01]
          Length = 736

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 66/393 (16%), Positives = 121/393 (30%), Gaps = 66/393 (16%)

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           TT+ A  +LW         +  LAN E Q    L   + K                +   
Sbjct: 269 TTVVAAFLLWYAMFHSDKEIAVLANKEKQAIEIL-DRIRK----------------AYQD 311

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYS-EERPDTFVGHHNTYGMAIINDEASGTPDV--I 207
            P++        G     +    + Y+     D+  G        +  DE +   +    
Sbjct: 312 LPFFLQQGCEKFGSTLIEFENGSKIYAYATSSDSIRGR---SVSLLYVDEVAFIENDFEF 368

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD---WKRFQIDT---RTVEGI 261
                  +   + +R  I+TS P+   G FY+I  K       +  F +       V   
Sbjct: 369 WESTFPAIASADTSR-CILTSTPKGQRGLFYDIVTKADPRHPQYNDFHLTEVPWYKVPAY 427

Query: 262 --DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN---REP-----C 311
             DP +     AR G        E   +F +  + S IP   +++  +   REP      
Sbjct: 428 TKDPDWETKQRARLG--DARFDQEFGIKF-RGSVGSLIPAKCLDKMTSKLYREPNEFTKI 484

Query: 312 PDPYAPLIMGCDIAEEG----GDNTVV-VLRRGPVIEHLFDWSKTDL---RTTNNKISGL 363
              Y P  +   IA+ G    GD +V+ +L        +    + +          I+ +
Sbjct: 485 YKEYDPQRIYFGIADTGKGVEGDYSVLTILDITEYPHVIAAKYRNNTIPPMMYAYTIADM 544

Query: 364 VEKYRPDAIIIDA-NNTGARTCDYLEMLGYHVYRVLG-----------QKRAVDLEFCRN 411
             +Y    ++++  N+ G +    L     +   +               R  +     N
Sbjct: 545 CTEYGECPVLVETNNDVGGQVITILYQEIEYPEIIFTSTDNKGTGKRIGGRKPEPGINTN 604

Query: 412 R--RTELHVKMADWLE-FASLINHSGLIQNLKS 441
           R  R+     +   +E    +I     I  L +
Sbjct: 605 RKVRSIGCANLKALIEKEMLVIEDQDTIDELST 637


>gi|282599341|ref|YP_003358653.1| Gp17 terminase DNA packaging enzyme large subunit [Shigella phage
           phiSboM-AG3]
 gi|226973647|gb|ACO94400.1| Gp17 terminase DNA packaging enzyme large subunit [Shigella phage
           phiSboM-AG3]
          Length = 736

 Score = 68.6 bits (166), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 61/393 (15%), Positives = 124/393 (31%), Gaps = 66/393 (16%)

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           TT+ A  +LW         +  LAN E Q    L   + K                +   
Sbjct: 269 TTVVAAFLLWYAMFHSDKEIAVLANKEKQAIEIL-DRIRK----------------AYQD 311

Query: 151 APWYSDVLHCSLGIDSKHYSTMCRTYS-EERPDTFVGHHNTYGMAIINDEASGTPDV--I 207
            P++        G     +    + Y+     D+  G        +  DE +   +    
Sbjct: 312 LPFFLQQGCEKFGSTLIEFENGSKIYAYATSSDSIRGR---SVSLLYVDEVAFIENDFEF 368

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD---WKRFQIDTRTVEGI--- 261
                  +   + +R  I+TS P+   G FY+I  K   +   +  F++       +   
Sbjct: 369 WESTFPAIASADTSR-CILTSTPKGQRGLFYDIVTKANPEHPQYNDFKLTEVPWYRVPTY 427

Query: 262 --DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--------EPC 311
             DP++     A+ G        E   +F +  + S IP   +++  ++           
Sbjct: 428 TKDPNWESKQRAKLG--DARFDQEFGIKF-RGSVGSLIPAKCLDKMTSKLYQEPNEFTKI 484

Query: 312 PDPYAPLIMGCDIAEEG----GDNTVV-VLRRGPVIEHLFDWSKTDL---RTTNNKISGL 363
              Y P  +   IA+ G    GD +V+ +L        +    + +          I+ +
Sbjct: 485 YHDYDPKRIYMGIADTGKGVEGDYSVLTILDITDYPHKIAAKYRNNTIPPMMYAYTIADM 544

Query: 364 VEKYRPDAIIIDA-NNTGARTCDYLEMLGYHVYRVLG-----------QKRAVDLEFCRN 411
            EKY    ++++  N+ G +    L     +   +               R  +     N
Sbjct: 545 GEKYGTCPMLVETNNDVGGQVITILYQEIEYPEIIFTTTDAKGTGKRIGGRRPEPGINTN 604

Query: 412 R--RTELHVKMADWLE-FASLINHSGLIQNLKS 441
           +  R+     +   +E    +++    I  L +
Sbjct: 605 KKVRSNGCANLKALIEREMLVVDDQDTIDELST 637


>gi|291334627|gb|ADD94276.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C231]
          Length = 320

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 83/218 (38%), Gaps = 26/218 (11%)

Query: 195 IINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF----NKPLDDWK 249
           ++ DEA+    +V    I   L ++    + +  S P   +  FY+++         +W+
Sbjct: 56  VVLDEAAFMDAEVWFEVIRPALADKEG--WALFISTPDGTASWFYDLWCYVPEDETGEWQ 113

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
           R+   T     +     E   A+  LD+   R E    F  +++   + ++  +E +++E
Sbjct: 114 RWSYTTIEGGNVSKHEVEAARAQ--LDNRTFRQEFEASF--ENLTGLVAISFSDENISQE 169

Query: 310 PCPDPYAPLIMGCDIAEEGGD--NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY 367
                  PL++G D      D  + +  ++ G  +    +   T   TT +    +  +Y
Sbjct: 170 AKDISIQPLLLGVD---FNVDPMSGICAVKNGETLYVFDEIMLTGGATTWDFAEEVTRRY 226

Query: 368 RPDAIII---DANN-----TGARTCDY--LEMLGYHVY 395
             D  +I   D        +G    D+  L   G+ V 
Sbjct: 227 GVDRRVIACPDPTGGARKTSGVGVTDHAILRRSGFTVQ 264


>gi|297566322|ref|YP_003685294.1| hypothetical protein Mesil_1911 [Meiothermus silvanus DSM 9946]
 gi|296850771|gb|ADH63786.1| protein of unknown function DUF264 [Meiothermus silvanus DSM 9946]
          Length = 427

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 68/386 (17%), Positives = 134/386 (34%), Gaps = 44/386 (11%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
           +GK+   +   +      P    + L+  E Q         SK L+    +H   +Q ++
Sbjct: 32  VGKSFAASLEAVLDCVAHPRSLWVFLSRGERQ---------SKELAEKAQRHLEAIQVVA 82

Query: 148 -LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD- 205
            ++  P+ ++     + + +              PDT  G+       ++ DE +   D 
Sbjct: 83  EMYDEPFDAESTQTVIRLPNGSRIISLPA----NPDTARGYSGN----VLLDEFALHKDS 134

Query: 206 -VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP--LDDWKRFQIDTRTVEGID 262
             I   +   +T R+      + S P+   GKFYEI+      D W R ++D        
Sbjct: 135 REIWGALYPTIT-RSKRYRLRVLSTPKGQQGKFYEIWQPEPGGDLWSRHRVDIYDAVQQG 193

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP--YAPLIM 320
                  + +   D  + + E   +F  +   +++P  +I    + +   D      L +
Sbjct: 194 LEVDPEELRKGLKDPVLWQQEYLLEFVDEAS-AWLPYELITSCESSQARTDGALEGDLYL 252

Query: 321 GCDIAEEGGDNTVV--VLRRGPVI--EHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDA 376
           G DI     D +V+    R G V+    +    +T   T    +  L+ + R     IDA
Sbjct: 253 GMDIGRH-RDLSVIWVAERVGDVLWTRRVIWLERTPFATQREVLYSLLPQVRRAC--IDA 309

Query: 377 NNTGARTCDYLE-MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL-INHSG 434
           +  G +  +  +   G  V  V+  +   +          L V +    E   + I    
Sbjct: 310 SGLGMQLAEEAQSRFGSRVEPVMFTRAVKED---------LAVTLRRKFEDRLIRIPPDD 360

Query: 435 LIQNLKSLKSFIVPNTGELAIESKRV 460
            I+        I  + G +  ++ R 
Sbjct: 361 RIRESLHAVRRITTSAGHIRFDADRD 386


>gi|300775654|ref|ZP_07085515.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
 gi|300505681|gb|EFK36818.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
          Length = 475

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 46/284 (16%), Positives = 101/284 (35%), Gaps = 35/284 (12%)

Query: 217 ERNANRFWIMTSNPRRLSGKFYEIFNKPLD------DWKRFQIDTRTVEGIDPSFHEGII 270
           E        +T NP++     Y  F KP+         K  Q   +    I   + E + 
Sbjct: 179 EYGLKPKIFVTCNPKKN--WMYSYFYKPMKEGLLKLKQKFIQAFVQENPFITTDYIEQLE 236

Query: 271 ARYGLDSDVTRVEVC-GQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPLIMGCDIAEE 327
           +         R  +  G +  +  D+   L I +  L+  +    +      +  D+A  
Sbjct: 237 ST---TDKAKRERLLKGNW--EYDDNPYKLTIYDRILDLWKNDHIEKKGRKYITADVARF 291

Query: 328 GGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI--SGLVEKYRPDAIIIDANNTGARTCD 385
           G D   V +     +  + ++  +        I    +  K      I DA+  G    D
Sbjct: 292 GSDLATVGVWEDWDLIEVHEFEISKTTEIQACIQAMRIKHKIPKHNCIADADGVGGGVVD 351

Query: 386 YLEMLGYHVYRVLGQ---KRAVDLEFCRNRRTELHVKMADWLEFASLINHSG-------- 434
            L+++G+       +    ++ +    +N +T+L V +A+ +   + +N S         
Sbjct: 352 NLDIIGFVNNAKPFEENTGQSKNAPKYKNMQTQLLVYLAEKIINQNKMNISADISEKQKE 411

Query: 435 -LIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            + + L +++   +P+   + +  K   +    +S DY D ++ 
Sbjct: 412 YIKEELDTIE--RIPDVDIVTLVDKTQIKQNIGRSPDYRDMILM 453


>gi|329954246|ref|ZP_08295340.1| phage terminase, large subunit, PBSX family [Bacteroides clarus YIT
           12056]
 gi|328527952|gb|EGF54938.1| phage terminase, large subunit, PBSX family [Bacteroides clarus YIT
           12056]
          Length = 438

 Score = 67.1 bits (162), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 52/319 (16%), Positives = 109/319 (34%), Gaps = 45/319 (14%)

Query: 196 INDEASGTPDVINLGILG----FLTE-RNANRFWIMTSNPRRLSGKFYEIFNKP------ 244
             +EA     +    +       L +  N     ++T NP++     Y+ F KP      
Sbjct: 126 WIEEAGQVNRLAFEVLQTRIGRHLNDVYNVPGKILITCNPKKN--WLYDKFYKPWKEHKL 183

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC-GQFPQQDIDSFIPLNIIE 303
            D +   Q   +        +   +      +  VT+  +  G +   +     P  + +
Sbjct: 184 KDGYAFVQALVQDNPFATEDYINTLKNT---NDKVTKERLYFGNWEYDND----PAVLCD 236

Query: 304 EALNREPCPDPY-APLIMGC---DIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359
                +   + +  P+ +     D+A +G D  V     G V     D   +  ++    
Sbjct: 237 YDAICDLFVNEHVQPVGLSTGSSDLAMKGRDRFVSGHWIGNVCYIRLDQEYSTGKSIEAD 296

Query: 360 ISGLVEKY--RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
           +  ++ ++      +I+D++  G     YLE     +    G  R ++ E   N ++E  
Sbjct: 297 LKNMMIQWSIPRSMMIVDSDGLG----SYLESYLNGIKEFHGGNRPINPE-FDNLKSECA 351

Query: 418 VKMADWLEFASL------INHSGLIQNLKSLKSFIVP----NTGELAIESKRVKGAKSTD 467
            K+A+ +    +           +I+ L  LK   +       G ++ E  +     S D
Sbjct: 352 FKLAELINNRQIRIICTEAQRERIIEELGVLKQDHIDADTRKKGIISKEKMKEILGHSPD 411

Query: 468 YSDGLMYT-FA--ENPPRS 483
           Y D L+   F   +  P+ 
Sbjct: 412 YLDMLIMAMFFRIKPIPKR 430


>gi|167623253|ref|YP_001673547.1| hypothetical protein Shal_1320 [Shewanella halifaxensis HAW-EB4]
 gi|167353275|gb|ABZ75888.1| protein of unknown function DUF264 [Shewanella halifaxensis
           HAW-EB4]
          Length = 617

 Score = 67.1 bits (162), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 87/249 (34%), Gaps = 34/249 (13%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP-------- 317
            E +   Y  + D  +      F   D DS    + +E+ +        + P        
Sbjct: 380 IEELRDEY--NDDDFKNLFMCIFVD-DADSVFKFSDLEKCMVESARWQDHKPKEQRPFGN 436

Query: 318 --LIMGCDIAEEGGDNTVVVL----RRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRP 369
             + +G D +    + T+VV+    ++G     L    W   +     ++I  +  +YR 
Sbjct: 437 REVWLGYDPSRTRDNATLVVIAPGEKKGEKFRVLEKHYWRGLNFSHHVSEIQKVYARYRV 496

Query: 370 DAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL 429
             I +D    GA   D +  L          + A  + +  + +T L +KM D +E   +
Sbjct: 497 TYIGVDTTGIGAGVFDSISTL--------FPREATAIHYSVSSKTRLVLKMIDVVESGRI 548

Query: 430 I---NHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
               +H  +  +  S++       G +  ++ R        ++D + +  A       ++
Sbjct: 549 EWDASHKDIAMSCLSIRKTTTDTGGAITFKASRDNVT---GHAD-VFFAIAHAVINEPLN 604

Query: 487 FGRCPSYQY 495
           F    +  +
Sbjct: 605 FAHKRTSSW 613


>gi|291337121|gb|ADD96636.1| hypothetical protein Syncc9605_0456 [uncultured organism
           MedDCM-OCT-S12-C92]
          Length = 354

 Score = 66.7 bits (161), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 99/270 (36%), Gaps = 38/270 (14%)

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEE----RPDTFVGHHNTYGMAIINDEASG 202
            L P  W        L I+  + ST+    +E     R  +  G        ++ DEA+ 
Sbjct: 12  KLVPKVWIRTKNETDLRIELINGSTIELKGTENAMALRGRSLSG--------VVLDEAAF 63

Query: 203 T-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF----NKPLDDWKRFQIDTRT 257
              +V    I   L ++    + +  S P   +  FY+++    +   ++W+R+   T  
Sbjct: 64  MDAEVWFEVIRPALADKEG--WALFISTPDGTASWFYDLWCYVPDDETNEWQRWSYTTID 121

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
              +     E   A+  LD+   R E    F  +++   + ++  ++ ++ E       P
Sbjct: 122 GGNVSKHEVEAARAQ--LDTRTFRQEFEASF--ENLTGLVAISFSDDNISTEAKDISIQP 177

Query: 318 LIMGCDIAEEGGD--NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIII- 374
           L++G D      D  + +  ++ G  +    +   T   TT +    +  +Y  D  II 
Sbjct: 178 LLLGVD---FNVDPMSGICAVKNGETLYVFDEVMLTGGATTWDFAEEVTRRYGVDRRIIA 234

Query: 375 --DANN-----TGARTCDY--LEMLGYHVY 395
             D        +G    D+  L   G+ V 
Sbjct: 235 CPDPTGGARKTSGVGVTDHAILRRSGFTVQ 264


>gi|326784094|ref|YP_004324487.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
 gi|310004826|gb|ADO99217.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
          Length = 550

 Score = 66.3 bits (160), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 49/323 (15%), Positives = 103/323 (31%), Gaps = 47/323 (14%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+T     +L  +     ++V  LAN  +  +  L    ++  +   N   +  Q + 
Sbjct: 84  TGKSTTVVSYLLHYLIFNDSVNVGILANKASTARDLL----ARLATAYENLPKWIQQGVV 139

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           +    W    +    G      ST          +            I  DE +  P+ I
Sbjct: 140 V----WNKGNIELENGSKILAASTSASAVRGMSFN-----------IIFLDEFAFVPNHI 184

Query: 208 ----NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEG 260
                  +   +T    +   I+ S P+ ++  FY+++       +D+   ++    V G
Sbjct: 185 ADSFFASVYPTITS-GKSTKVIIISTPQGMN-HFYKMWQDAVNGRNDYTYHEVHWSQVPG 242

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--------- 311
            D  + E  I            E   +F    +D+ I  + ++     EP          
Sbjct: 243 RDAKWKEETIKNTSQRQ--FTQEFECEFL-GSVDTLISASKLKALAFDEPITRNKGLDIY 299

Query: 312 --PDPYAPLIMGCDIAE--EGGDNTVVVLRRGPVIEHLFDWSKTD---LRTTNNKISGLV 364
             P      ++  D++    G  +  +V     V   +    + +        N I+ + 
Sbjct: 300 EKPKDKNEYLLTVDVSRGIGGDYSAFIVYDITTVPYKIVGKYRNNEIKPMLFPNVINDVA 359

Query: 365 EKYRPDAIIIDANNTGARTCDYL 387
             Y    ++ + N+ G +    L
Sbjct: 360 RAYNNAWVLCEVNDVGDQVASIL 382


>gi|58532911|ref|YP_195134.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
 gi|58331378|emb|CAF34164.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
          Length = 548

 Score = 66.3 bits (160), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/323 (14%), Positives = 104/323 (32%), Gaps = 47/323 (14%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
            GK+T     +L  +     +++  LAN  +  +  L    ++  +   N   +  Q + 
Sbjct: 84  TGKSTTVVSYLLHYLIFNDNVNIGILANKASTARDLL----ARLATAYENLPKWIQQGVV 139

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           +    W    +    G      ST          +            I  DE +  P+ I
Sbjct: 140 V----WNKGNIELENGSKILAASTSASAVRGMSFN-----------IIFLDEFAFVPNHI 184

Query: 208 ----NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF---NKPLDDWKRFQIDTRTVEG 260
                  +   +T    +   I+ S P+ ++  FY+++       + +   ++    V G
Sbjct: 185 ADSFFASVYPTITS-GKSTKVIIISTPQGMN-HFYKMWVDATNGRNGYTFHEVHWSQVPG 242

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--------- 311
            D  + E  I            E   +F    +D+ I  + ++  +  +P          
Sbjct: 243 RDEKWKEETIKNTSERQ--FTQEFECEFL-GSVDTLIAASKLKALVFNDPIKRNKGLDIY 299

Query: 312 --PDPYAPLIMGCDIAE--EGGDNTVVVLRRGPVIEHLFDWSKTD---LRTTNNKISGLV 364
             P   +  +M  D++    G  +  ++     V   +    + +        N I+ L 
Sbjct: 300 EEPKEKSEYLMTVDVSRGIGGDYSAFIIFDITTVPYKVVGKYRNNEIKPMLFPNIINDLA 359

Query: 365 EKYRPDAIIIDANNTGARTCDYL 387
             Y    ++ + N+ G +    L
Sbjct: 360 RSYNNAWVLCEVNDIGDQVASIL 382


>gi|319775358|ref|YP_004137846.1| Terminase, ATPase subunit [Haemophilus influenzae F3047]
 gi|317449949|emb|CBY86161.1| Terminase, ATPase subunit [Haemophilus influenzae F3047]
          Length = 603

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 55/375 (14%), Positives = 118/375 (31%), Gaps = 70/375 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +  T+      T   +H      
Sbjct: 210 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--TFLGTNSATAQSYHGN---- 263

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FN+    
Sbjct: 264 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNRNRAK 321

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            ++ +ID                             G +    + +IA    +       
Sbjct: 322 SEKIEIDISHENLKSGKLCADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEE--FEQL 379

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV 333
              QF   +  +F   ++    ++       Y P          + +G D A  G    +
Sbjct: 380 FLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 439

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++      R    + H   +   D  T  ++I    + Y    I+ID    G+     +
Sbjct: 440 VIVAPPKVERGDYRVLHKQTFHGMDYETQASRIKQFCDDYNVTRIVIDKTGMGSGVYQEV 499

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKS 444
                 V  +         E+  + + E+ +K  + ++   L      + ++ +  ++K 
Sbjct: 500 RKFYPMVQGL---------EYNADLKNEMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK 550

Query: 445 FIVPNTGELAIESKR 459
             +  TG++   S R
Sbjct: 551 -RITGTGKITYVSDR 564


>gi|320162476|ref|YP_004175701.1| hypothetical protein ANT_30750 [Anaerolinea thermophila UNI-1]
 gi|319996330|dbj|BAJ65101.1| hypothetical protein ANT_30750 [Anaerolinea thermophila UNI-1]
          Length = 506

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 57/329 (17%), Positives = 94/329 (28%), Gaps = 43/329 (13%)

Query: 120 LKTTLWAEVSKWLSLLPNKHWFEMQSL--SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS 177
           L +   AE+ K    L  +    M+ L   L+  P          G   +         S
Sbjct: 72  LFSGTSAEMVKASPTLRPQSLTAMRRLERVLNANPLTRGRWRRESGNTFRLGQARIHFLS 131

Query: 178 EERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLT--ERNANRFWIMTSNPRRLSG 235
                + VG   T  + +  DEA           L  +T        FW        L G
Sbjct: 132 AAPGASIVG--ATASLLLEVDEAQAVSIEKFDTELAPMTASTGAVRVFWGTAWTASTLLG 189

Query: 236 K---FYEIFNKPLDDWKRFQIDTRTVEGIDPSFH---EGIIARYGLDSDVTRVEVCGQFP 289
           +     +         + F++    V    P +    E  I + G +    R +   +  
Sbjct: 190 RELRLAQAEQARDGVRRVFRLTAAEVIADHPRYARTVERAIQQLGRNHPAVRTQYFSEEV 249

Query: 290 QQDIDSFIPLNIIEEALNREPCPDP---------------YAPLIMGC--DIAEEGGDNT 332
                +  P   +       P  D                 AP+ +    D A    D++
Sbjct: 250 DAA-GTLFPEERLALLRGTHPWQDAPLPGRTYAFLLDVGGTAPVQLPLMDDYAGNRRDSS 308

Query: 333 VVVLRR-----------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGA 381
            +V+                  HL  W+         ++  L  ++ P  I+IDA   GA
Sbjct: 309 ALVIVEVEPPQDGRPAPRYRAVHLCQWTGVSQTRLFEQVLALARQWSPRRIVIDATGVGA 368

Query: 382 RTCDYLEML--GYHVYRVLGQKRAVDLEF 408
              D+L+    G  V  V       DL +
Sbjct: 369 GLADFLDRALPGRVVRFVFSSASKSDLGY 397


>gi|163758712|ref|ZP_02165799.1| prophage MuMc02, terminase, ATPase subunit, putative [Hoeflea
           phototrophica DFL-43]
 gi|162284002|gb|EDQ34286.1| prophage MuMc02, terminase, ATPase subunit, putative [Hoeflea
           phototrophica DFL-43]
          Length = 460

 Score = 64.4 bits (155), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 49/304 (16%), Positives = 86/304 (28%), Gaps = 32/304 (10%)

Query: 129 SKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHH 188
           +K   L    H ++ Q           D+ H S             T     PDT  G  
Sbjct: 79  AKAYDLAIEAHEYDWQGQEGSYRAMEVDLPHGSK-----------ITALPANPDTARGFS 127

Query: 189 NTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
                 +  DE +   D   I   +   ++   A     +TS P     KFYE+     D
Sbjct: 128 AN----VFLDEFAFHKDSGAIWKALFPVIS---AGWKLRITSTPNGKGNKFYELMTAEGD 180

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID----SFIPLNII 302
            W + ++D               +     D D    E   ++  +         I     
Sbjct: 181 RWSKHEVDIYRAVADGLPRDIEELREGLADEDAWAQEYELKWLDEASAWLSYELISSVED 240

Query: 303 EEALNREPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEHLFDWSKTDLRTTNN 358
           E A   +P      P  +G DI     D  V+     +          +  +    + + 
Sbjct: 241 ERA--GDPYLYQGGPCYVGRDIGRRN-DLHVIWVWELVGDVLWERERIEQKRATFASMDA 297

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYRVLGQKRAVDLEFCRNRRTELH 417
               ++E+YR     ID    G +  +  +   G  +  VL       +     +     
Sbjct: 298 AFDDVMERYRVVRACIDQTGMGEKVVEDAQTRHGSRIEGVLFTGPNKLVMATAGKEAFED 357

Query: 418 VKMA 421
            ++ 
Sbjct: 358 RRVR 361


>gi|78212008|ref|YP_380787.1| hypothetical protein Syncc9605_0456 [Synechococcus sp. CC9605]
 gi|78196467|gb|ABB34232.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 414

 Score = 64.4 bits (155), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 50/254 (19%), Positives = 88/254 (34%), Gaps = 39/254 (15%)

Query: 82  ISAGRGIGKTTLN-AWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           +++GR  GKT +   WL+   + T  G  +  LA +  Q K   W ++            
Sbjct: 25  VNSGRRFGKTRMALTWLLEGALLT-SGSRMWFLAPTRVQAKQIAWRDLK----------- 72

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
                  + P  W S V   +L I+ ++ S + +    +  D+  G           DE 
Sbjct: 73  ------EMVPGSWASQVRESTLTIELRNGSHI-QLAGADYADSLRGQRADR---FAIDEY 122

Query: 201 SGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTR 256
               D   +    L  +   + +   I +S P        E++ +      W R+   + 
Sbjct: 123 CYIRDLQEMWQAALLPMLGTSDDGSVIFSSTPAGGGTFSAELWERAETAEGWARWNFPSV 182

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---PD 313
               + P + E   AR  +D  + R E  G            L  +  A N++      D
Sbjct: 183 AGGWVKPEYVEQ--ARQTMDPSLWRQEFFGSIES-------LLGAVYPAFNQQNISDTVD 233

Query: 314 PYAPLIMGCDIAEE 327
              PL++GCD    
Sbjct: 234 NGGPLLVGCDFNRS 247


>gi|319762771|ref|YP_004126708.1| prophage mumc02, terminase, atpase subunit, putative
           [Alicycliphilus denitrificans BC]
 gi|317117332|gb|ADU99820.1| prophage MuMc02, terminase, ATPase subunit, putative
           [Alicycliphilus denitrificans BC]
          Length = 454

 Score = 64.0 bits (154), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 77/241 (31%), Gaps = 21/241 (8%)

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRR 232
           T     PDT  G        ++ DE +   D   I   +   +++          S P  
Sbjct: 113 TALPANPDTARGFSAN----VLLDEFAFHQDSRAIWKALFPVISKPGLKLRV--ISTPNG 166

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTR-TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
              KFY++     D W R   D    V    P   E +    G D D+   E   ++  +
Sbjct: 167 KGNKFYDLMTGADDGWSRHTTDIYQAVADGLPRNIEELRKGAG-DDDLWAQEFELKWLDE 225

Query: 292 DIDSFIPLNIIEEA---LNREPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEH 344
              +++P  +I         +P      P  +G DIA    D  V+     +     +  
Sbjct: 226 AS-AWLPFELITACEHEAAGKPEHYQGGPCFVGVDIASRN-DLFVIWVFELVGDVLWVRE 283

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG-ARTCDYLEMLGYH-VYRVLGQKR 402
           + +  +      +  + G+  +YR     +D    G     D     G   V  VL    
Sbjct: 284 IIERRRITFAEQDMLLDGVFRRYRVIRACMDQTGMGEKPVEDAQRRHGSSRVQGVLFTSS 343

Query: 403 A 403
           A
Sbjct: 344 A 344


>gi|146277344|ref|YP_001167503.1| hypothetical protein Rsph17025_1297 [Rhodobacter sphaeroides ATCC
           17025]
 gi|146278140|ref|YP_001168299.1| hypothetical protein Rsph17025_2103 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555585|gb|ABP70198.1| protein of unknown function DUF264 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556381|gb|ABP70994.1| protein of unknown function DUF264 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 476

 Score = 64.0 bits (154), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 69/239 (28%), Gaps = 21/239 (8%)

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRR 232
           T     PDT  G        +I DE +       I   +   +++    +   + S P  
Sbjct: 133 TALPANPDTARGFSAN----VILDEFAFHAKSREIWAALFPVISKG--RQKLRVISTPNG 186

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
              KFYE+       W R  +D              ++     D D    E   ++  + 
Sbjct: 187 KGNKFYELMTAEGSVWSRHVVDIYEAVRQGLDRDVDMLRAGMADEDAWAQEYELKWLDEA 246

Query: 293 ----IDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEH 344
                   I     E  L  +P      P  +G DIA    D  V+     +        
Sbjct: 247 SAWLDYDLISS--CESELAGKPEGYQGGPCFVGVDIAARN-DLFVIWVMELVGDVLWTRE 303

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG-ARTCDYLEMLG-YHVYRVLGQK 401
           +    +      +  +  ++ +YR   + +D    G     D     G   V  VL   
Sbjct: 304 IIARRRISFAEQDALLDDVMRRYRVIRVQMDQTGMGEKPVEDAKRRHGQLRVEGVLFSA 362


>gi|171914351|ref|ZP_02929821.1| hypothetical protein VspiD_24270 [Verrucomicrobium spinosum DSM
           4136]
          Length = 450

 Score = 64.0 bits (154), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 61/349 (17%), Positives = 102/349 (29%), Gaps = 59/349 (16%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQ-LKTTLWAEVSKWLSLLPNKHWFEMQSL 146
            GK   +A  ++     R   + +  A SE Q L+T           L     W E   L
Sbjct: 31  TGKDFSSAAEIVRDCKLRDKTTWMIAAPSERQSLET-----------LAKCSEWSEAFDL 79

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCR-TYSEERPDTFVGHHNTYGM---AIINDEASG 202
           +        D     L      ++   R      RPDT  G      M   A   D    
Sbjct: 80  ASEGIREERDGPEALLKQGEIKFANGSRVIAVPGRPDTVRGFSANVLMTEFAFFED---- 135

Query: 203 TPDVINLGILGFLTE--RNANRFWIMTSNPRRLSGKFYEIFNKP---LDDWKRFQIDTRT 257
            PD     IL  +T   R   +   + + P     K ++++ K       W + ++    
Sbjct: 136 -PDATWRAILPSITNPLRGGEKKVRLITTPNGQGNKAHDLWTKENSTKHKWSKHKVTIHD 194

Query: 258 VE----GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD----IDSFIPLNIIEEALNRE 309
                  +DP     ++     D +    E   +F            I      EA   +
Sbjct: 195 AVAAGLPVDPEELRAMLD----DPEGWAQEYECEFLDAAGVLLSYELIGSCEAPEATTTQ 250

Query: 310 P----CPDPYAPLIMGCDIAEEGGDNTVV--VLRRGP--VIEHLFDWSKTDLRTTNNKIS 361
           P       P  PL  G D A +  D +V+    + GP  V + +         +T  ++ 
Sbjct: 251 PDAFWAARPQFPLYAGWDFARK-KDLSVLWTAQKIGPLLVTKEVLVMRG---MSTPKQVE 306

Query: 362 GLVEKYRPDA-IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
            +  + +    + +D    G    D L             +   D    
Sbjct: 307 LVSHRLKNITRLCLDYTGAGVGAGDLLVE--------KFGEWNFDKHQF 347


>gi|227500282|ref|ZP_03930349.1| terminase [Anaerococcus tetradius ATCC 35098]
 gi|227217568|gb|EEI82880.1| terminase [Anaerococcus tetradius ATCC 35098]
          Length = 466

 Score = 64.0 bits (154), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 55/364 (15%), Positives = 122/364 (33%), Gaps = 51/364 (14%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
           +P  WQ + ++ + A   + +   +   +          GKT +     LW +    G +
Sbjct: 35  SPYPWQEKLIKDIFAVNDDGLWTHSKFGYAVPRRN----GKTEIVYMAELWFLM--DGKN 88

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           +I  A+  +   +  + ++ K+L  +      + +S+         +++          +
Sbjct: 89  IIHTAHRISTSHS-SFKKLKKYLEKMGLVDKVDFKSIKAK----GQEMIELIKTGGVIQF 143

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
            T  RT +    + F          ++ DEA    +     +   +T+ + N   +M   
Sbjct: 144 RT--RTETGGLGEGFD--------LLVIDEAQEYTEGQESALKYTVTDSD-NPMILMCGT 192

Query: 230 P------RRLSGKFYE---IFNKPLDDWKRFQIDTRTVE-------GIDPS-----FHEG 268
           P        +  K+ +      K  + W  + +   T           +PS         
Sbjct: 193 PPTLVSGGTVFSKYRDLILSGGKNHNGWAEWSVSEMTNPYDIDAWYKTNPSMGYKLRERA 252

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIP-LNIIEEALNREPCPDPYAPLIMGCDIAEE 327
           +    G D     ++  G + + +  S I  L+     L     P     L +G     +
Sbjct: 253 VEEEIGPDETDFNIQRLGYWVKYNQKSVISKLDWDR--LKLTRLPSLVGKLHVGIKYGND 310

Query: 328 GGDNTVVVLRRGPVIEHLFD-WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
           G +  + +  +        +      +R  N+ I   ++K +P +++ID    GA   D 
Sbjct: 311 GRNVALSIAVKTLSNRIFIESIDCQSIRNGNDWIVDFLKKTKPISVVID----GASRQDI 366

Query: 387 LEML 390
           LE  
Sbjct: 367 LEEQ 370


>gi|326782381|ref|YP_004322781.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
 gi|310003329|gb|ADO97726.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
          Length = 362

 Score = 63.6 bits (153), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 92/287 (32%), Gaps = 44/287 (15%)

Query: 89  GKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           GK+T+    +LW +     ++V  LAN     +  L     +      N   +  Q +  
Sbjct: 85  GKSTIVTSYLLWYVIFNDNVNVAILANKAATSREML----QRLQRSYENLPKWLQQGIVQ 140

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP---- 204
               W    L    G           + S  R  +F          I  DE +  P    
Sbjct: 141 ----WNRGSLELENGSKI---MAASTSSSAVRGMSFN--------VIFLDEFAFVPNHIA 185

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN---KPLDDWKRFQIDTRTVEGI 261
           D     +   ++    +   I+ S P  ++  FY++++   +  +++   ++    V G 
Sbjct: 186 DEFFSSVYPTISS-GKSTKVIIISTPHGMN-MFYKLWHDSERKKNEYISTEVHWSEVPGR 243

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---------- 311
           D  +    IA         +VE   +F    +D+ I  + +   +  +P           
Sbjct: 244 DAKWKAQTIANTSEQQ--FKVEFECEFL-GSVDTLISPSKLRTMVYNDPLVQNKGLSIYE 300

Query: 312 -PDPYAPLIMGCDIAEE--GGDNTVVVLRRGPVIEHLFDWSKTDLRT 355
                   ++  D+A    G  +  VV+    +   L    K +   
Sbjct: 301 HVQKDHNYVITVDVARGVSGDFSAFVVIDTTTIPYKLVAKYKNNTIK 347


>gi|171915351|ref|ZP_02930821.1| hypothetical protein VspiD_29290 [Verrucomicrobium spinosum DSM
           4136]
          Length = 451

 Score = 63.6 bits (153), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 61/348 (17%), Positives = 104/348 (29%), Gaps = 57/348 (16%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQ-LKTTLWAEVSKWLSLLPNKHWFEMQSL 146
            GK   +A  ++     R   + +  A SE Q L+T           L     W E   L
Sbjct: 32  TGKDFSSAAEIVRDCKLRDKTTWMIAAPSERQSLET-----------LAKCGEWSEAFDL 80

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCR-TYSEERPDTFVGHHNTYGM---AIINDEASG 202
           +        D     L      ++   R      RPDT  G      M   A   D    
Sbjct: 81  ASEGIREERDGPEALLKQGEIKFANGSRVIAVPGRPDTVRGFSANVLMTEFAFFED---- 136

Query: 203 TPDVINLGILGFLTE--RNANRFWIMTSNPRRLSGKFYEIFNKP---LDDWKRFQIDTRT 257
            PD     IL  +T   R   +   + + P     K ++++ K       W + ++    
Sbjct: 137 -PDATWRAILPSITNPLRGGEKKVRLITTPNGQGNKAHDLWTKENSTKHKWSKHKVTIHD 195

Query: 258 VE----GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII---EEALNREP 310
                  +DP     ++     D +    E   +F        +P  +I   E A     
Sbjct: 196 AVAAGLPVDPEELRAMLD----DPEGWAQEYECEFLD-SAGVLLPYELIATCEAAEATTT 250

Query: 311 CPDPYA------PLIMGCDIAEEGGDNTVV--VLRRGPVIEHLFDWSKTDLRTTNNKISG 362
             D +       PL  G D A +  D +V+    + GP I+   +       +T  ++  
Sbjct: 251 QADAFWNARQQFPLYAGWDFARK-KDLSVLWTAQKVGP-IKVTKEVLIMRGMSTPAQVEL 308

Query: 363 LVEKYRPDA-IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC 409
           +  + +    + +D    G    D L             +   D    
Sbjct: 309 VSHRLKHITRLCLDYTGAGVGAGDLLVE--------KFGEWNFDKHQF 348


>gi|68250195|ref|YP_249307.1| terminase, ATPase subunit [Haemophilus influenzae 86-028NP]
 gi|68058394|gb|AAX88647.1| terminase, ATPase subunit [Haemophilus influenzae 86-028NP]
          Length = 593

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 54/375 (14%), Positives = 116/375 (30%), Gaps = 70/375 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FN+    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNRNRAK 311

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            ++ +ID                             G +    + +IA    +       
Sbjct: 312 SEKIEIDISHENLKSGKLCADRQWKQIVSIYDAMESGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV 333
              QF   +  +F   ++    ++       Y P          + +G D A  G    +
Sbjct: 370 FLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++           + H   +   D  T  ++I    + Y    I+ID    G+     +
Sbjct: 430 VIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQFCDDYNVTRIVIDKTGMGSGVYQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKS 444
                          A  LE+  + + E+ +K  + ++   L      + ++ +  ++K 
Sbjct: 490 R---------KFYPMAQGLEYNADLKNEMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK 540

Query: 445 FIVPNTGELAIESKR 459
             +  TG++   S R
Sbjct: 541 -RITGTGKITYVSDR 554


>gi|326783799|ref|YP_004324193.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
 gi|310003811|gb|ADO98206.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
          Length = 552

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 61/407 (14%), Positives = 124/407 (30%), Gaps = 56/407 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M       +N+ +N    + K    +    GK+T     +L        +++  LAN   
Sbjct: 60  MYDFQEKLVNNFHNNRFNICKMPRQS----GKSTTVVSYLLHYAIFNDSVTIGILANKAQ 115

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
             +  L          L   +    + +      W    +           ST       
Sbjct: 116 TARDLL--------GRLQIAYENLPKWMQQGIIAWNKGSMELENKSKIIAASTSASAVRG 167

Query: 179 ERPDTFVGHHNTYGMAIINDE----ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
              +            I  DE    A+   D     +   ++    +   I+ S PR ++
Sbjct: 168 MSFN-----------IIFLDEFAFVANHLADDFFSSVYPTISS-GKSTKVIIVSTPRGMN 215

Query: 235 GKFYEIFNK---PLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             FY +++      +++    +    V G D ++ E  I          RVE   +F   
Sbjct: 216 -HFYRLWHDAELGRNEYVTTDVHWSEVPGRDEAWKEQTIKN--TSEAQFRVEFECEFL-G 271

Query: 292 DIDSFIPLNIIEEALNREPC------------PDPYAPLIMGCDIAEEG--GDNTVVVLR 337
            +D+ I  + ++  +  EP             P       +  D+A       +  +V  
Sbjct: 272 SVDTLIAPSKLKTMVYDEPINTGKRGGEIYQNPIEKHNYSITVDVARGVEKDYSAFIVFD 331

Query: 338 RGPVIEHLFDWSKTDL---RTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEML 390
                  +    + +        + I+     Y    I+ + N+ G +        LE  
Sbjct: 332 TTTFPYKVVAKYRNNTIKPMLFPSVIAEFARAYNNAFILCEVNDIGDQIASILFYDLEYE 391

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQ 437
              +  V G+   V  +     + +L VKM+  ++    +N   LI+
Sbjct: 392 NVLMTAVRGRAGQVLGQGFSGSKVQLGVKMSKTVKKIGALNLKTLIE 438


>gi|323146129|gb|ADX32368.1| putative terminase ATPase subunit [Cronobacter phage ESSI-2]
          Length = 639

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 69/211 (32%), Gaps = 28/211 (13%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  E +  RY  +     +     F     DS      +
Sbjct: 377 PDGQWRYVITMEDAIAGGFNLASIEKLRNRY--NPTTFNMLYMCVFVDSK-DSVFSYGDL 433

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLF 346
           E           + P          +  G D A  G  +  V++           +  +F
Sbjct: 434 EACAVETETWQDHKPDAPRPFGDREVWGGFDPARSGDFSCFVIVAPPLFAGEKFRVLRVF 493

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
           +W   + R    +I  L +KY    + +D    G    D ++     V        AV +
Sbjct: 494 NWKGMNFRWQAKQIEQLFKKYNFAYLGVDVTGIGQGVFDNIQHFALRV--------AVPI 545

Query: 407 EFCRNRRTELHVKMADWLEFASLINHSGLIQ 437
            + RN + +L +K AD +E   +     L +
Sbjct: 546 RYDRNTKNQLVLKAADVVESQRIEWDKELKE 576


>gi|318603823|emb|CBY25321.1| phage terminase, ATPase subunit [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 257

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 47/170 (27%), Gaps = 27/170 (15%)

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDIAEEG 328
            R     +F      S  P   ++  +                   Y P+ MG D +  G
Sbjct: 31  FRNLFLCEFVDDKA-SVFPFEELQACMVDSLVEWEDFAPFAEQPFNYHPVWMGYDPSHTG 89

Query: 329 GDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
                VV+      G     L    W   D       I  L EKY  + I IDA   G  
Sbjct: 90  DSAGCVVMAPPWVPGGKFRILERHQWKGMDFADQAESIKKLTEKYNVEYIGIDATGIGQG 149

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH 432
               +               A ++ +    +T + +K  D +    L   
Sbjct: 150 VYQLVR---------NFFPAAREIRYSAEVKTNMVLKAKDLITTGRLEYD 190


>gi|120599697|ref|YP_964271.1| hypothetical protein Sputw3181_2900 [Shewanella sp. W3-18-1]
 gi|120559790|gb|ABM25717.1| protein of unknown function DUF264 [Shewanella sp. W3-18-1]
          Length = 602

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 71/208 (34%), Gaps = 32/208 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP-------- 317
            + +   Y  + D         F   D DS    + +E+ +        Y P        
Sbjct: 365 IDELRDEY--NGDDFANLFMCIFVD-DADSVFKFSDLEKCMVEAARWQDYKPAAPRPFGN 421

Query: 318 --LIMGCDIAEEGGDNTVVVL-----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             + +G D +    DN V+ +     ++G     L    W   +      +I  +  KYR
Sbjct: 422 REVWLGYDPSRT-RDNAVLAVVAPGEKKGEKFRVLERHRWRGMNFAHHVAEIQKIYAKYR 480

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
              I +D    GA   D +  L          + A  + +    +T L +KM D +E   
Sbjct: 481 VTYIGVDTTGIGAGVFDSISTL--------YPREATAIHYSVGSKTRLVLKMIDVVEGGR 532

Query: 429 LINHSGLIQ---NLKSLKSFIVPNTGEL 453
           +   +GL     +  S++  +  + G +
Sbjct: 533 IEWDAGLKDIAMSFLSIRRTVTDSGGAI 560


>gi|225872083|ref|YP_002753538.1| putative bacteriophage portal protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225792593|gb|ACO32683.1| putative bacteriophage portal protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 507

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 66/363 (18%), Positives = 111/363 (30%), Gaps = 65/363 (17%)

Query: 78  FKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN 137
           FK A+ + R IG +   A          P  +   L+ S+ Q  +  + E     +    
Sbjct: 46  FKIAVKSAR-IGFSFATALEAALDCLAHPNTTWTVLSASKAQ--SVEFIE-----TCHRL 97

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS-EERPDTFVGHHNTYGMAII 196
                  +   H   WY ++ H         ++   R  +    P T  G+        I
Sbjct: 98  IEVMTGTAELYHDEDWYDELGHIEAIQQRITFANGARIIALPANPRTARGYPGNA----I 153

Query: 197 NDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN------------ 242
            DE +   +   I   I   +   +  R     S P    GKFY++              
Sbjct: 154 LDEFAHHEESYAIWAAITRQVALGHKVRVL---STPNGEQGKFYDLCKELGLTDGVAPEN 210

Query: 243 --KPLDDWKRFQIDTR----TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
             K +  W    ID          I+      +I     D+D+   E    F +    ++
Sbjct: 211 NFKIVKGWSIHWIDAPMAIADGCPINMDEMRQLIQ----DADIVNQEFYCVFLKSG-GAW 265

Query: 297 IPLNIIEEALNREPCPD------PYAPLIMGCDIAEEGGDNT---------VVVLRRGPV 341
           IPL++I+ A +     +      P   L  G D+       T         V+V R    
Sbjct: 266 IPLDLIQRAESETATVEWPGGYAPRGRLFGGIDVGRFSNRTTFWVKEDLGDVLVTRMAMA 325

Query: 342 IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYRVLGQ 400
           I  +    + +L     K++ +          ID+   G    D L  L    V  V   
Sbjct: 326 IHEMPFPDQANLIAPWMKMTQV--------TAIDSTGMGIGLFDDLNKLCPGRVMGVNFA 377

Query: 401 KRA 403
             +
Sbjct: 378 GSS 380


>gi|198242430|ref|YP_002214959.1| hypothetical protein SeD_A1100 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|193876434|gb|ACF24836.1| ORF11 [Salmonella enterica subsp. enterica serovar Dublin]
 gi|197936946|gb|ACH74279.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622711|gb|EGE29056.1| hypothetical protein SD3246_1075 [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 423

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 64/372 (17%), Positives = 115/372 (30%), Gaps = 68/372 (18%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTT-LNAWLVLWLMSTRPGISVICLANS 116
            +E +  H        +P   K  I AGR  GKTT L      W               +
Sbjct: 6   VIEFLPFHAGQKKIYRSPAKRKV-IRAGRRFGKTTMLEQAGGNW---------------A 49

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
             Q++   +A   K L  LP+          +  +   +D +   +G     +      +
Sbjct: 50  ARQMRVGWFAPSYKIL--LPSFKTIRDLLKPITISSSKTDSIIELIGGGLVEF------W 101

Query: 177 SEERPDTFVGHHNTYGMAIINDEAS----GTPDVINLGILGFLTERNANRFWIMTSNPRR 232
           + + PD      +     +I DE S    G  D+    I   L + + +   +M   P+ 
Sbjct: 102 TLDNPDAGR---SRKYHKVIIDEGSLVKKGMRDIWEQAIEPTLLDFDGDA--VMAGTPKG 156

Query: 233 --LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
                 FY+  N     W+     T     I+P+    II   G    V + E   +F  
Sbjct: 157 VDDENFFYQACNDKSMGWEEHHAPTAANPTINPAALARIID--GRPPLVVQQEYNAEFVD 214

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEG---GDNTV-------------- 333
               +F  L+ + E       P     +    D A++G    D +               
Sbjct: 215 WRGQNFFKLDWLLENGAPVDYPFSCDTVYGVVDCAQKGKLQNDGSACIWFALDNLPSPHL 274

Query: 334 ------VVLRRGPVIEHLF-DWSKTDLRTTNNKISGLVE-KYRPDAIIIDANNTGARTCD 385
                 ++   G  ++ +   W           +S +   +     + I+   TG     
Sbjct: 275 IILDWDIIQIDGYFLKDVVPQWEGK-----AKHLSEICRARMGTTGLFIEDKATGITLLQ 329

Query: 386 YLEMLGYHVYRV 397
                G++V+ V
Sbjct: 330 QDANEGWNVHPV 341


>gi|223939800|ref|ZP_03631671.1| protein of unknown function DUF264 [bacterium Ellin514]
 gi|223891576|gb|EEF58066.1| protein of unknown function DUF264 [bacterium Ellin514]
          Length = 449

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 49/345 (14%), Positives = 101/345 (29%), Gaps = 48/345 (13%)

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS-EERPDTFVGHHNTYGMAI 195
            K W ++  +  H                   ++T  R YS    P+   G        +
Sbjct: 71  CKAWAQLLDVVAHDLGEIIFDREKKFSAYVLEFATKLRIYSLSSNPNALAGKRGH----V 126

Query: 196 INDEASGTPDV--INLGILGFLTERNA-NRFWIMTSNPRRLSGKFYEIFNKPLDD-WKRF 251
           I DE +   D   +        T                  +G  ++I ++     W   
Sbjct: 127 ILDEFALHGDQRMLYRIAKPVTTWGGQLEIISTHRGVGTVFNGIIHDIHHRGNPMGWSHH 186

Query: 252 QIDTRTVEGIDPSFHEGIIARYGL--DSDVTRVEVCGQ-------------FPQQDIDSF 296
           ++  +    I+    E I  + G     +     V  +              P  +   F
Sbjct: 187 KVTLQEA--IEQGVVERINGKTGEAESREGYLARVRAECLDEEQWLQEYCCVPADESSVF 244

Query: 297 IPLNIIEEALNREPCPDPY-----APLIMGCDIAEEGGDNTVVVLRRGPVIEHL------ 345
           I  ++I+   +       Y      PL +G D+  +  D +V+    G  +  +      
Sbjct: 245 IGYDLIDACEDDCLKDFEYLRKCENPLYLGFDVGRK-RDLSVI--DVGEKVGDVMWDRMR 301

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYHVYRVLGQKRAV 404
            + +         ++  L+E  +     IDA   G +  +  +   G+ V  V       
Sbjct: 302 IELAGKTFSEQEAELYRLLELPKLKRACIDATGLGMQLAERAKYRFGWKVEAVTFTGHVK 361

Query: 405 DLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPN 449
           + E   N R  +  +         +     L  +L+ +K  +  +
Sbjct: 362 E-ELAYNLR--MAFEDRR----VRITRDPLLRADLRGIKKEVTTS 399


>gi|223940405|ref|ZP_03632258.1| protein of unknown function DUF264 [bacterium Ellin514]
 gi|223890900|gb|EEF57408.1| protein of unknown function DUF264 [bacterium Ellin514]
          Length = 447

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 49/345 (14%), Positives = 100/345 (28%), Gaps = 48/345 (13%)

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS-EERPDTFVGHHNTYGMAI 195
            K W ++  +  H                   ++T  R YS    P+   G        +
Sbjct: 71  CKAWAQLLDVVAHDLGEIIFDREKKFSAYVLEFATKLRIYSLSSNPNALAGKRGH----V 126

Query: 196 INDEASGTPDV--INLGILGFLTERNA-NRFWIMTSNPRRLSGKFYEIFNKPLDD-WKRF 251
           I DE +   D   +        T                  +G  ++I  +     W   
Sbjct: 127 ILDEFALHGDQRMLYRIAKPVTTWGGQLEIISTHRGVGTVFNGIIHDIHQRGNPMGWSHH 186

Query: 252 QIDTRTVEGIDPSFHEGIIARYGL--DSDVTRVEVCGQ-------------FPQQDIDSF 296
           ++  +    I+    E I  + G     +     V  +              P  +   F
Sbjct: 187 KVTLQEA--IEQGVVERINEKTGEAESREGYLARVRAECLDEEQWLQEYCCVPADESSVF 244

Query: 297 IPLNIIEEALNREPCPDPY-----APLIMGCDIAEEGGDNTVVVLRRGPVIEHL------ 345
           I  ++I+   +       Y      PL +G D+  +  D +V+    G  +  +      
Sbjct: 245 IGYDLIDACEDDCLKDFEYLRKCENPLYLGFDVGRK-RDLSVI--DVGEKVGDVMWDRMR 301

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYHVYRVLGQKRAV 404
            + +         ++  L+E  +     IDA   G +  +  +   G+ V  V       
Sbjct: 302 IELAGKTFSEQEAELYRLLELPKLKRACIDATGLGMQLAERAKYRFGWKVEAVTFTGHVK 361

Query: 405 DLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPN 449
           + E   N R  +  +         +     L  +L+ +K  +  +
Sbjct: 362 E-ELAYNLR--MAFEDRR----VRITRDPLLRADLRGIKKEVTTS 399


>gi|146310462|ref|YP_001175536.1| hypothetical protein Ent638_0800 [Enterobacter sp. 638]
 gi|145317338|gb|ABP59485.1| conserved hypothetical protein [Enterobacter sp. 638]
          Length = 445

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 43/290 (14%), Positives = 83/290 (28%), Gaps = 28/290 (9%)

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
           +L      F           W        + ++      + +  + +             
Sbjct: 143 ALFWKARKFVETLPVEFRGSWDEKKHAPYMRVEFPDTGAVIKGEAGDNIGR-----GDRT 197

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                DEA+     +   I   L++    R  I  S+   +S  F +   +       F 
Sbjct: 198 TLYFVDEAAFLQRPLL--IDAALSQ--TTRCRIDLSSVNGMSNPFAQ--KRHSGKIPVFT 251

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
              R+    D  ++     +  +D+ V    E+   +        IP   ++ A++    
Sbjct: 252 FHWRSDPRKDNEWYRKECEK--IDNPVIVAQELDLNYQASAEGILIPSEWVQAAVDAHIK 309

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS--GLVEKY 367
               P    +   DIA+EG D      R G +++ + +WS        + +   G  + Y
Sbjct: 310 LGIQPSGQRLGSMDIADEGKDKNGFSSRYGFLLQSVHEWSGEGSDIYASVVKSFGYCDDY 369

Query: 368 RPDAIIIDANNTGAR------TCDYLEML----GYHVYRVLGQKRAVDLE 407
             D    D +  GA         + L               G     D E
Sbjct: 370 GLDEFRFDEDGLGAGARGDARVINELRQAEGRGTIAATPFRGSGSVFDPE 419


>gi|145636853|ref|ZP_01792518.1| terminase, ATPase subunit [Haemophilus influenzae PittHH]
 gi|145269934|gb|EDK09872.1| terminase, ATPase subunit [Haemophilus influenzae PittHH]
          Length = 593

 Score = 61.7 bits (148), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 54/375 (14%), Positives = 116/375 (30%), Gaps = 70/375 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FN+    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNRNRTK 311

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            ++ +ID                             G +    + +IA    +       
Sbjct: 312 SEKIEIDISHENLKSGKLCADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV 333
              QF   +  +F   ++    ++       Y P          + +G D A  G    +
Sbjct: 370 FLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++           + H   +   D  T  ++I    + Y    I+ID    G+     +
Sbjct: 430 VIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQFCDDYNVTRIVIDKTGMGSGVYQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKS 444
                          A  LE+  + + E+ +K  + ++   L      + ++ +  ++K 
Sbjct: 490 R---------KFYPMAQGLEYNADLKNEMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK 540

Query: 445 FIVPNTGELAIESKR 459
             +  TG++   S R
Sbjct: 541 -RITGTGKITYVSDR 554


>gi|53802921|ref|YP_115325.1| prophage MuMc02, terminase, ATPase subunit [Methylococcus
           capsulatus str. Bath]
 gi|53756682|gb|AAU90973.1| putative prophage MuMc02, terminase, ATPase subunit [Methylococcus
           capsulatus str. Bath]
          Length = 443

 Score = 61.7 bits (148), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 80/276 (28%), Gaps = 25/276 (9%)

Query: 180 RPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
            PDT  G   +    ++ DE +   D   I   +   ++  +        S P     KF
Sbjct: 114 NPDTARGFTAS----VLLDEFAFHADSRKIWQALFPVVSRSDLKLRV--ISTPNGKGNKF 167

Query: 238 YEIFNKPLDDWKRFQIDTR-TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID-- 294
           Y++       W R   D    V    P   E + A  G D D    E   Q+  +     
Sbjct: 168 YDLITGDHPVWSRHVTDIYQAVADGLPRDIEELKAGVG-DDDAWAQEYELQWLDEASAWL 226

Query: 295 SFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVV----VLRRGPVIEHLFDWSK 350
           SF  +N +E      P      P  +G DIA    D  V+     +        +    +
Sbjct: 227 SFELINSVEHDHAGIPEHYAGGPCFLGVDIAARN-DLFVIWVLEAVGDVYWTREILARRR 285

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTG-ARTCDYLEMLGYH-VYRVLGQKRAVDLEF 408
                 +  ++    +YR     +D    G     D     G   V  VL      +   
Sbjct: 286 ISFAEQDALLADAFNRYRVIRCCMDQTGMGEKPVEDAQRRFGSSRVEGVLFTG--PNKLA 343

Query: 409 CRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKS 444
                 E        +       +  L  +L  LK 
Sbjct: 344 LATTGKEAFEDRRIRIPEG----NQELRNDLHKLKK 375


>gi|145630909|ref|ZP_01786686.1| terminase, ATPase subunit [Haemophilus influenzae R3021]
 gi|144983569|gb|EDJ91037.1| terminase, ATPase subunit [Haemophilus influenzae R3021]
          Length = 593

 Score = 61.7 bits (148), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 54/375 (14%), Positives = 116/375 (30%), Gaps = 70/375 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FN+    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNRNRAK 311

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            ++ +ID                             G +    + +IA    +       
Sbjct: 312 SEKIEIDISHENLKSGKLCADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV 333
              QF   +  +F   ++    ++       Y P          + +G D A  G    +
Sbjct: 370 FLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++           + H   +   D  T  ++I    + Y    I+ID    G+     +
Sbjct: 430 VIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQFCDDYNVTRIVIDKTGMGSGVYQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKS 444
                          A  LE+  + + E+ +K  + ++   L      + ++ +  ++K 
Sbjct: 490 R---------KFYPMAQGLEYNADLKNEMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK 540

Query: 445 FIVPNTGELAIESKR 459
             +  TG++   S R
Sbjct: 541 -RITGTGKITYVSDR 554


>gi|300723941|ref|YP_003713254.1| Terminase, ATPase subunit [Xenorhabdus nematophila ATCC 19061]
 gi|297630471|emb|CBJ91136.1| Terminase, ATPase subunit (GpP) [Xenorhabdus nematophila ATCC
           19061]
          Length = 573

 Score = 61.3 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 54/144 (37%), Gaps = 23/144 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE-----------PCPDP 314
            + +  +Y    D  +  +  +F   DI+S   L +++  +                P  
Sbjct: 333 IDRLRRQY--SPDEYQNLLMCEF-MDDIESIFSLQLMQGCMVDSWEIWHDVQPLMLRPYG 389

Query: 315 YAPLIMGCDIAEEG--GDNT---VVVLRR--GPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           Y P+ +G D A+ G  GD+    V+   +  G     L    W   D R  ++ I  L E
Sbjct: 390 YHPVWIGYDPAKGGENGDSAGCVVIAPPQVPGGKFRILERHQWRGMDFRAQSDAIRQLTE 449

Query: 366 KYRPDAIIIDANNTGARTCDYLEM 389
           +Y  + I ID+   G      ++ 
Sbjct: 450 QYNVEYIGIDSTGIGHGVYQNVKE 473


>gi|120602517|ref|YP_966917.1| hypothetical protein Dvul_1472 [Desulfovibrio vulgaris DP4]
 gi|120562746|gb|ABM28490.1| protein of unknown function DUF264 [Desulfovibrio vulgaris DP4]
          Length = 599

 Score = 61.3 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 57/197 (28%), Gaps = 28/197 (14%)

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-- 306
               +      G D      +   Y    +  R     +F       F  L  +E  +  
Sbjct: 346 NIITLADAEAGGCDLFDVAQLKLEY--TPEEFRQLFGCEFIDDTQGVF-RLAQLEACMVD 402

Query: 307 --------NREPCPDPYAPLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTD 352
                     +P P    P+  G D A  G D +  VL    R G  I  +    W    
Sbjct: 403 PADWQDVRQGDPHPVGNLPVWGGYDPARSGDDASFAVLLPDLRDGGGIRCIERHKWKGRS 462

Query: 353 LRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNR 412
                 +I  L EKYR   + ID    G    + ++              A  + +    
Sbjct: 463 YLWQAERIRELAEKYRFAHLGIDTTGPGIGVFEQVQQ---------FCPVATPINYGVQS 513

Query: 413 RTELHVKMADWLEFASL 429
           +  L +K  + +E   L
Sbjct: 514 KAMLVLKAREVIEEGRL 530


>gi|120603805|ref|YP_968205.1| hypothetical protein Dvul_2767 [Desulfovibrio vulgaris DP4]
 gi|120564034|gb|ABM29778.1| protein of unknown function DUF264 [Desulfovibrio vulgaris DP4]
          Length = 599

 Score = 61.3 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 57/197 (28%), Gaps = 28/197 (14%)

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-- 306
               +      G D      +   Y    +  R     +F       F  L  +E  +  
Sbjct: 346 NIITLADAEAGGCDLFDVAQLKLEY--TPEEFRQLFGCEFIDDTQGVF-RLAQLEACMVD 402

Query: 307 --------NREPCPDPYAPLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTD 352
                     +P P    P+  G D A  G D +  VL    R G  I  +    W    
Sbjct: 403 PADWQDVRQGDPHPVGNLPVWGGYDPARSGDDASFAVLLPDLRDGGGIRCIERHKWKGRS 462

Query: 353 LRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNR 412
                 +I  L EKYR   + ID    G    + ++              A  + +    
Sbjct: 463 YLWQAERIRELAEKYRFAHLGIDTTGPGIGVFEQVQQ---------FCPVATPINYGVQS 513

Query: 413 RTELHVKMADWLEFASL 429
           +  L +K  + +E   L
Sbjct: 514 KAMLVLKAREVIEEGRL 530


>gi|302339289|ref|YP_003804495.1| hypothetical protein Spirs_2798 [Spirochaeta smaragdinae DSM 11293]
 gi|301636474|gb|ADK81901.1| conserved hypothetical protein [Spirochaeta smaragdinae DSM 11293]
          Length = 295

 Score = 61.3 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 49/257 (19%), Positives = 85/257 (33%), Gaps = 45/257 (17%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
            R  GK+T+ A           G  +I ++ +  Q K  L  +V  +++L  +      +
Sbjct: 53  CRQAGKSTVIAAKAAHKAKFFSGSLIILVSPALRQSKE-LMRKVEDFIALDKSFPPASEE 111

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
              L                       +    SE+      G        II DEAS  P
Sbjct: 112 DNQLTKE-------------FKNRSRIVALPGSEKTIRGLSGP-----TLIIIDEASRIP 153

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP- 263
           D +   I   +   +     ++ + P    G FY+ +++    W + ++  R + G  P 
Sbjct: 154 DELYKAIRPMMAGADTE--LVLMTTPFGKRGVFYDAWSRSK-RWTKIEVVGRDILGRFPN 210

Query: 264 -------SFHEGIIARYGLDSDV--------------TRVEVCGQFPQQDIDSFIPLNII 302
                     +GI A Y     V               R E  G+F    IDS   +  +
Sbjct: 211 EQVYAQLRRKDGIKACYSPRHSVEFLGEELEEMGEWWYRQEYGGEFMDP-IDSVFNMEDV 269

Query: 303 EEALNREPCPDPYAPLI 319
             A+  +     +AP+I
Sbjct: 270 RAAIINDTPAISFAPII 286


>gi|273810556|ref|YP_003344937.1| gp2 [Sodalis phage SO-1]
 gi|258619841|gb|ACV84094.1| gp2 [Sodalis phage SO-1]
          Length = 461

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 69/335 (20%), Positives = 120/335 (35%), Gaps = 46/335 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           +G G GK+ + A  V+ L++  PG   I    +   L   ++ E+ K       +  F  
Sbjct: 58  SGFGGGKSWVAARKVIQLLTLNPGHDGIVTEPTIPLLVKIMYPELEKAFDEAGFRWKFNK 117

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q           D ++  L +  K    +C   S E     +G +  +   I+ DE   T
Sbjct: 118 Q-----------DKIYSVL-VKGKWTRVICE--SMENYTRLIGVNAAW---IVADEFDTT 160

Query: 204 PDVINLGILGFLTER---NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVE 259
              + L     L  R      R +++ S P       Y+IF    D  KR  +  T    
Sbjct: 161 KQDVALAAYHKLLGRLRAGFVRQFVIVSTPEGYRAM-YQIFEVEKDSQKRLIRAKTTDNH 219

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI 319
            +   F + + ++Y   +++    + G F      +   +   EE  + E    P   LI
Sbjct: 220 HLPADFIDTLRSQY--PANLIDAYLNGLFVNLTSGAVYKMFNREENASTEEVQ-PEDTLI 276

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-------TDLRTTNNKISGLVEKYR---- 368
           +G D         VV +RR  + E+     +        DL  T   I  + E+Y     
Sbjct: 277 IGMDFNVTKM-AAVVYVRRQRITENKEFLDEIHAVDEFVDLFDTPAMIEAIEERYPDHCA 335

Query: 369 PDAIII--DANN-----TGARTCD--YLEMLGYHV 394
              +++  D++        A + D   LE  G+ V
Sbjct: 336 AGRVVVYPDSSGKSRKTVNASSSDIAQLEDAGFEV 370


>gi|330874284|gb|EGH08433.1| hypothetical protein PSYMP_06646 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 684

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKNAKEPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DDDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|301386048|ref|ZP_07234466.1| hypothetical protein PsyrptM_25573 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060830|ref|ZP_07252371.1| hypothetical protein PsyrptK_12639 [Pseudomonas syringae pv. tomato
           K40]
 gi|302129770|ref|ZP_07255760.1| hypothetical protein PsyrptN_00140 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 684

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKAAKDPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DDDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|152973346|ref|YP_001337126.1| putative prophage large terminase protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150958195|gb|ABR80225.1| putative prophage large terminase protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 589

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 58/207 (28%), Gaps = 30/207 (14%)

Query: 244 PLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W++   I+     G      E +     +D    R     +F      S  P   +
Sbjct: 328 PDGQWRQIVTIEDALAGGCTLFNLEQLKRENSVDD--FRNLFMCEFVDDKA-SVFPFEDL 384

Query: 303 EEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL----RRGPVIEHL-- 345
           +  +                     P+ +G D +  G     VVL      G     L  
Sbjct: 385 QRCMVDSLEEWEDFAPFADNPFGSRPVWVGYDPSHSGDSAGCVVLAPPVVAGGKFRILER 444

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
             W   D  T    I  L EKY  + I IDA   G      +               A D
Sbjct: 445 HQWKGMDFATQAESIRQLTEKYNVEYIGIDATGLGIGVFQLVR---------SFYPAARD 495

Query: 406 LEFCRNRRTELHVKMADWLEFASLINH 432
           + +    +T + +K  D +    L   
Sbjct: 496 IRYTPEMKTAMVLKAKDVIRRGCLEYD 522


>gi|296141561|ref|YP_003648804.1| terminase [Tsukamurella paurometabola DSM 20162]
 gi|296029695|gb|ADG80465.1| Terminase [Tsukamurella paurometabola DSM 20162]
          Length = 489

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 77/407 (18%), Positives = 115/407 (28%), Gaps = 74/407 (18%)

Query: 28  FSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRG 87
           F  F   F     KGT  +G    R WQ++    V      +V    P          RG
Sbjct: 27  FLAFADKFLR-VPKGTGAKGKLHLRDWQVDVARDVLDSGARTVGIMFP----------RG 75

Query: 88  IGKTTLNAWLVLWLMST-RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
            GKTTLNA + L+   T   G +V  +A  E Q            L+    +   E+   
Sbjct: 76  QGKTTLNAAIALYRFFTGGEGANVCVVAVDERQAG----------LAFSAARRMVELNEE 125

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV 206
                  + D L+    + +      C   S   P    G      +  + DEA      
Sbjct: 126 LSARCQIFKDRLY----LPTTDSVFQCLPAS---PTALEGL---DYVLALVDEAGVVNRD 175

Query: 207 INLGILGFLTERNANRFWIMTSNPRRLSG--------KFYEIFNKPLD-DWKRFQI---- 253
           +   +      +      +    P              ++          W+ F      
Sbjct: 176 VFEVVQLA-QGKREKSVLVAIGTPGPNLDDQVLLSLRDYHLEHPDDASLRWREFSAAGFE 234

Query: 254 -----DTRTVEGIDPSFHEGIIAR--------YGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
                 T   E  +P+  + +              +S   R     QF      SF+P  
Sbjct: 235 DHPVDCTHCWELANPALDDFLHRDALVALLPPKTRESTFRRAR-LCQFAADTEGSFLPAG 293

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR---GPVIEHLFDWSKTDLR--- 354
           + E     EP P   A +++  D      D T ++L      P    L  W +       
Sbjct: 294 VWEGLSTGEPVP-LGAEVVIALD-GSFSDDTTALLLGTVAAAPHFHPLRVWERPADNDDW 351

Query: 355 -----TTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                   N I      Y+   II D      RT   LE  G  V  
Sbjct: 352 RVPVLEVENTIRQACRDYQVVEIIADPFRW-TRTLQVLEQEGLPVVE 397


>gi|114046227|ref|YP_736777.1| hypothetical protein Shewmr7_0720 [Shewanella sp. MR-7]
 gi|113887669|gb|ABI41720.1| protein of unknown function DUF264 [Shewanella sp. MR-7]
          Length = 602

 Score = 61.3 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 54/164 (32%), Gaps = 20/164 (12%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    I+     G D    + +   Y  + D         F   D DS    + +
Sbjct: 342 PDKQWRYVVTIEDALAGGCDLFDIDELREEY--NGDDFNNLFMCIFVD-DADSVFKFSDL 398

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL----RRGPVIEHLFD- 347
           E+ +        + P          + +G D +    + T+VV+    ++G     L   
Sbjct: 399 EKCMVDAARWQDHKPAAPRPFGNREVWLGYDPSRTRDNATLVVVAPGEKKGEKFRVLEKH 458

Query: 348 -WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
            W   +      +I  +  KYR   I +D    GA   D +  L
Sbjct: 459 YWRGMNFSHHVAEIQKIYAKYRVTYIGVDTTGIGAGVFDSISTL 502


>gi|291334706|gb|ADD94352.1| hypothetical protein Ddes_0719 [uncultured phage
           MedDCM-OCT-S04-C890]
          Length = 311

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/266 (13%), Positives = 81/266 (30%), Gaps = 32/266 (12%)

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
                 +A +  Q K+  W  + ++ + +PN  + E +     P      +L        
Sbjct: 6   NPRFAYIAPTFKQAKSIAWDYMKQFTAKIPNTKFNETELRVDLPNGSRITLLG------- 58

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN-LGILGFLTERNANRFWI 225
                       E  D   G +       + DE +     +    I   L++R    + +
Sbjct: 59  -----------AENSDGLRGIYLDGC---VIDEYANIDGKLFAEIIRPALSDR--KGYCV 102

Query: 226 MTSNPRRLSGKFYEIFNKPLD--DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
               P  ++  FY+++       DW  ++      + +DP   E      G        E
Sbjct: 103 FIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK--YLQE 160

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE---GGDNTVVVLRRGP 340
               +      +     I +     +    PY P  +    A +      ++++  ++  
Sbjct: 161 FECDWIANIEGAIYGEEIAKIEDKNQIARVPYDP-TLPVSTAWDLGVADHSSIIFFQQKG 219

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEK 366
               + D+ +       + I  L EK
Sbjct: 220 TGVQIIDYHEERGHGLPHYIQMLEEK 245


>gi|330830158|ref|YP_004393110.1| phage-related terminase [Aeromonas veronii B565]
 gi|328805294|gb|AEB50493.1| Phage-related terminase [Aeromonas veronii B565]
          Length = 588

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 67/210 (31%), Gaps = 35/210 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-NREPCPDPYAP------- 317
            + + + Y  D    R  +  +F      S  PL  ++  + +     + Y P       
Sbjct: 349 LDQLRSEYSEDE--YRNLLMCEFMDDTE-SLFPLATLQRCMVDSWLVWEDYKPHTLRPLA 405

Query: 318 ---LIMGCDIAEEGGDNTV--------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEK 366
              + +G D A+ G  ++         +V      +     W   D       I  + ++
Sbjct: 406 NRAVWIGYDPAKGGKGDSAGCAVLAPPLVPGGKFRVLERHRWQGMDFDAQAKSIRAICDR 465

Query: 367 YRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF 426
           Y    I ID    G      ++                 +++  N +  + +K  D +  
Sbjct: 466 YNVAYIGIDTTGIGEGVYQLVKQ---------FYPAVTAIQYNPNVKMRMVMKAQDVMNK 516

Query: 427 ASLINHSG---LIQNLKSLKSFIVPNTGEL 453
             L   SG   L Q   S++   V  +G+L
Sbjct: 517 GRLEFDSGWTDLAQAFMSIRR-AVTQSGKL 545


>gi|330939345|gb|EGH42730.1| hypothetical protein PSYPI_10145 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 650

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKAAKDPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DDDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|330985172|gb|EGH83275.1| hypothetical protein PLA107_09108 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 684

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKAAKDPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DDDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|331017153|gb|EGH97209.1| hypothetical protein PLA106_13994 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 684

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKAAKDPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DDDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|190890121|ref|YP_001976663.1| hypothetical protein RHECIAT_CH0000492 [Rhizobium etli CIAT 652]
 gi|190695400|gb|ACE89485.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 465

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 58/406 (14%), Positives = 128/406 (31%), Gaps = 61/406 (15%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPG---------ISVICLANSETQLKTTLWAEVSKWLSLL 135
           GR  GK+   A + ++L                +V+ +A    Q +  L   V    ++L
Sbjct: 68  GRRGGKSFTMALIAVFLACFFDYRQYLAPGERATVLVIATDRRQARVIL-RYVR---AML 123

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
            N    +          +  D        +S        ++   R  T+           
Sbjct: 124 DNIPLLQAMVERDTADSFDLD--------NSTTIEVGTASFRSTRGYTYAAVLCDELAFW 175

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
             D+A+     I   I   +     N   +  S+P    G  ++ F +         +  
Sbjct: 176 RTDDAAEPDYAILDAIRPGMASI-PNSMLLCASSPHARRGALWDAFKRFWGKDDAPLVWR 234

Query: 256 RTVEGIDPSFHEGIIAR-YGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR---EPC 311
                ++P+  + ++ R    D      E   +F + DI+ F+ + ++E+ ++R   E  
Sbjct: 235 AATREMNPTISQSVVDRALERDHASAMAEYGAEF-RSDIEQFVNIEVVEDCVSRGVYERA 293

Query: 312 PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-----TDLRTTNNKISGLVEK 366
           P P        D +    D+  + +       ++ D  +         +   + +  + K
Sbjct: 294 PLPNIRYRAFVDPSGGSNDSMTLAIGHKEGERNILDCVRERKPPFSPESVVAEFADTLAK 353

Query: 367 YRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF 426
           YR   +               +       R   +K+ +  +     R++L+  M   L  
Sbjct: 354 YRVREV-------------EGDRYAGEWPREQFRKKGITYKIAEKPRSDLYRDMLPLLNS 400

Query: 427 A--SLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAK-STDYS 469
               L++   L+  +               +E +  +G K S D++
Sbjct: 401 GVADLLDSDRLVTQIVG-------------LERRVSRGGKESIDHA 433


>gi|83943081|ref|ZP_00955541.1| hypothetical protein EE36_12908 [Sulfitobacter sp. EE-36]
 gi|83846089|gb|EAP83966.1| hypothetical protein EE36_12908 [Sulfitobacter sp. EE-36]
          Length = 259

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 45/260 (17%), Positives = 75/260 (28%), Gaps = 40/260 (15%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             P +WQ++ +        +  +N    +      +GR  GK+T    L         G 
Sbjct: 30  GEPDAWQVDLLRS------DPRSNEADRMILAL--SGRQSGKSTTAGGLG--YDDFSRGK 79

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLP-NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
           +VI  A S  Q  T L+  + ++ +  P            L   P +   +      D  
Sbjct: 80  TVILTAPSLRQ-STELFRRILEYKNTDPFCPPIVRQTQTELEAHPRHGGRIIVVPATDQ- 137

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
                 R  + +               II DEA    D           E        + 
Sbjct: 138 -----ARGMTAD--------------TIIADEACFLDDDALTAFFPMRKETG---RIFLL 175

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
           S P    G FYE +       +R    +  +     +  E   A   +     R E   +
Sbjct: 176 STPNMRQGYFYETWTSAKRV-RRITARSIDIPR-RKAQVEFDKAT--MSEATFRREHLCE 231

Query: 288 FPQQDIDSFIPLNIIEEALN 307
           F        +    +E+A N
Sbjct: 232 FI-GAGTPLVSWEALEKASN 250


>gi|332185581|ref|ZP_08387329.1| terminase-like family protein [Sphingomonas sp. S17]
 gi|332014559|gb|EGI56616.1| terminase-like family protein [Sphingomonas sp. S17]
          Length = 436

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 68/409 (16%), Positives = 134/409 (32%), Gaps = 58/409 (14%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I AGRG GKT   A  V  L    PG  +  +  +   ++  +          +  +   
Sbjct: 60  IRAGRGFGKTRAGAEWVSALARDNPGARIALMGATLRDVERVM----------VRGESGL 109

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG--HHNTY--GMAIIN 197
              +       W   +        +  ++     YS   P+   G  HH  +   +    
Sbjct: 110 LAVARKGEAPKWIGSLGQVHFTSGAIGFA-----YSAAAPEALRGPQHHAAWCDELGKWK 164

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
            EA G  +++    LG       +   ++T+ PR        +  K +      +   RT
Sbjct: 165 GEA-GWDNLMMTLRLG------EHPRVLVTTTPRATP-----LMRKVMALPDCVETIGRT 212

Query: 258 VE--GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
            +   +  SF + ++++YG D+ + R E+ G+       +     +++    R       
Sbjct: 213 SDNAHLPDSFQDAMLSQYG-DTRLGRQELDGEMVDDREGALWTRALLDR--QRVKTVPAL 269

Query: 316 APLIMGCD-IAEEGGDNTVVV---LRRGPVIEHLFDWSKTDLRTT--NNKISGLVEKYRP 369
             +++G D  A   GD   +V   L R      L D S+  L       +++G   + R 
Sbjct: 270 DRVVVGVDPPATSSGDACGIVAVGLGRDGHGYVLEDASEAGLSPEGWAARVAGCARRNRA 329

Query: 370 DAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL 429
           D ++ + N  G    + +  L      V     ++         + L+ +   W      
Sbjct: 330 DRVVAERNQ-GGDMVESVLRLADPTLPVHLVYASIGKAARAEPVSFLYAQGRVW-HARGF 387

Query: 430 INHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                 +  L    ++  P                S D +D L++   E
Sbjct: 388 PALEDELCGLGVAGAYDGP--------------GHSPDRADALVWALTE 422


>gi|320172719|gb|EFW47954.1| Phage terminase, ATPase subunit [Shigella dysenteriae CDC 74-1112]
          Length = 590

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 61/209 (29%), Gaps = 33/209 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGELA 454
            + +     ++ S        + ++G +A
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGRIA 546


>gi|239502629|ref|ZP_04661939.1| hypothetical protein AbauAB_09982 [Acinetobacter baumannii AB900]
          Length = 414

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 49/307 (15%), Positives = 98/307 (31%), Gaps = 38/307 (12%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           + AGR  GKT+L+  L++   S +P   +  +A +    K  +W ++             
Sbjct: 26  VVAGRRWGKTSLSRTLII-SKSRKPRQRIWYVAPTYRMAKQIMWKDL------------- 71

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
               +   P  W   + H SL I+  +  T+      + PD+  G        ++ DE  
Sbjct: 72  ----IEAIPRKWVVKINHSSLSIELVN-GTLIELKGADDPDSLRGVGID---FLVLDEFQ 123

Query: 202 GTPDVINL-GILGFLTERNANRFWIMTSNPRRLSGKF------YEIFNKPLDDWKRFQID 254
              +      +   L     +  +     P+  +  +       +        W+ +Q  
Sbjct: 124 DISEEAWTQCLRPTLASTGGHAIF--IGTPKAYNQLYTVYMQGQDPKKVKAGQWQSWQFP 181

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
           T T   I  S  E   A     S   + E    F       + P +  E     +   DP
Sbjct: 182 TITSPFIPESEIEAARADMDEKS--FKQEFLASFETMSGRVYYPFDRKEH--VGKYPFDP 237

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--SKTDLRTTNNKISGLVEKY-RPDA 371
             P+ +G D   +     ++  +    +  + +     ++      +I     +Y +   
Sbjct: 238 KLPIWIGMDFNIDPMSTVIMQPQPNGEVWVVDEIVQFGSNTEEICEEIERKYWRYMKQIV 297

Query: 372 IIIDANN 378
           I  D   
Sbjct: 298 IFPDPAG 304


>gi|291336431|gb|ADD95986.1| hypothetical protein Ddes_0719 [uncultured organism
           MedDCM-OCT-S04-C1073]
          Length = 311

 Score = 60.9 bits (146), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 37/266 (13%), Positives = 81/266 (30%), Gaps = 32/266 (12%)

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
                 +A +  Q K+  W  + ++ + +PN  + E +     P      +L        
Sbjct: 6   NPRYAYIAPTFKQAKSIAWDYMKQFTAKIPNTKFNETELRVDLPNGSRITLLG------- 58

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN-LGILGFLTERNANRFWI 225
                       E  D   G +       + DE +     +    I   L++R    + +
Sbjct: 59  -----------AENSDGLRGIYLDGC---VIDEYANIDGKLFAEIIRPALSDR--KGYCV 102

Query: 226 MTSNPRRLSGKFYEIFNKPLD--DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
               P  ++  FY+++       DW  ++      + +DP   E      G        E
Sbjct: 103 FIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK--YLQE 160

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE---GGDNTVVVLRRGP 340
               +      +     I +     +    PY P  +    A +      ++++  ++  
Sbjct: 161 FECDWIANIEGAIYGEEIAKIEDKNQIARVPYDP-TLPVSTAWDLGVADHSSIIFFQQKG 219

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEK 366
               + D+ +       + I  L EK
Sbjct: 220 TGVQIIDYHEERGHGLPHYIQMLEEK 245


>gi|67920466|ref|ZP_00513986.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gi|67857950|gb|EAM53189.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
          Length = 244

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 74/234 (31%), Gaps = 37/234 (15%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP-------------GISVICLANSETQL 120
           +P+ F+  +  GR  GK+ L     +      P               +V+    +  Q 
Sbjct: 18  DPQKFQVLV-CGRRFGKSHLQVTKHVIDCLMFPKLMPGYNVKQQTMETAVLVGMPTLKQA 76

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           +  LW  + K L   P          ++       D++   L  ++   +   + +    
Sbjct: 77  RKILWKPLVKTLENCPYVDKISRSDYTIRFKGNRPDIILAGLNDNAGDRARGLKLWR--- 133

Query: 181 PDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
                         +  DE     P VI+  I+  + +   +   + T  P+  +   Y 
Sbjct: 134 --------------VCIDEVQDVRPSVIDAVIIPAMADT-PHSRALFTGTPKGKNNHLYN 178

Query: 240 IFN--KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
           +F   +  DDWK +   T T   I     E    R  L   +   E   Q+ + 
Sbjct: 179 LFTMERDNDDWKSYNFPTWTNPLISKDEVERARKR--LSPRLFSQEFEAQWKES 230


>gi|294085818|ref|YP_003552578.1| hypothetical protein SAR116_2251 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665393|gb|ADE40494.1| protein of unknown function DUF264 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 454

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 74/401 (18%), Positives = 133/401 (33%), Gaps = 54/401 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           AGRG GKT   A  + WL  +     +  +  +    +  +    S  LS+ PN      
Sbjct: 82  AGRGFGKTRAGAEWIRWLAQSGRARRIALVGETFDDARQVMVEGASGILSVCPN------ 135

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE-ASG 202
                    W                 T+ R YS + P+   G    YG     DE A  
Sbjct: 136 ---------WARPAWRAGQRTLIWPSGTIARCYSADDPEQLRGPEFDYG---WADEIAKW 183

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVE-GI 261
                   ++  L     +   I T+ P R      ++     +D    Q  +R     +
Sbjct: 184 RYPSAWDNLMLAL-RIGKSPQCIATTTP-RPVRWLADL--AAAEDTVLVQGASRENAANL 239

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMG 321
            P+F   +  R+G DS + R E+ G       D+    N I       P    +  +++G
Sbjct: 240 SPAFMAAMHRRFG-DSYLARQELEGIMMSNLPDALWCRNDILRLHRPMPKRHRFIRIVIG 298

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK----ISGLVEKYRPDAIIIDAN 377
            D A  GGD T ++        H++  +   L  T ++    I  +  ++R D++I + N
Sbjct: 299 VDPAMGGGDETGIITAGKDQDGHIWILADDSLHATPDRWAVQIQRVFRQWRADSVIAEIN 358

Query: 378 NTGARTCDYLEMLG--YHVYRVLG-QKRAVDLEFCRNRRTELHVKMADWLEFASLINHSG 434
             G+     L   G    V  V   + +++  E            ++   +F +L +   
Sbjct: 359 QGGSLIRTLLAQAGCALPVREVRAMRSKSIRAEPVA--AAYARGDVSHAGQFGALED--- 413

Query: 435 LIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
               + +                   +   S D  D +++ 
Sbjct: 414 ---QMCACVP--------------GQRQTPSPDRLDAMVWA 437


>gi|126173520|ref|YP_001049669.1| hypothetical protein Sbal_1282 [Shewanella baltica OS155]
 gi|125996725|gb|ABN60800.1| protein of unknown function DUF264 [Shewanella baltica OS155]
          Length = 602

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 71/207 (34%), Gaps = 30/207 (14%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP-------- 317
            + +   Y  + D         F   D DS    + +E+ +        Y P        
Sbjct: 365 IDELRDEY--NGDDFANLFMCIFVD-DADSVFKFSDLEKCMVEAARWQDYKPAAPRPFGN 421

Query: 318 --LIMGCDIAEEGGDNTVVVL----RRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRP 369
             + +G D +    + T+VV+    ++G     L    W   +      +I  +  KYR 
Sbjct: 422 REVWLGYDPSRTRDNATLVVVAPGEKKGEKFRVLEKHYWRGMNFSHHVAEIQKIYAKYRV 481

Query: 370 DAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL 429
             I +D    GA   D +  L          + A  + +    +T L +KM D +E   +
Sbjct: 482 TYIGVDTTGIGAGVFDSISTL--------YPREATAIHYSVGSKTRLVLKMIDVIEGGRI 533

Query: 430 I---NHSGLIQNLKSLKSFIVPNTGEL 453
                H  +  +  S++  +  + G +
Sbjct: 534 EWDAGHKDIAMSCLSIRRTVTDSGGAI 560


>gi|152985800|ref|YP_001350388.1| hypothetical protein PSPA7_5052 [Pseudomonas aeruginosa PA7]
 gi|152986886|ref|YP_001346099.1| hypothetical protein PSPA7_0704 [Pseudomonas aeruginosa PA7]
 gi|150960958|gb|ABR82983.1| conserved hypothetical protein, putative [Pseudomonas aeruginosa
           PA7]
 gi|150962044|gb|ABR84069.1| conserved hypothetical protein, putative [Pseudomonas aeruginosa
           PA7]
          Length = 682

 Score = 60.5 bits (145), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 53/179 (29%), Gaps = 20/179 (11%)

Query: 244 PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W++   I      G +    E +   Y  D +        +F      +F  L  +
Sbjct: 340 PDGQWRKVITIQDAIAGGCNLFDLERLQLEY--DEERFEQLFMCKFIDSTQAAF-ALADL 396

Query: 303 EEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEHLFD- 347
           E   +            P P    P+ +G D +    D T VV    L  G     L   
Sbjct: 397 ERCYSDLGLWTDYDPDSPRPFDNRPVWLGYDPSRTRDDATCVVVAPPLEPGGKFRILEKH 456

Query: 348 -WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
            W  T       +I  L E++    I ID    G    D ++        +     A +
Sbjct: 457 SWRGTSFTHQAKQIEKLCERFNVQHIGIDITGVGYGVFDLVKDFFPRATPIHYSLEAKN 515


>gi|260582917|ref|ZP_05850701.1| terminase ATPase subunit [Haemophilus influenzae NT127]
 gi|260094017|gb|EEW77921.1| terminase ATPase subunit [Haemophilus influenzae NT127]
          Length = 593

 Score = 60.1 bits (144), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 73/219 (33%), Gaps = 31/219 (14%)

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP-- 317
           G +    + +IA    +          QF   +  +F   ++    ++       Y P  
Sbjct: 348 GCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKPFY 405

Query: 318 --------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
                   + +G D A  G    +V++           + H   +   D  T  ++I   
Sbjct: 406 QRPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQF 465

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            + Y    I+ID    G+     +               A  LE+  + + E+ +K  + 
Sbjct: 466 CDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMAQGLEYNADLKNEMVLKTQNL 516

Query: 424 LEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESKR 459
           ++   L      + ++ +  ++K   +  TG++   S R
Sbjct: 517 IQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDR 554


>gi|332654528|ref|ZP_08420271.1| phage terminase, large subunit, PBSX family [Ruminococcaceae
           bacterium D16]
 gi|332516492|gb|EGJ46098.1| phage terminase, large subunit, PBSX family [Ruminococcaceae
           bacterium D16]
          Length = 418

 Score = 60.1 bits (144), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 55/347 (15%), Positives = 112/347 (32%), Gaps = 46/347 (13%)

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVL-WLMSTRPGISVICLANSETQLKTTLWA 126
           +   N    +  GA+ +    GKT         W MS     +      S   ++  L +
Sbjct: 21  SPFRNCQAIICDGAVRS----GKTLCTGLSFFCWAMSCYQDKTFALCGKSIPSVRRNLLS 76

Query: 127 EVSKWLSLL--PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
           E+   L  L    +       L++      S+  +   G+D        R+ +  +  T 
Sbjct: 77  ELLPILRQLGFSCRERASRNQLTVTM-GHRSNTFYLFGGLDE-------RSAALVQGITL 128

Query: 185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
            G         + DE +  P      +    +   + R W    NP   +  FY+ + + 
Sbjct: 129 AGA--------LLDEVALMPRSFVEQVCARCSVEGS-RLWFSC-NPESPAHWFYQEWIQK 178

Query: 245 LDDWKRFQID--TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS--FIPLN 300
            ++ K  ++         + P+  E     +       R  V G++   +     F   +
Sbjct: 179 AEEKKVLRLSFAMTDNPSLSPAMLERYRTMF--QGAFYRRFVLGEWVNAEGLVYDFFSQD 236

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW--------SKTD 352
           ++     REP  D   P  + CD       +  +  R+  V   L ++         +  
Sbjct: 237 LV-----REPPLDVSGPFYVSCDYGTVNPTSMGLWGRKNGVWYRLEEYYYNSRQARRQKT 291

Query: 353 LRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLG 399
            +   + +  LV+     A+++D +   A   + L   G  V +   
Sbjct: 292 DQEYADDLGALVKGRPLGAVVVDPSA--ASFIEVLRRRGVPVRKANN 336


>gi|289628558|ref|ZP_06461512.1| hypothetical protein PsyrpaN_26063 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648058|ref|ZP_06479401.1| hypothetical protein Psyrpa2_09957 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330870325|gb|EGH05034.1| hypothetical protein PSYAE_24348 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 684

 Score = 60.1 bits (144), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 54/306 (17%), Positives = 86/306 (28%), Gaps = 56/306 (18%)

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT-YSEERPDTFVGHHN 189
           +LS    +       +      W+   L  +  + SK         +      T  GHH 
Sbjct: 206 FLSASRAQSEIFRSYIIAFAQSWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHG 265

Query: 190 TYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFN 242
                +  DE     D   +N       T +   +     S P  +S + Y     E F 
Sbjct: 266 H----VYVDEYFWIRDFEKLNTVASAMATHKKWRKT--YFSTPSAVSHQAYPFWQGEKFR 319

Query: 243 K----------------------PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
                                  P   W++   I      G D    E +   Y  D D 
Sbjct: 320 NSKRKAAKDPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY--DEDK 377

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGG 329
            +     +F      +F  L  +E   +           +P P   +P+ +G D +    
Sbjct: 378 FQQLFMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRD 436

Query: 330 DNTVVV----LRRGPVIEHLFD--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           D T VV    L  G     L    W     +    ++  L E++    I ID    G   
Sbjct: 437 DATCVVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGV 496

Query: 384 CDYLEM 389
            D +  
Sbjct: 497 FDLVRD 502


>gi|116751218|ref|YP_847905.1| hypothetical protein Sfum_3801 [Syntrophobacter fumaroxidans MPOB]
 gi|116700282|gb|ABK19470.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 507

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 62/394 (15%), Positives = 108/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L       
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHLDTII-EEIEFQLDSNPD----LMNSIALTKYGKPK 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     D +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSDQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSELRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGG-------DNTVVVLRRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+              T +  R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQETEIGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|170748408|ref|YP_001754668.1| hypothetical protein Mrad2831_1990 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654930|gb|ACB23985.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 478

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 52/334 (15%), Positives = 106/334 (31%), Gaps = 35/334 (10%)

Query: 154 YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILG 213
            S+ +    G+D +      +T    R +T  G           + ++    +I   +  
Sbjct: 145 TSETIRLLSGVDIEVRPANYKTI---RGETLAGCLADEVAFWHLENSANPDTLILDAVRP 201

Query: 214 FLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI------DTRTVEGIDPSFHE 267
            L          + S+P    G+ Y    +         +             +DP+  +
Sbjct: 202 GLATTGGP--LCVLSSPYARKGELYRTHQRDFGPSGDPAVLVLRAPSQTMNPSLDPAVVK 259

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN---REPCPDPYAPLIMGCDI 324
                Y  D      E   +F + D+++FI L  ++  +     E  P P       CD 
Sbjct: 260 ---RAYTRDPAAASAEYGAEF-RADVEAFISLEAVQACMAGDLLERAPAPGLTYQAFCDP 315

Query: 325 AEEGGDNTVVVLRRGPVIEHLFD-----WSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +  G D+  + +          D     +         +  + L++ Y   ++  D    
Sbjct: 316 SGGGADSMTLAIGHAENGIAYLDAVREMYPGGSPEAVVSTFAELLQSYGLGSVTGDHY-A 374

Query: 380 GARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNL 439
           G    +   + G    R    K  +  EF     ++   +         ++  + L   L
Sbjct: 375 GEWPKERFRVHGITYERSERSKSDIYREFLPVLNSQ---RCR-------MLPVAKLEAQL 424

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLM 473
            SL+      TG+  I+  +VKGA   D ++ + 
Sbjct: 425 VSLERRTTRGTGKDTIDHPQVKGAHD-DVANAVA 457


>gi|323699495|ref|ZP_08111407.1| protein of unknown function DUF264 [Desulfovibrio sp. ND132]
 gi|323459427|gb|EGB15292.1| protein of unknown function DUF264 [Desulfovibrio desulfuricans
           ND132]
          Length = 428

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 55/334 (16%), Positives = 98/334 (29%), Gaps = 43/334 (12%)

Query: 79  KGAISAGRG-IGKTTLN-AWLVLWLMSTR-PGISVICLANSETQLKTTLWAEVSKWLSLL 135
           + A+       GKT L+   L+     TR        +A    Q KT +W E+ ++    
Sbjct: 21  RFAVLVCHRRFGKTVLSVNRLINAARETRRDDWRGAYIAPLYRQAKTVVWDELKRY---- 76

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
                 +  ++  +     +D  + S            R +    PD+  G +      +
Sbjct: 77  -CGFGLDGCTVKFNETELRADFDNGSR----------IRLFGANNPDSLRGMYLDG---V 122

Query: 196 INDEASGTPDVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQ 252
           + DE +  P  +    I   L++R     +     PR  +   YEI+ K     DW    
Sbjct: 123 VFDEVAQMPLRVWTEVIRPALSDRKGWAMF--IGTPRGKNA-LYEIWEKGKTDPDWLAAM 179

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL---NIIEEALNRE 309
                   +     E       +  +    E    F      ++      +   E    +
Sbjct: 180 YRASETGILPVEELEASARE--MSPEEYEQEFECSFTAAIRGAYFGQLLADADREGRMTD 237

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVL---RRGPVIEHLFDWS--KTDLRTTNNKISGLV 364
              DP  P+    D+     D+T +     R G     +  +      L      +    
Sbjct: 238 VPADPSMPVHTAWDLGM--SDSTSIWFVQARPGGTFAVIDYYEACGEGLDHYARILDDKG 295

Query: 365 EKYR----PDAIIIDANNTGARTCDYLEMLGYHV 394
            KY     P  I +    TG    +    LG   
Sbjct: 296 YKYGTHIAPHDIRVRELGTGKSRLETARSLGIRF 329


>gi|145639982|ref|ZP_01795581.1| terminase, ATPase subunit [Haemophilus influenzae PittII]
 gi|145270948|gb|EDK10866.1| terminase, ATPase subunit [Haemophilus influenzae PittII]
 gi|309751635|gb|ADO81619.1| Probable bacteriophage terminase, ATPase subunit [Haemophilus
           influenzae R2866]
          Length = 591

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 55/373 (14%), Positives = 118/373 (31%), Gaps = 68/373 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FNK    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNKNRAK 311

Query: 248 -----------------------WKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                                  WK+   I+     G +    + +IA    +       
Sbjct: 312 ADKVEIDISHENLRIGKLCADRQWKQIVTINDAMEGGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQD-------IDSFIPLNIIEEALNREP---CPDPYAPLIMGCDIAEEGGDNT- 332
              QF   +             ++ +EE  + +P    P     + +G D A  G     
Sbjct: 370 FLCQFADDNTSAFKFADLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 333 -VVVLRR----GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            ++   +       + H   +   D     ++I    + Y    I+ID    G+     +
Sbjct: 430 AIIAPPKVEGGDYRVLHWQTFHGMDYEAQASRIKSFCDDYNVTRIVIDKTGMGSGVFQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL-INHSGLIQNLKSLKSFI 446
           +              A+ L++  + + E+ +K  + ++   L  + + +I +  ++K   
Sbjct: 490 K---------KFYPMAIGLDYNADLKNEMVLKTQNLIQKRRLKFDGNEIITSFMTVKK-R 539

Query: 447 VPNTGELAIESKR 459
           +  TG++   S R
Sbjct: 540 ITGTGKITYVSDR 552


>gi|229845311|ref|ZP_04465443.1| terminase, ATPase subunit [Haemophilus influenzae 6P18H1]
 gi|229811764|gb|EEP47461.1| terminase, ATPase subunit [Haemophilus influenzae 6P18H1]
          Length = 593

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 54/374 (14%), Positives = 114/374 (30%), Gaps = 70/374 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FN+    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNRNRAK 311

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            ++ +ID                             G +    + +IA    +       
Sbjct: 312 SEKIEIDISHENLKSGKLCADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV 333
              QF   +  +F   ++    ++       Y P          + +G D A  G    +
Sbjct: 370 FLCQFADDNSSAFKFADLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++           + H   +   D  T  ++I    E Y    I+ID    G      +
Sbjct: 430 VIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQFCEDYNVTRIVIDKTGMGTGVYQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKS 444
                          A  LE+  + + E+ +K  + ++   L      + ++ +  ++K 
Sbjct: 490 R---------KFYPMAQGLEYNADLKNEMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK 540

Query: 445 FIVPNTGELAIESK 458
             +  TG++   S 
Sbjct: 541 -RITGTGKITYVSD 553


>gi|301155044|emb|CBW14507.1| terminase, atpase subunit [Haemophilus parainfluenzae T3T1]
          Length = 591

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 53/373 (14%), Positives = 116/373 (31%), Gaps = 68/373 (18%)

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
              K   + +S  ++ A   +DV      I   + + +   +      T   +H      
Sbjct: 200 ASKKQALQFRSYIVNYAKQTADVDLKGETIKLPNGAEL--IFLGTNSATAQSYHGN---- 253

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  DV+     G   ++   +     S P  ++   Y     + FNK    
Sbjct: 254 LYFDEVFWVPKFDVMRKVASGMAAQKMYRQT--YFSTPTTIAHPAYAFFSGKAFNKNRAK 311

Query: 248 WKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDSDVTRVE 283
             + +ID                             G +    + +IA    +       
Sbjct: 312 ADKVEIDISHENLKSGKLCADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEE--FEQL 369

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNT- 332
              QF   +  +F   ++    ++       Y P          + +G D A  G     
Sbjct: 370 FLCQFADDNSSAFKFADLQLCQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAAL 429

Query: 333 -VVVLRR----GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            ++   +       + H   +   D     ++I    + Y    I+ID    G+     +
Sbjct: 430 AIIAPPKVEGGDYRVLHWQTFHGMDYEAQASRIKSFCDDYNVTRIVIDKTGMGSGVFQEV 489

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL-INHSGLIQNLKSLKSFI 446
           +              A+ L++  + + E+ +K  + ++   L  + + +I +  ++K   
Sbjct: 490 K---------KFYPMAIGLDYNADLKNEMVLKTQNLIQKRRLKFDGNEIITSFMTVKK-R 539

Query: 447 VPNTGELAIESKR 459
           +  TG++   S R
Sbjct: 540 ITGTGKITYVSDR 552


>gi|163735142|ref|ZP_02142578.1| hypothetical protein RLO149_23000 [Roseobacter litoralis Och 149]
 gi|161391600|gb|EDQ15933.1| hypothetical protein RLO149_23000 [Roseobacter litoralis Och 149]
          Length = 267

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 83/265 (31%), Gaps = 41/265 (15%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             P  WQ   M       +   +  + +     + AG+ + K               P  
Sbjct: 28  GPPDPWQRSLMNSTSDVIMVLASRRSGKSTTVGVMAGQELAK---------------PDH 72

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            VI L+ +  Q    L+A+++           F  + ++L        +    L   S  
Sbjct: 73  QVIILSPTLAQ-SQLLFAKIA-----------FTWEKMALPIETRRRTMTELHLKNGS-- 118

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
            S +C    ++  +   G+    G+    DEA+  PD +       L+    N   +  +
Sbjct: 119 -SVVCVPAGQD-GEGARGYGVKNGIL-AFDEAAFIPDKVFGA---TLSIAEDNAKTVFIT 172

Query: 229 NPRRLSGKFYEIF--NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
            P   SGK YE++  +    + +R +  +  +  +             ++ DV      G
Sbjct: 173 TPGGKSGKAYEMWTNHDLYPEVERIRACSLDLPRMAKLVARQRKTLSKMEFDVEH----G 228

Query: 287 QFPQQDIDSFIPLNIIEEALNREPC 311
                    F   + I  A    P 
Sbjct: 229 LQWMGRGTPFFDPDTIRAAYTDTPE 253


>gi|146313136|ref|YP_001178210.1| hypothetical protein Ent638_3501 [Enterobacter sp. 638]
 gi|145320012|gb|ABP62159.1| protein of unknown function DUF264 [Enterobacter sp. 638]
          Length = 589

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 64/229 (27%), Gaps = 32/229 (13%)

Query: 244 PLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W++   I+     G      + +       +D  R     +F      S  P   +
Sbjct: 328 PDGQWRQIVTIEDALAGGCTLFNLDQLKQE--NSADDFRNLFMCEFVDDKA-SVFPFEEL 384

Query: 303 EEALNREPCPDP-----------YAPLIMGCDIAEEGGDN--TVVV--LRRGPVIEHL-- 345
           +  +                   + P+ +G D +  G      V+   L  G     L  
Sbjct: 385 QRCMVDAMEEWEDFEQFADRPFNWRPVWIGYDPSHTGDSAGCAVLAPPLVAGGKFRILER 444

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
             W   D       I  L EKY  D I IDA   G      +               A  
Sbjct: 445 HQWKGMDFAAQAEAIRSLTEKYTVDYIGIDATGIGQGVYQLVR---------SFFPAARA 495

Query: 406 LEFCRNRRTELHVKMADWLEFASLINHSGL--IQNLKSLKSFIVPNTGE 452
           + +    +T + +K  D +    L   +G   I          + ++G 
Sbjct: 496 IRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDITQSFMAIRKTMTSSGR 544


>gi|293417393|ref|ZP_06660017.1| terminase [Escherichia coli B185]
 gi|291430913|gb|EFF03909.1| terminase [Escherichia coli B185]
          Length = 590

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRELTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|258544092|ref|ZP_05704326.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
 gi|258520720|gb|EEV89579.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
          Length = 562

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 62/201 (30%), Gaps = 29/201 (14%)

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--- 307
             I+     G D    E +  ++          +  QF   D DS   +  ++  +    
Sbjct: 306 ITIEDAINSGFDRVTMEKLRIKF--PPGQFENLLMCQFV-NDTDSIFKMAELQRCMVDAW 362

Query: 308 --------REPCPDPYAPLIMGCDIAEEGGDNTVVVL----RRGPVIEHLFD--WSKTDL 353
                     P P   AP+ +G D +    D ++VV+      G V   +    ++  D 
Sbjct: 363 TLWKDYTPLAPRPLDDAPVWIGYDPSRSQDDASLVVIAPPRVEGGVFRIVDKQSFNGLDF 422

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                KI      Y    I IDA   G    D +              RA  + +    +
Sbjct: 423 DGQAQKIREFCAIYNVANIAIDATGIGQAVYDLVRQ---------FYPRARKIIYTVEAK 473

Query: 414 TELHVKMADWLEFASLINHSG 434
            E+ +K    +    L   +G
Sbjct: 474 NEMVLKAKQLIHHGRLQWDAG 494


>gi|300022629|ref|YP_003755240.1| hypothetical protein Hden_1105 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524450|gb|ADJ22919.1| protein of unknown function DUF264 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 500

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 71/420 (16%), Positives = 127/420 (30%), Gaps = 68/420 (16%)

Query: 84  AGRGIGKTTLNA-WLVLWLMSTRPGISVIC-------LANSETQLKTTLWAEVSKWLSLL 135
            GRG GKT   A W+        PG             A ++   +  L   V K L+ +
Sbjct: 104 GGRGSGKTRAGAEWIRGLACGEEPGPRSAAGSRNASRRAPTKESPRIAL---VGKTLADV 160

Query: 136 PNKHWFEMQSL-SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
            N        L ++HPA     V   S          +   +S +  +   G       A
Sbjct: 161 RNVMIEGQSGLLAVHPARERP-VFEPSKRRLIWPNGAVAELFSADEAEALRG---PQFTA 216

Query: 195 IINDEASGT--PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
              DE +     +     +   L   +A R   +T+ PR       ++    + D     
Sbjct: 217 AWCDELAKWRNAEKAWDMLQFALRLGDAPR-ACVTTTPRAT-----KLLKSIIADEATVT 270

Query: 253 IDTRTVEG---IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
           ++  T +    + P+F   +  RY   S + R E+ G+  +   D     + IEEA  R 
Sbjct: 271 VNLATADNALNLAPTFLAEMTRRY-AGSAIGRQELLGEIVEDASDGLWRRHWIEEA--RV 327

Query: 310 PCPDPYAPLIMGCDI---AEEGGDNTVVV-----LRRGPVIEHLFDWSKTDLRTTNNKIS 361
                   +++  D    A    D   +V     + +   +                   
Sbjct: 328 DAAPEMQRVVVAVDPPVTATAASDACGIVVAGLGVDKRAYVLADRTVQGRTPEIWARAAL 387

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEM--LGYHVYRVLGQKRAVDLEFCRNRRTE---- 415
              + Y  D ++ + N  G      L+     + V +V   +           R E    
Sbjct: 388 SAFDDYEADRMVAEVNQGGDLVVSVLQQFRQNFPVVKVRATRGKW-------VRAEPVAA 440

Query: 416 LHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           L+ +         L     L   + +       + G +          +S D SD L++ 
Sbjct: 441 LYAEGRVA-HVGRL---DALEDQMCT-----FGSDGTVK--------GRSPDRSDALVWA 483


>gi|156564098|ref|YP_001429607.1| terminase large subunit [Bacillus phage 0305phi8-36]
 gi|154622795|gb|ABS83675.1| terminase large subunit [Bacillus phage 0305phi8-36]
          Length = 635

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 64/206 (31%), Gaps = 22/206 (10%)

Query: 40  EKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVL 99
           E+   L     P+ W  E ++         +     +  +  +  GR +GKT     ++L
Sbjct: 45  EELHYLAILDKPKFWAAETLKWFCRDYQEPMLQEMADSKRTVLRLGRRLGKTETMCIMIL 104

Query: 100 WLMSTRPGIS------VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPW 153
           W   T+P         ++ +A  E Q+   ++  +S+ +             +S    P 
Sbjct: 105 WHAFTQPNKGPNNQYDILIIAPYEEQV-DLIFKRLSQLID------------MSGDVNPS 151

Query: 154 YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILG 213
                H  L   +  +     + S        G        I+ DE     +     I+ 
Sbjct: 152 RDIDKHIELPNGTVIHGITAGSKSGSGAANTRGQRAD---LIVLDEMDYMGESEITNIMN 208

Query: 214 FLTERNANRFWIMTSNPRRLSGKFYE 239
              E       I+ S P      +Y+
Sbjct: 209 IRNEAPERIKMIVASTPSGRRDSYYK 234


>gi|322420465|ref|YP_004199688.1| hypothetical protein GM18_2968 [Geobacter sp. M18]
 gi|320126852|gb|ADW14412.1| hypothetical protein GM18_2968 [Geobacter sp. M18]
          Length = 507

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 62/394 (15%), Positives = 109/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L      +
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHLDTII-EEIEFQLDTNPD----LMNSIALTKYGKPN 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     D +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSDQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSELRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGG-------DNTVVVLRRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+              T +  R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQETEIGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|161521371|ref|YP_001584798.1| hypothetical protein Bmul_4835 [Burkholderia multivorans ATCC
           17616]
 gi|189352462|ref|YP_001948089.1| ATPase subunit of bacteriophage terminase [Burkholderia multivorans
           ATCC 17616]
 gi|327198040|ref|YP_004306409.1| gp42 [Burkholderia phage KS5]
 gi|160345421|gb|ABX18506.1| protein of unknown function DUF264 [Burkholderia multivorans ATCC
           17616]
 gi|189336484|dbj|BAG45553.1| ATPase subunit of bacteriophage terminase [Burkholderia multivorans
           ATCC 17616]
 gi|310657174|gb|ADP02289.1| gp42 [Burkholderia phage KS5]
          Length = 588

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 44/138 (31%), Gaps = 20/138 (14%)

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-NREPCPDPYAP------ 317
             + +   Y    +     +  QF    + S  PL +++  + +     D + P      
Sbjct: 350 NLDRLRLEY--SPEEYANLLLCQFIDDSL-SVFPLTVLQPCMVDTWEVWDDFKPLYLRPF 406

Query: 318 ----LIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKY 367
               + +G D +  G     VV+    R G     L  F W   D      +I  L  +Y
Sbjct: 407 GDEEVWIGYDPSHTGDSAGCVVIAPPKRPGGKFRVLERFQWHGLDFEAQAAQIEALTRRY 466

Query: 368 RPDAIIIDANNTGARTCD 385
           R   I ID    G     
Sbjct: 467 RVTYIGIDTTGIGQGVYQ 484


>gi|168822445|ref|ZP_02834445.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205341120|gb|EDZ27884.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 594

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 51/162 (31%), Gaps = 20/162 (12%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  + +  RY  D+    +     F     DS    + +
Sbjct: 331 PDGQWRYIITLEDAIAGGFNLASIDKLRNRYNRDT--FNMLYMCVFVDSK-DSVFSFSHV 387

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV------VVLRRGPVIEHLF 346
           E         + +            +  G D A  G  +T       +V      +  +F
Sbjct: 388 ERCCVDPDIWEDHDENLPRPFGNREVWAGYDPARSGDTSTFVIIAPPIVAGEKFRVLRVF 447

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
            W   + +    +I  L  +Y    I ID    G+   + ++
Sbjct: 448 HWQGMNWKWQAAQIKKLFGQYNMTYIGIDITGLGSGVFEDVQ 489


>gi|323943519|gb|EGB39636.1| terminase [Escherichia coli H120]
          Length = 367

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 128 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 184

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 185 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 244

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 245 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 294

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 295 CLEYDVSATDITSSFMAIRKTMTSSGR 321


>gi|78356952|ref|YP_388401.1| hypothetical protein Dde_1909 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219357|gb|ABB38706.1| hypothetical protein Dde_1909 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 507

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 61/394 (15%), Positives = 108/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L       
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHLDTII-EEIEFQLDTNPD----LMNSIALTKYGKPK 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     + +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSEQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSELRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGG-------DNTVVVLRRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+              T +  R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQETEIGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|197251462|ref|YP_002147591.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197215165|gb|ACH52562.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|312913681|dbj|BAJ37655.1| hypothetical protein STMDT12_C27120 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
          Length = 594

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 51/162 (31%), Gaps = 20/162 (12%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  + +  RY  D+    +     F     DS    + +
Sbjct: 331 PDGQWRYIITLEDAIAGGFNLASIDKLRNRYNRDT--FNMLYMCVFVDSK-DSVFSFSHV 387

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV------VVLRRGPVIEHLF 346
           E         + +            +  G D A  G  +T       +V      +  +F
Sbjct: 388 ERCCVDPDIWEDHDENLPRPFGNREVWAGYDPARSGDTSTFVIIAPPIVAGEKFRVLRVF 447

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
            W   + +    +I  L  +Y    I ID    G+   + ++
Sbjct: 448 HWQGMNWKWQAAQIKKLFGQYNMTYIGIDITGLGSGVFEDVQ 489


>gi|322832199|ref|YP_004212226.1| terminase, ATPase subunit [Rahnella sp. Y9602]
 gi|321167400|gb|ADW73099.1| terminase, ATPase subunit [Rahnella sp. Y9602]
          Length = 588

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 53/349 (15%), Positives = 104/349 (29%), Gaps = 67/349 (19%)

Query: 195 IINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPL-- 245
           +  DE    P+   +     G  ++ +        S P  L+   Y     E+FNK    
Sbjct: 249 LYVDEIFWIPNFQKLRKVASGMASQEHLRTT--YFSTPSALTHGAYPFWSGELFNKGREN 306

Query: 246 ----------------------DDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
                                   W++   I+     G +    + +      +    R 
Sbjct: 307 PNDRIELDIGHHSLAKGRLCEDGQWRQIVTIEDALAGGCNLFNIDTLKQENSAED--FRN 364

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDIAEEGGDN 331
               +F      S  P   ++  +                   Y  + +G D +  G   
Sbjct: 365 LFMCEFVDDQ-TSVFPFAELQRCMVESAEEWQDFSPFAVRPFGYRAVWIGYDPSHTGDSA 423

Query: 332 --TVVV--LRRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
              VV   L  G     L    W   D       I  L ++Y  + I +DA   G     
Sbjct: 424 GCAVVAPPLVDGGKFRVLERHQWKGMDFAAQAKSIEELTKRYCVEYIGVDATGIGQGVFQ 483

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI---NHSGLIQNLKSL 442
            +               A+++ +    +T++ +K  D +    L    NH  +  +  ++
Sbjct: 484 LVRQ---------FFPAAMEIRYSPETKTKMVLKAKDTITSGRLEYDTNHKDITSSFMAI 534

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
           +  +  +      E+ R + A   D +  +M+    N P +  + G+ P
Sbjct: 535 RKTMTASGSRSTYEASRSEEASHADVAWAIMHALL-NEPLTAANGGQSP 582


>gi|154247076|ref|YP_001418034.1| hypothetical protein Xaut_3147 [Xanthobacter autotrophicus Py2]
 gi|154161161|gb|ABS68377.1| protein of unknown function DUF264 [Xanthobacter autotrophicus Py2]
          Length = 416

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 68/415 (16%), Positives = 121/415 (29%), Gaps = 68/415 (16%)

Query: 82  ISAGRGIGKTTLNA-WLVLWLM-----STRPGISVICLANSETQLKTTLWAEVSKWLSLL 135
           +  GRG GKT   A W+    +     + RP   +  +A +   ++  +   VS  L++ 
Sbjct: 31  VLGGRGAGKTRAGAEWVRGLALGRPPFAGRPVGRIALVAETMADVREVMVEGVSGLLAVH 90

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
           P       +                           + + +S E P++  G       A 
Sbjct: 91  PRAERPRWEPTR---------------RRLEWANGAVAQGFSAEDPESLRG---PQFAAA 132

Query: 196 INDEASGTPDVINLGILGFLTERNANRFW-----IMTSNPRRLSGKFYEIFNKPLDDWKR 250
             DE +                             M +   R +     +   P     R
Sbjct: 133 WLDELAK-----WKRAEATFDMLQFGLRLGAQPRQMVTTTPRPTALLRRLLADPSTAVTR 187

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            +        + PSF   ++ RYG    + R E+ G+  +   D+      +E    RE 
Sbjct: 188 AR-TADNAFHLAPSFLGQVLTRYGGT-RLGRQELDGELIEDRADALFSRPALEAL--REA 243

Query: 311 CPDPYAPLIMGCDI---AEEGGDNTVVV---LRRGPVIEHLFDWSKTDLRTT--NNKISG 362
              P   +++  D    +  G D   +V   +    V+  L D S   LR      K   
Sbjct: 244 QVPPLTRIVVAVDPPASSRAGADACGIVCAGMDATGVVHVLADDSAAGLRPAQWAAKAVA 303

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEM--LGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           L  ++  D I+ + N  G      +     G  V +V   +           R E    +
Sbjct: 304 LFRRFEADLIVAEVNQGGEMVRAVIAEVDDGVPVEQVRATRGKF-------LRAEPVAAL 356

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
            +            L   +           G   + S      +S D  D L++ 
Sbjct: 357 YEQGRVRHAGAFPALEDEMC-----DFGTDG---LSS-----GRSPDRLDALVWA 398


>gi|307315386|ref|ZP_07594955.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|307315408|ref|ZP_07594975.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905258|gb|EFN35804.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905260|gb|EFN35805.1| protein of unknown function DUF264 [Escherichia coli W]
          Length = 385

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 58/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +      D    +     +F      S  P   ++  +                   
Sbjct: 146 IEQLKRENSADD--FKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 202

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 203 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 262

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 263 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 312

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 313 CLEYDVSATDITSSFMAIRKTMTSSGR 339


>gi|289805729|ref|ZP_06536358.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 257

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 58/167 (34%), Gaps = 5/167 (2%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 82  VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 139

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 140 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 199

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTN 357
              P     +G D+A+ G D    V R G VI    +W   +     
Sbjct: 200 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLK 246


>gi|213618708|ref|ZP_03372534.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 282

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 58/163 (35%), Gaps = 5/163 (3%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK-FYEIFNKPLDDWKRFQ 252
            +  +EA    +     +   + +  +  ++    NP  ++   +      P +D    +
Sbjct: 122 VLWLEEAHALTEYQWKILEPTIRKEGSECWF--IFNPGLVTDFVWRNFVVDPPEDTLIRK 179

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN--REP 310
           I+      +  +  + I A    D +       G     D  + I L+ IE A++  +  
Sbjct: 180 INYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVL 239

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL 353
              P     +G D+A+ G D    V R G VI    +W   + 
Sbjct: 240 DFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKED 282


>gi|323973818|gb|EGB68992.1| terminase [Escherichia coli TA007]
          Length = 589

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 55/196 (28%), Gaps = 29/196 (14%)

Query: 276 DSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDI 324
            +D  R     +F      S  P   ++  +                   + P+ +G D 
Sbjct: 359 SADDFRNLFMCEFVDDKA-SVFPFEELQRCMVDAMEEWEDFEPFADRPFNWRPVWIGYDP 417

Query: 325 AEEGGDN--TVVV--LRRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           +  G      V+   L  G     L    W   D       I  L EKY  D I IDA  
Sbjct: 418 SHTGDSAGCAVLAPPLVAGGKFRILERHQWKGMDFAAQAEAIRALTEKYTVDYIGIDATG 477

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGL--I 436
            G      +               A  + +    +T + +K  D +    L   +G   I
Sbjct: 478 IGQGVYQLVR---------SFFPAARAIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDI 528

Query: 437 QNLKSLKSFIVPNTGE 452
                     + N+G 
Sbjct: 529 TQSFMAIRKTMTNSGR 544


>gi|261340099|ref|ZP_05967957.1| terminase, ATPase subunit [Enterobacter cancerogenus ATCC 35316]
 gi|288318026|gb|EFC56964.1| terminase, ATPase subunit [Enterobacter cancerogenus ATCC 35316]
          Length = 589

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 55/196 (28%), Gaps = 29/196 (14%)

Query: 276 DSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDI 324
            +D  R     +F      S  P   ++  +                   + P+ +G D 
Sbjct: 359 SADDFRNLFMCEFVDDKA-SVFPFEELQRCMVDAMEEWEDFEPFADRPFNWRPVWIGYDP 417

Query: 325 AEEGGDN--TVVV--LRRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANN 378
           +  G      V+   L  G     L    W   D       I  L EKY  D I IDA  
Sbjct: 418 SHTGDSAGCAVLAPPLVAGGKFRILERHQWKGMDFAAQAEAIRALTEKYTVDYIGIDATG 477

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGL--I 436
            G      +               A  + +    +T + +K  D +    L   +G   I
Sbjct: 478 IGQGVYQLVR---------SFFPAARAIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDI 528

Query: 437 QNLKSLKSFIVPNTGE 452
                     + ++G 
Sbjct: 529 TQSFMAIRKTMTSSGR 544


>gi|218558996|ref|YP_002391909.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|218365765|emb|CAR03503.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
          Length = 600

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 361 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 417

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 418 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 477

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 478 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 527

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 528 CLEYDVSATDITSSFMAIRKTMTSSGR 554


>gi|212709268|ref|ZP_03317396.1| hypothetical protein PROVALCAL_00303 [Providencia alcalifaciens DSM
           30120]
 gi|212688180|gb|EEB47708.1| hypothetical protein PROVALCAL_00303 [Providencia alcalifaciens DSM
           30120]
          Length = 585

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 58/165 (35%), Gaps = 24/165 (14%)

Query: 246 DDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
             W++   ++     G D    E +   Y    D     +  +F   DI S   L ++++
Sbjct: 324 GQWRQIVTVEDAIRGGCDLFEIEQLSLEY--SPDEFENLLMCEFVD-DIASIFNLQLMQK 380

Query: 305 ALNRE-----------PCPDPYAPLIMGCDIAE--EGGDN--TVVV---LRRGPVIEHLF 346
            +                P  Y P+ +G D A+  + GD+   VVV   LR G     L 
Sbjct: 381 CMVDSWEVWNDVQPLMVRPYAYHPVWIGYDPAKGTQNGDSAGCVVVAPPLRAGDKFRILE 440

Query: 347 D--WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
              W   D R   N I  L E+Y    I ID+   G      +  
Sbjct: 441 HHQWRGMDFRAQANAIKELTERYNVQYIGIDSTGIGHGVLQNVRD 485


>gi|194444881|ref|YP_002043300.1| hypothetical protein SNSL254_A4364 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194403544|gb|ACF63766.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 589

 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 71/230 (30%), Gaps = 34/230 (14%)

Query: 244 PLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W++   I+    +G      + +     +D    R     +F      S  P   +
Sbjct: 328 PDGQWRQIVTIEDALAKGCTLFNIDTLKRENSVDE--FRNLFMCEFVDDKA-SVFPFEEL 384

Query: 303 EEALNR-----------EPCPDPYAPLIMGCDIAEEGGDNTVVVL----RRGPVIEHL-- 345
           +  +                P  + P+ +G D +  G     VV+      G     L  
Sbjct: 385 QRCMVDSLEKWEDYAPFADRPFGHRPVWIGYDPSLRGDSAGCVVIAPPVVAGGKFRILER 444

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
             W   D       I  L +KY  + I IDA   G      +               A +
Sbjct: 445 HQWKGMDFAQQAESIRELTQKYTVEYIGIDATGLGQGVFQLVR---------SFYPAARE 495

Query: 406 LEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGE 452
           + +    +T + +K  D +    L      + + Q+  S++   + ++G 
Sbjct: 496 IRYTPEMKTAMVLKAKDTIRRGCLEYDVSATDITQSFMSIRK-TMTSSGR 544


>gi|154248423|ref|YP_001419381.1| hypothetical protein Xaut_4503 [Xanthobacter autotrophicus Py2]
 gi|154162508|gb|ABS69724.1| protein of unknown function DUF264 [Xanthobacter autotrophicus Py2]
          Length = 457

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 68/240 (28%), Gaps = 20/240 (8%)

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRR 232
           T     PDT  G        +  DE +   D   I   +   +++         TS P  
Sbjct: 113 TALPANPDTARGFSAN----VFLDEFAIHKDSKAIWGALFPVISKNGLRLRV--TSTPNG 166

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
              KFYEI     + W R  +D               +     D D+   E   ++  + 
Sbjct: 167 KGNKFYEIMTAADEVWSRHVVDIYQAVADGLPRDIDELRAGLADDDLWAQEYELKWLDEA 226

Query: 293 ID----SFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL----RRGPVIEH 344
                   I     E A   +P         +G DI     D  V+ +            
Sbjct: 227 SAWLSYDLISSCEDERA--GDPALYQGGVCFVGRDIGRRQ-DLHVIWVWEQVGDVLWERE 283

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC-DYLEMLGYHVYRVLGQKRA 403
             +  +      ++    ++ +YR     ID    G +   D     G  V  VL    +
Sbjct: 284 RIEQKRATFAEMDDAFDDIMVRYRVGRACIDQTGMGEKVVEDAQRRWGSRVEGVLFTGPS 343


>gi|225220117|ref|YP_002720084.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
 gi|224986058|gb|ACN74622.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
          Length = 461

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 66/336 (19%), Positives = 117/336 (34%), Gaps = 48/336 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           +G G GK+ + A  V+ L++  PG   I    +   L   ++ E+ K       +  F  
Sbjct: 58  SGFGGGKSWVAARKVIQLLTLNPGYDGIVTEPTIPLLVKIMYPELEKAFDEAGFRWKFNK 117

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q           D ++  L +  K    +C   S E     +G +  +   I+ DE   T
Sbjct: 118 Q-----------DKIYNVL-VKGKWTRVICE--SMENYTRLIGVNAAW---IVADEFDTT 160

Query: 204 PDVINLGILGFLTER---NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVE 259
              + +     L  R      R +++ S P       Y+IF       KR  +  T    
Sbjct: 161 KQDVAMAAYHKLLGRLRAGFVRQFVIVSTPEGYRAM-YQIFEVEKGSQKRLIRAKTTDNH 219

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLI 319
            +   F + + ++Y   +++    + G F      +   +   E   + E    P   LI
Sbjct: 220 HLPADFIDTLRSQY--PANLIDAYLNGLFVNLTSGAVYKMFNREGNASTEE-VHPDDTLI 276

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--------TDLRTTNNKISGLVEKYR--- 368
           +G D         VV +RR   I    ++           DL  T   I  + E+Y    
Sbjct: 277 IGMDFNVTKM-AAVVYVRR-QRITENKEFRDEIHAVDEFVDLFDTPAMIEAIEERYPEHC 334

Query: 369 -PDAIII--DANN-----TGARTCD--YLEMLGYHV 394
               +++  D++        A + D   LE  G+ V
Sbjct: 335 AAGRVVVYPDSSGKSRKTVNASSSDIAQLEDAGFEV 370


>gi|326783087|ref|YP_004323484.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
 gi|310005505|gb|ADO99893.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
          Length = 560

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 72/414 (17%), Positives = 135/414 (32%), Gaps = 65/414 (15%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            +Q E +E    H  N    P               GK+T     +L  +     ++V  
Sbjct: 60  DFQQELIESFHEHRFNIAKLPRQ------------TGKSTTCVSYLLHYILFNDNVNVGI 107

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           LAN  +  +  L    S+          +  Q + ++      +     L   SK     
Sbjct: 108 LANKLSTARDLL----SRLQLAYEQLPLWIQQGIVVY------NKGSMELENGSK-ILAA 156

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI----NLGILGFLTERNANRFWIMTS 228
             + S  R  +F          I  DE +  P+ I       +   +T    +   I+ S
Sbjct: 157 STSASAVRGMSFN--------IIFLDEFAFIPNHIAEQFFSSVYPTITS-GTSTKVIIIS 207

Query: 229 NPRRLSGKFYEIF---NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
            P  ++  FY+++    K  + +   ++    V G D  + E  IA           E  
Sbjct: 208 TPNGMN-HFYKLWVDAQKGRNGYAWNEVHWSKVPGRDAKWKEQTIANTSERQ--FTQEFD 264

Query: 286 GQFPQQDIDSFIPLNIIEE-----------ALNREPCPDPYAPLIMGCDIAEE--GGDNT 332
            +F    +D+ I  + +             +L+    P      I+  D++       + 
Sbjct: 265 CEFL-GSVDTLITASKLRVLTYDDVMTTNGSLDIYEKPIDKHEYIITVDVSRGLAQDYSA 323

Query: 333 VVVLRRGPVIEHLF-DWSKTDLRTT--NNKISGLVEKYRPDAIIIDANNTGARTCD---- 385
            VV+        L   +   D+R     N I  +   Y    ++ + N+ G         
Sbjct: 324 FVVIDITHAPWRLVAKYRDKDVRPMLFPNIIFNVATNYNKAYVLTEVNDIGEAVAGSLFY 383

Query: 386 YLEMLGYHVYRVLG-QKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
            LE     +  + G   + V   F  N+ T++ VKM+  ++     N   LI++
Sbjct: 384 DLEYENTLMCAMRGRAGQIVGQGFSGNK-TQMGVKMSKTVKAQGCSNLKTLIED 436


>gi|322662586|gb|EFY58794.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
          Length = 280

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 49/143 (34%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +           +    P  
Sbjct: 40  LDQLRMEY--SPDEYQNLLMCEFID-DLASVFPLSELQACMVDSWEVWTDFQSLALRPFG 96

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 97  WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 156

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 157 QYNVTYIGIDSTGVGHGVYENVK 179


>gi|323183894|gb|EFZ69285.1| terminase, ATPase subunit [Escherichia coli 1357]
          Length = 590

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|320180747|gb|EFW55673.1| Phage terminase, ATPase subunit [Shigella boydii ATCC 9905]
 gi|323167352|gb|EFZ53060.1| terminase, ATPase subunit [Shigella sonnei 53G]
          Length = 590

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 60/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F    + S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKV-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|117623093|ref|YP_852006.1| putative phage terminase [Escherichia coli APEC O1]
 gi|117624286|ref|YP_853199.1| Phage protein P [Escherichia coli APEC O1]
 gi|115512217|gb|ABJ00292.1| putative phage terminase [Escherichia coli APEC O1]
 gi|115513410|gb|ABJ01485.1| Phage protein P [Escherichia coli APEC O1]
          Length = 590

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|331675382|ref|ZP_08376132.1| terminase, ATPase subunit (GpP) [Escherichia coli TA280]
 gi|331067442|gb|EGI38847.1| terminase, ATPase subunit (GpP) [Escherichia coli TA280]
          Length = 590

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSTDDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|330967816|gb|EGH68076.1| hypothetical protein PSYAC_24858 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 774

 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 51/163 (31%), Gaps = 20/163 (12%)

Query: 244 PLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W++   I      G D    E +   Y  D D  +     +F      +F  L  +
Sbjct: 343 PDGQWRKVITILDAISGGCDLFDLEQLQLEY--DEDKFQQLFMCKFIDSSQSAF-SLADL 399

Query: 303 EEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEHLFD- 347
           E   +           +P     +P+ +G D +    D T VV    L  G     L   
Sbjct: 400 ERCYSDLSLWADFDPDDPRLYGNSPVWIGYDPSRTRDDATCVVIAPPLENGGKFRILEKH 459

Query: 348 -WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
            W     +    ++  L E++    I ID    G    D +  
Sbjct: 460 SWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLVRD 502


>gi|294634584|ref|ZP_06713119.1| terminase, ATPase subunit [Edwardsiella tarda ATCC 23685]
 gi|291092098|gb|EFE24659.1| terminase, ATPase subunit [Edwardsiella tarda ATCC 23685]
          Length = 588

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 44/134 (32%), Gaps = 17/134 (12%)

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE----ALNREPCPDPYA------PLIMG 321
           +    +D  +     +F      S  P   ++     AL      +PYA      P+ +G
Sbjct: 355 KRENSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDALEAWTDVNPYADHPFDRPVWIG 413

Query: 322 CDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIID 375
            D +  G     VVL      G     L    W   D  T    I  L EKYR D I ID
Sbjct: 414 YDPSHTGDSAGCVVLAPPAVPGGKFRMLERHQWKGMDFSTQAEAIRALTEKYRVDYIGID 473

Query: 376 ANNTGARTCDYLEM 389
           A   G      +  
Sbjct: 474 ATGIGQGVFQLVRE 487


>gi|323936689|gb|EGB32974.1| terminase [Escherichia coli E1520]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFATNPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|210062534|gb|ACJ06274.1| probable terminase subunit [Photorhabdus luminescens]
          Length = 585

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 53/144 (36%), Gaps = 23/144 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE-----------PCPDP 314
            + +   Y    D  +  +  +F   DI+S   L +++  +                P  
Sbjct: 345 IDQLRLEY--SPDEYQNLLMCEF-MDDIESIFSLQLMQGCMVDSWEIWDDVQPLMLRPYG 401

Query: 315 YAPLIMGCDIAEEG--GDNT---VVVLRR--GPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           Y P+ +G D A+ G  GD+    VV   R  G     L    W   + R  ++ I  L E
Sbjct: 402 YHPVWIGYDPAKGGENGDSAGCVVVAPPRVPGDKFRILERHQWRGMNFRAQSDAIKRLTE 461

Query: 366 KYRPDAIIIDANNTGARTCDYLEM 389
           +Y  + I ID+   G      ++ 
Sbjct: 462 QYNVEYIGIDSTGVGHGVYQNVKE 485


>gi|324113792|gb|EGC07767.1| terminase [Escherichia fergusonii B253]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFATNPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|332088966|gb|EGI94078.1| terminase, ATPase subunit [Shigella boydii 5216-82]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|323961666|gb|EGB57270.1| terminase [Escherichia coli H489]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|294494147|gb|ADE92903.1| terminase, ATPase subunit [Escherichia coli IHE3034]
 gi|323951869|gb|EGB47743.1| terminase [Escherichia coli H252]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|254039145|ref|ZP_04873195.1| terminase [Escherichia sp. 1_1_43]
 gi|226838581|gb|EEH70610.1| terminase [Escherichia sp. 1_1_43]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|30065706|ref|NP_839851.1| gpP [Yersinia phage L-413C]
 gi|300947250|ref|ZP_07161455.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|301022960|ref|ZP_07186775.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|331678021|ref|ZP_08378696.1| terminase, ATPase subunit (GpP) [Escherichia coli H591]
 gi|30025900|gb|AAP04439.1| gpP [Yersinia phage L-413C]
 gi|33413700|gb|AAN28220.1| gpP [Enterobacteria phage WPhi]
 gi|300397301|gb|EFJ80839.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300453115|gb|EFK16735.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|315061386|gb|ADT75713.1| terminase, ATPase subunit [Escherichia coli W]
 gi|315063221|gb|ADT77548.1| phage large terminase subunit [Escherichia coli W]
 gi|323380714|gb|ADX52982.1| phage large terminase subunit GpP [Escherichia coli KO11]
 gi|325499372|gb|EGC97231.1| Terminase, ATPase subunit (GpP) [Escherichia fergusonii ECD227]
 gi|331074481|gb|EGI45801.1| terminase, ATPase subunit (GpP) [Escherichia coli H591]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|323378035|gb|ADX50303.1| phage large terminase subunit GpP [Escherichia coli KO11]
          Length = 589

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 350 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 406

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 407 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 466

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 467 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 516

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 517 CLEYDVSATDITSSFMAIRKTMTSSGR 543


>gi|315296184|gb|EFU55492.1| conserved hypothetical protein [Escherichia coli MS 16-3]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|213646682|ref|ZP_03376735.1| Phage protein P [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|9630329|ref|NP_046758.1| gpP [Enterobacteria phage P2]
 gi|168789033|ref|ZP_02814040.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC869]
 gi|188492656|ref|ZP_02999926.1| phage large terminase subunit GpP [Escherichia coli 53638]
 gi|261225041|ref|ZP_05939322.1| Terminase, ATPase subunit (GpP) [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257612|ref|ZP_05950145.1| Terminase, ATPase subunit (GpP) [Escherichia coli O157:H7 str.
           FRIK966]
 gi|301048706|ref|ZP_07195715.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|139354|sp|P25479|VPP_BPP2 RecName: Full=Terminase, ATPase subunit; AltName: Full=GpP
 gi|3139088|gb|AAD03269.1| gpP [Enterobacteria phage P2]
 gi|188487855|gb|EDU62958.1| phage large terminase subunit GpP [Escherichia coli 53638]
 gi|189371250|gb|EDU89666.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC869]
 gi|300299452|gb|EFJ55837.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|324020535|gb|EGB89754.1| hypothetical protein HMPREF9542_00768 [Escherichia coli MS 117-3]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|320196848|gb|EFW71470.1| Phage terminase, ATPase subunit [Escherichia coli WV_060327]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|170683976|ref|YP_001746268.1| phage large terminase subunit GpP [Escherichia coli SMS-3-5]
 gi|170521694|gb|ACB19872.1| phage large terminase subunit GpP [Escherichia coli SMS-3-5]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 517

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 518 CLEYDVSATDITSSFMAIRKTMTSSGR 544


>gi|170769222|ref|ZP_02903675.1| phage large terminase subunit GpP [Escherichia albertii TW07627]
 gi|170121874|gb|EDS90805.1| phage large terminase subunit GpP [Escherichia albertii TW07627]
          Length = 590

 Score = 58.6 bits (140), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 51/184 (27%), Gaps = 29/184 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 351 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 407

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 408 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 467

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 468 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRGC 518

Query: 429 LINH 432
           L   
Sbjct: 519 LEYD 522


>gi|18466735|ref|NP_569542.1| hypothetical protein HCM2.0070c [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16506051|emb|CAD09937.1| hypothetical protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
          Length = 418

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 50/335 (14%), Positives = 106/335 (31%), Gaps = 46/335 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           + +V  H        +P  FK  + AGR  GK+ L+   ++   +      V  +A +  
Sbjct: 7   LSLVQLHSGQMQVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
             +  LW ++ + L                 P  W       ++ I  K+ S +      
Sbjct: 66  MARQILWDDLQEVL-----------------PRKWVRKKNDTTMTIVLKNGSEIALK-GA 107

Query: 179 ERPDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           ++PDT  G        ++ DE     PD     +   L+        ++   P+    +F
Sbjct: 108 DKPDTLRGV---ALHFVVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTPKG-FSEF 161

Query: 238 YEIFN-------KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
           ++++        +    WK +Q  T     +  +  E       +D      E    F  
Sbjct: 162 HKLWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKND--MDPKSFAQEYLASFEN 219

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
                + P +       +    +P  P+ +G D      D    V+ +      L+   +
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPKLPIWVGQD---FNIDPMSSVILQPQPNGELWAVDE 274

Query: 351 -----TDLRTTNNKISGLVEKYRPD-AIIIDANNT 379
                ++     +++     +++    I  D    
Sbjct: 275 VVLFSSNTAEVCDELERRFWRWKSQVTIFPDPAGA 309


>gi|16082806|ref|NP_395360.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|31795361|ref|NP_857813.1| hypothetical protein Y1030 [Yersinia pestis KIM]
 gi|40787951|ref|NP_857660.2| hypothetical protein YPKMT021 [Yersinia pestis KIM]
 gi|45478613|ref|NP_995469.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52788073|ref|YP_093901.1| hypothetical protein pG8786_021 [Yersinia pestis]
 gi|108793557|ref|YP_636707.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|108793757|ref|YP_636595.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|145597216|ref|YP_001154679.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|149192775|ref|YP_001294006.1| hypothetical protein YPE_4292 [Yersinia pestis CA88-4125]
 gi|162417876|ref|YP_001604588.1| hypothetical protein YpAngola_0076 [Yersinia pestis Angola]
 gi|165939469|ref|ZP_02228016.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166214433|ref|ZP_02240468.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402343|ref|ZP_02307808.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422791|ref|ZP_02314544.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167466683|ref|ZP_02331387.1| hypothetical protein YpesF_02065 [Yersinia pestis FV-1]
 gi|229896952|ref|ZP_04512111.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|229897756|ref|ZP_04512911.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900293|ref|ZP_04515428.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904817|ref|ZP_04519927.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|270491004|ref|ZP_06208077.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294502015|ref|YP_003565752.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|3883031|gb|AAC82691.1| unknown [Yersinia pestis KIM 10]
 gi|5834709|emb|CAB55206.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|45357266|gb|AAS58660.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52538002|emb|CAG27427.1| hypothetical protein [Yersinia pestis]
 gi|108777821|gb|ABG20339.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|108782104|gb|ABG16161.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|145212984|gb|ABP42389.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|148872433|gb|ABR14922.1| hypothetical protein YPMT1.24c [Yersinia pestis CA88-4125]
 gi|162350848|gb|ABX84797.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165912657|gb|EDR31287.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166204381|gb|EDR48861.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958284|gb|EDR55305.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167048235|gb|EDR59643.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|229678132|gb|EEO74238.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|229686652|gb|EEO78733.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229693337|gb|EEO83387.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229699988|gb|EEO88028.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|262363909|gb|ACY60628.1| hypothetical protein YPD4_pMT0023 [Yersinia pestis D106004]
 gi|262364065|gb|ACY64401.1| hypothetical protein YPD8_pMT0023 [Yersinia pestis D182038]
 gi|270334985|gb|EFA45763.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294352486|gb|ADE66542.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|320017547|gb|ADW01117.1| hypothetical protein YPC_4788 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 418

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 50/335 (14%), Positives = 106/335 (31%), Gaps = 46/335 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           + +V  H        +P  FK  + AGR  GK+ L+   ++   +      V  +A +  
Sbjct: 7   LSLVQLHSGQMQVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
             +  LW ++ + L                 P  W       ++ I  K+ S +      
Sbjct: 66  MARQILWDDLQEVL-----------------PRKWVRKKNDTTMTIVLKNGSEIALK-GA 107

Query: 179 ERPDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           ++PDT  G        ++ DE     PD     +   L+        ++   P+    +F
Sbjct: 108 DKPDTLRGV---ALHFVVLDEFQDMKPDTWYKVLRPTLSS--TRGGALIIGTPKG-FSEF 161

Query: 238 YEIFN-------KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
           ++++        +    WK +Q  T     +  +  E       +D      E    F  
Sbjct: 162 HKLWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKND--MDPKSFAQEYLASFEN 219

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
                + P +       +    +P  P+ +G D      D    V+ +      L+   +
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPKLPIWVGQD---FNIDPMSSVILQPQPNGELWAVDE 274

Query: 351 -----TDLRTTNNKISGLVEKYRPD-AIIIDANNT 379
                ++     +++     +++    I  D    
Sbjct: 275 VVLFSSNTAEVCDELERRFWRWKSQVTIFPDPAGA 309


>gi|324115403|gb|EGC09352.1| terminase [Escherichia coli E1167]
          Length = 572

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 59/207 (28%), Gaps = 33/207 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 357 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAANPFG 413

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 414 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 473

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 474 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRG- 523

Query: 429 LINHSGLIQNLKS---LKSFIVPNTGE 452
            + +     ++ S        + ++G 
Sbjct: 524 CLEYDVSATDITSSFMAIRKTMTSSGR 550


>gi|302343251|ref|YP_003807780.1| hypothetical protein Deba_1821 [Desulfarculus baarsii DSM 2075]
 gi|301639864|gb|ADK85186.1| conserved hypothetical protein [Desulfarculus baarsii DSM 2075]
          Length = 507

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 63/394 (15%), Positives = 109/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L       
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHLDTII-EEIEFQLDTNPD----LMNSIALTKYGKPK 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     D +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSDQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSEMRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGGDNTVVVL-------RRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+        +VV        R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQEMEIGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|300715671|ref|YP_003740474.1| Terminase, ATPase [Erwinia billingiae Eb661]
 gi|299061507|emb|CAX58621.1| Terminase, ATPase subunit [Erwinia billingiae Eb661]
          Length = 588

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 46/144 (31%), Gaps = 23/144 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y       +  +  +F   D+ S  PL  ++  +                P  
Sbjct: 348 IDQLRLEY--SPPEYQNLLMCEFID-DLASVFPLADLQACMVDSWEVWQDFEALALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L  
Sbjct: 405 WREVWIGYDPAKGTQHGDSAGCVVIAPPSVPGGKFRILERHQWRGMDFRAQADAIKELTR 464

Query: 366 KYRPDAIIIDANNTGARTCDYLEM 389
           +Y    I ID+   G    + ++M
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVKM 488


>gi|221633560|ref|YP_002522786.1| hypothetical protein trd_1584 [Thermomicrobium roseum DSM 5159]
 gi|221155562|gb|ACM04689.1| conserved hypothetical protein [Thermomicrobium roseum DSM 5159]
          Length = 489

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 53/352 (15%), Positives = 96/352 (27%), Gaps = 55/352 (15%)

Query: 89  GKTTLNAWLVLWLMSTRP--GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
           GK    A  + WL+      G  V+    S                +L   +    + + 
Sbjct: 65  GKDEALAQFLAWLLLRFHRRGGEVVVALPSWR-----------PQGALARERLLAVLAAP 113

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV 206
            L        +     G        + R  S        G   T  + ++ +EA      
Sbjct: 114 RLAALLAGLGLAPEVAGARVALGRAVVRYASAGPSANVRGL--TASLLLVANEAQDIAPD 171

Query: 207 INLGILGFLTERNANRFWIMTSNPRRLSG------KFYEIFNKPLDDWKRFQIDTRTVEG 260
                   +   +     +    P           ++     +     + +++   TV  
Sbjct: 172 RWDSAFAPMA-ASTGAPALYLGTPWGSDSLLARELRYLTALERQDGQQRVWRVPWTTVAA 230

Query: 261 IDPSF---HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---PDP 314
             P++       +A+ G      R E  G           P   +       P    P P
Sbjct: 231 ELPAYGDHVRERMAQLGAGHPFVRTEY-GLEELAGEGRLFPPERLALVRGDHPALLAPRP 289

Query: 315 YAPLIMGCDIAEEGGDN-------------------TVVVLRRGPVIEHLFDWS----KT 351
                +  D+A  G D                    TVV +  G +  +   W       
Sbjct: 290 GERYALTVDVA--GEDEASAGELRDDPGARRDATALTVVRVVPGTLPRYEAVWRARWVGA 347

Query: 352 DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYHVYRVLGQKR 402
                +  +  L   +R + +++DA+  GA    +LE  LG  V RV+   R
Sbjct: 348 RQVRQHEALVQLARAWRAERVVVDASGVGAGLAAFLEHALGERVRRVVFSPR 399


>gi|307826152|ref|ZP_07656363.1| protein of unknown function DUF264 [Methylobacter tundripaludum
           SV96]
 gi|307732791|gb|EFO03657.1| protein of unknown function DUF264 [Methylobacter tundripaludum
           SV96]
          Length = 598

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 78/261 (29%), Gaps = 52/261 (19%)

Query: 189 NTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIF 241
           + +G   + DE    PD   +     G    +   R     S P  +S + Y     E +
Sbjct: 261 SYHGHLYV-DECFWIPDFDKMWKVASGMAAHKKWRRTL--FSTPSAISHQAYPMWCGEKY 317

Query: 242 NKPLDDWKRFQIDT------------------------RTVEGIDPSFHEGIIARYGLDS 277
           N+   D K+ + D                            +G D    + +   Y  D 
Sbjct: 318 NQGKADDKKAEFDVSHAALKDGLMGADKIWRHMVTVVDAEAQGCDLFDIDELQDEYSKDD 377

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE---------PCPDPYAPLIMGCDIAEEG 328
                    +F   D  S   L I+     RE         P P    P+ +G D +   
Sbjct: 378 --FANLFMCKFID-DAKSVFNLGIMMTCYAREDYTDYNDKAPRPYGNRPVAIGYDPSRTR 434

Query: 329 GDNT----VVVLRRG--PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
            + +     + LR G    +    D+   + +   N+I  +V+ +    + ID    G  
Sbjct: 435 DNASLAILAIPLRPGDKWRVLKTMDFHGQNFQYQANRIKEIVDSHNVQHVGIDVTGIGYG 494

Query: 383 TCDYLEMLGYHVYRVLGQKRA 403
             + +E     V  +      
Sbjct: 495 LFELVEQFYRRVTPINYSNET 515


>gi|318064508|gb|ADV36483.1| phage terminase large subunit [Edwardsiella phage eiDWF]
 gi|318064606|gb|ADV36532.1| phage terminase large subunit [Edwardsiella phage eiMSLS]
          Length = 460

 Score = 58.2 bits (139), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 63/346 (18%), Positives = 113/346 (32%), Gaps = 38/346 (10%)

Query: 44  PLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMS 103
           P++     R+W+++ +     H    +N+   ++      +G G GKT   A   + L  
Sbjct: 27  PVKKERKSRTWRIKTL----PHQRGLINDTTTKILGLC--SGFGGGKTWSAARKAVQLAI 80

Query: 104 TRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
             PG   I    +   L   ++ E+ K L+    K  F  Q    H              
Sbjct: 81  LNPGCDGIITEPTIPLLVKIMYPELEKALNEAGIKWKFNKQDKIYHC------------R 128

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG---ILGFLTERNA 220
           I  +    +C   S E     +G +  + +    D     PD+       +LG L   N 
Sbjct: 129 IAGQMTRIICD--SMENYTRLIGVNAAWCVCDEFDTTK--PDIAMEAYRKLLGRLRTGNV 184

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
            +  I  S P       Y+IF    DD KR  +  T     +   + + + A+Y    ++
Sbjct: 185 RQMVI-VSTPEGFRAM-YQIFISEADDQKRLIKARTTDNHYLPQDYIDTLRAQY--PPEL 240

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
               + G+F      +    N      N +   +    L++G D         V V R  
Sbjct: 241 IEAYLNGEFVNLTGGAVY-RNFSRTLNNCDTVAEDDDTLMIGMDFNVGQMAGAVYVQRIA 299

Query: 340 PVIEHLFDWSKT----DLRTTNNKISGLVEKYRP---DAIIIDANN 378
             +E +    +     D     + I      +       I  D++ 
Sbjct: 300 DGVEEMHLVDEFCGLLDTDAMIDAIKERYPDHHARGLIEIFPDSSG 345


>gi|318064394|gb|ADV36428.1| phage terminase large subunit [Edwardsiella phage eiAU]
          Length = 460

 Score = 58.2 bits (139), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 63/346 (18%), Positives = 113/346 (32%), Gaps = 38/346 (10%)

Query: 44  PLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMS 103
           P++     R+W+++ +     H    +N+   ++      +G G GKT   A   + L  
Sbjct: 27  PVKKERKSRTWRIKTL----PHQRGLINDTTTKILGLC--SGFGGGKTWSAARKAVQLAI 80

Query: 104 TRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
             PG   I    +   L   ++ E+ K L+    K  F  Q    H              
Sbjct: 81  LNPGCDGIITEPTIPLLVKIMYPELEKALNEAGIKWKFNKQDKIYHC------------R 128

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG---ILGFLTERNA 220
           I  +    +C   S E     +G +  + +    D     PD+       +LG L   N 
Sbjct: 129 IAGQMTRIICD--SMENYTRLIGVNAAWCVCDEFDTTK--PDIAMEAYRKLLGRLRTGNV 184

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
            +  I  S P       Y+IF    DD KR  +  T     +   + + + A+Y    ++
Sbjct: 185 RQMVI-VSTPEGFRAM-YQIFISEADDQKRLIKARTTDNHYLPQDYIDTLRAQY--PPEL 240

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
               + G+F      +    N      N +   +    L++G D         V V R  
Sbjct: 241 IEAYLNGEFVNLTGGAVY-RNFSRTLNNCDTVAEDDDTLMIGMDFNVGQMAGAVYVQRIA 299

Query: 340 PVIEHLFDWSKT----DLRTTNNKISGLVEKYRP---DAIIIDANN 378
             +E +    +     D     + I      +       I  D++ 
Sbjct: 300 DGVEEMHLVDEFCGLLDTDAMIDAIKERYPDHHARGLIEIFPDSSG 345


>gi|293411885|ref|ZP_06654610.1| predicted protein [Escherichia coli B354]
 gi|220980013|emb|CAP72205.1| Hypothetical protein [Escherichia coli LF82]
 gi|291469440|gb|EFF11929.1| predicted protein [Escherichia coli B354]
 gi|323934319|gb|EGB30739.1| PBSX family protein phage terminase [Escherichia coli E1520]
          Length = 418

 Score = 58.2 bits (139), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 48/335 (14%), Positives = 105/335 (31%), Gaps = 46/335 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           + +V  H        +P  FK  + AGR  GK+ L+   ++   +      V  +A +  
Sbjct: 7   LSLVQLHSGQMKVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
             +  LW ++ + L                 P  W       ++ I  K+ S +      
Sbjct: 66  MARQILWDDLQEVL-----------------PRKWVRKKNDTTMTIVLKNGSEIALK-GA 107

Query: 179 ERPDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           ++PDT  G        ++ DE      D     +   L+        ++   P+    +F
Sbjct: 108 DKPDTLRGV---ALHFVVLDEFQDMKADTWYKVLRPTLSS--TRGGALIIGTPKG-FSEF 161

Query: 238 YEIFN-------KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
           ++++        +    WK +Q  T     +  +  E       +D      E    F  
Sbjct: 162 HKLWTIGQNVELQRKGQWKSWQFVTADSPFVPTAEIEAAKND--MDPKSFAQEYLASFEN 219

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
                + P +       +    +P  P+ +G D      D    V+ +      L+   +
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPRLPIWVGQD---FNIDPMSSVILQPQPNGELWAIDE 274

Query: 351 -----TDLRTTNNKISGLVEKYRP-DAIIIDANNT 379
                ++     +++     +++    +  D    
Sbjct: 275 LVLFSSNTAEVCDELERRFWRWKSQITVFPDPAGA 309


>gi|322614428|gb|EFY11359.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621507|gb|EFY18360.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624368|gb|EFY21201.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626565|gb|EFY23370.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633573|gb|EFY30315.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638384|gb|EFY35082.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322647317|gb|EFY43813.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649287|gb|EFY45724.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655993|gb|EFY52293.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322661388|gb|EFY57613.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322666960|gb|EFY63135.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671329|gb|EFY67452.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677664|gb|EFY73727.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681510|gb|EFY77540.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322683910|gb|EFY79920.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195479|gb|EFZ80657.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200466|gb|EFZ85546.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203030|gb|EFZ88062.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205271|gb|EFZ90246.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210579|gb|EFZ95463.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218140|gb|EGA02852.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221594|gb|EGA06007.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227645|gb|EGA11800.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230903|gb|EGA15021.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234745|gb|EGA18831.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238784|gb|EGA22834.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241484|gb|EGA25515.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248370|gb|EGA32306.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323252865|gb|EGA36699.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257014|gb|EGA40723.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260513|gb|EGA44124.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264430|gb|EGA47936.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269565|gb|EGA53018.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 588

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 49/143 (34%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +           +    P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFID-DLASVFPLSELQACMVDSWEVWTDFQSLALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|262194129|ref|YP_003265338.1| hypothetical protein Hoch_0830 [Haliangium ochraceum DSM 14365]
 gi|262077476|gb|ACY13445.1| protein of unknown function DUF264 [Haliangium ochraceum DSM 14365]
          Length = 503

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 41/288 (14%), Positives = 85/288 (29%), Gaps = 52/288 (18%)

Query: 227 TSNPRRLSGKFYEI----------FNKPLDDWKRFQIDTRTVEGIDPSF----HEGIIAR 272
            S P    G F+EI            +    W R +     ++           E  +A 
Sbjct: 208 CSTPLGRRGIFWEISTEELRKYPHHTRDEVPWWRCRFFCLDIDRAMREAPHMPTEERVAA 267

Query: 273 YGLDSDV----------TRVEVCGQFPQQDIDSFIPLNIIEEALNRE--------PCPDP 314
           +G  + V           + E    F  +   S+ P  +I    + +          P+P
Sbjct: 268 FGTQAIVQQLDSLPLEDFQQEFECSFVDESY-SYYPYELILPCTSEDLVPAGDFTDLPEP 326

Query: 315 YAPLIMGCDIAEEGGD-NTVVVLRRGPV--IEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
              ++ G D+          V    G       L  + +         +   +++     
Sbjct: 327 EGRIVAGFDVGRTRDRSELAVFEDTGGHFVCRLLRRYDQVPFAEQEADLRRFLDRVPVAR 386

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL---EFAS 428
           + ID +  G    + L      V            +   N   E        L   +  +
Sbjct: 387 LSIDQSGIGMHLAENLARDYAQVVG----------DTFTNDNKERWATDLKILFQRKDIA 436

Query: 429 LINHSGLIQNLKSLKSFIVPNTGELAIESKRV-KGAKSTDYSDGLMYT 475
           L     L+  + S+K  ++P+ G++  +++R  +G  + D    +   
Sbjct: 437 LPRDRELVGQIHSIKRRVLPS-GKVGFDAERSTRGGHA-DRFWAIALA 482


>gi|213865314|ref|ZP_03387433.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
          Length = 171

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 11  LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 67

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 68  WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 127

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 128 QYNVTYIGIDSTGVGHGVYENVK 150


>gi|253991767|ref|YP_003043123.1| putative phage terminase subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638542|emb|CAR67163.1| probable phage terminase subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783217|emb|CAQ86382.1| probable phage terminase subunit [Photorhabdus asymbiotica]
          Length = 585

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 23/144 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE-----------PCPDP 314
            + +   Y    D  +  +  +F   DI+S   L +++  +                P  
Sbjct: 345 IDQLRLEY--SPDEYQNLLMCEF-MDDIESIFSLQLMQGCMVDSWEIWNDVQPLMLRPYG 401

Query: 315 YAPLIMGCDIAEEG--GDN--TVVV---LRRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           Y P+ +G D A+ G  GD+   VVV   L  G     L    W   + R  ++ I  L E
Sbjct: 402 YNPVWIGYDPAKGGKNGDSAGCVVVAPPLVPGGKFRILERHQWRGMNFRAQSDAIKRLTE 461

Query: 366 KYRPDAIIIDANNTGARTCDYLEM 389
           +Y  + I ID+   G      ++ 
Sbjct: 462 QYNVEYIGIDSTGVGHGVYQNVKE 485


>gi|322831306|ref|YP_004211333.1| terminase, ATPase subunit [Rahnella sp. Y9602]
 gi|321166507|gb|ADW72206.1| terminase, ATPase subunit [Rahnella sp. Y9602]
          Length = 596

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 50/338 (14%), Positives = 98/338 (28%), Gaps = 66/338 (19%)

Query: 195 IINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPL-- 245
           +  DE    P+   +     G  ++ +        S P  L+   Y     E+FNK    
Sbjct: 257 LYVDEIFWIPNFQKLRKVASGMASQEHLRTT--YFSTPSALTHGAYPFWSGELFNKGREN 314

Query: 246 ----------------------DDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
                                   W++   I+     G +    + +      +    R 
Sbjct: 315 PNDRIELDIGHHALAKGRLCEDGQWRQIVTIEDALAGGCNLFNIDTLKQENSAED--FRN 372

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDIAEEGGDN 331
               +F      S  P   ++  +                   Y  + +G D +  G   
Sbjct: 373 LFMCEFVDDQ-TSVFPFAELQRCMVESAEEWQDFSPFAMRPFGYRAVWIGYDPSHTGDSA 431

Query: 332 --TVVV--LRRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
              VV   L  G     L    W   D       I  L ++Y  + I +DA   G     
Sbjct: 432 GCAVVAPPLVDGGKFRVLERHQWKGMDFAAQAKSIEELTKRYCVEYIGVDATGIGQGVFQ 491

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI---NHSGLIQNLKSL 442
            +               A+++ +    +T++ +K  D +    L    NH  +  +  ++
Sbjct: 492 LVRQ---------FFPAAMEIRYSPETKTKMVLKAKDTITSGRLEYDTNHKDITSSFMAI 542

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           +  +  +      E+ R + A   D +  +M+     P
Sbjct: 543 RKTMTASGSRSTYEASRSEEASHADVAWAIMHALLNEP 580


>gi|312601717|gb|ADQ92391.1| terminase ATPase subunit [Salmonella phage RE-2010]
 gi|321223512|gb|EFX48577.1| Phage terminase, ATPase subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 572

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 48/143 (33%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 332 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 388

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 389 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 448

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 449 QYNVTYIGIDSTGVGHGVYENVK 471


>gi|298346517|ref|YP_003719204.1| phage terminase protein [Mobiluncus curtisii ATCC 43063]
 gi|298236578|gb|ADI67710.1| phage terminase protein [Mobiluncus curtisii ATCC 43063]
          Length = 470

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 63/406 (15%), Positives = 117/406 (28%), Gaps = 63/406 (15%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            WQ    +V              +     +   R  GKTTL   L+  +    PG  V  
Sbjct: 32  PWQKLVADVAGERQAEHPERARYQTVVVTVP--RQSGKTTLIKALMAAVAQANPGCQVYY 89

Query: 113 LANSETQLKTTL--WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
            A +    K  +  W E++K L             + + P       +    G +   + 
Sbjct: 90  TAQTR---KDAVEKWGELAKQLRKD----------MGIAPDGKPRVKVLEGTGNERIVFR 136

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP----DVINLGILGF------------ 214
                     P T  G H      ++ DEA        D +                   
Sbjct: 137 GTESMIMPFAP-TVEGIHGKTSPLVVVDEAWAFDQARGDDLMAAFNPVGLTIPHSQVWII 195

Query: 215 LTERNANRFWI---------MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPS- 264
            T  +    W+           ++P   +  F    ++ +       + +       P+ 
Sbjct: 196 STAGDTRSEWLRSLVDKGRQAINDPGTTTAFFEWSADEEMAAAN---LRSDEALAFHPAI 252

Query: 265 ------FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
                 +    +A+   D  + R      +P     S + L   E+    EP   P   +
Sbjct: 253 GFTQELWKIQSLAQTEPDH-LYRRSYLNLWPTAAETSIVDLEAWEKLAEPEPASMPPD-V 310

Query: 319 IMGCDIAEEGGDNTVVVL-RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDAN 377
            +G D+A      T+    + G  ++     SK         I+ L E   P A++ D +
Sbjct: 311 AIGFDVATARTGATIYAAWQDGETVQIHRLVSKAGAAWVEKAIAHLQETLAPMAVVADDS 370

Query: 378 NTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
                  + L   G  +Y       A+      +  +E   +++D 
Sbjct: 371 GDNRPIIEALRRNGKEIY-------ALRPREYASANSEFFARISDN 409


>gi|300088757|ref|YP_003759279.1| hypothetical protein Dehly_1680 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528490|gb|ADJ26958.1| conserved hypothetical protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 507

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 62/394 (15%), Positives = 109/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L       
Sbjct: 66  TDALHYAFTTRGGQGLIAAPHQGHLDTII-EEIEFQLDSNPD----LMNSIALTKYGKPK 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     + +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSEQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSELRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGGDNTVVVL-------RRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+        +VV        R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQEMEIGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|262194298|ref|YP_003265507.1| hypothetical protein Hoch_1017 [Haliangium ochraceum DSM 14365]
 gi|262077645|gb|ACY13614.1| protein of unknown function DUF264 [Haliangium ochraceum DSM 14365]
          Length = 478

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 41/288 (14%), Positives = 85/288 (29%), Gaps = 52/288 (18%)

Query: 227 TSNPRRLSGKFYEI----------FNKPLDDWKRFQIDTRTVEGIDPSF----HEGIIAR 272
            S P    G F+EI            +    W R +     ++           E  +A 
Sbjct: 183 CSTPLGRRGIFWEISTEELRKYPHHTRDEVPWWRCRFFCLDIDRAVREAPHMPTEERVAA 242

Query: 273 YGLDSDV----------TRVEVCGQFPQQDIDSFIPLNIIEEALNRE--------PCPDP 314
           +G  + V           + E    F  +   S+ P  +I    + +          P+P
Sbjct: 243 FGTQAIVQQLDSLALEDFQQEFECSFVDESY-SYYPYELILPCTSEDLVLAGDFTDLPEP 301

Query: 315 YAPLIMGCDIAEEGG-DNTVVVLRRGPV--IEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
              ++ G D+          V    G       L  + +         +   +++     
Sbjct: 302 EGRIVAGFDVGRTRDHSELAVFEDTGGHFVCRLLRRYDQVPFAEQEADLRRFLDRVPVAR 361

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL---EFAS 428
           + ID +  G    + L      V            +   N   E        L   +  +
Sbjct: 362 LSIDQSGIGMHLAENLARDYAQVVG----------DTFTNDNKERWATDLKILFQRKDIA 411

Query: 429 LINHSGLIQNLKSLKSFIVPNTGELAIESKRV-KGAKSTDYSDGLMYT 475
           L     L+  + S+K  ++P+ G++  +++R  +G  + D    +   
Sbjct: 412 LPRDRELVGQIHSIKRRVLPS-GKVGFDAERSTRGGHA-DRFWAIALA 457


>gi|255103207|ref|ZP_05332184.1| hypothetical protein CdifQCD-6_20513 [Clostridium difficile
           QCD-63q42]
          Length = 582

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 69/505 (13%), Positives = 144/505 (28%), Gaps = 118/505 (23%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
             + P  + +++           +     +  +    A RG+GK+ L       +   +P
Sbjct: 31  YLANPHRFCMDYFGFNLHLFQQILIYMMMKSDQFVFIASRGLGKSWLLGVFCCVIAVLKP 90

Query: 107 GISVICLANSETQLKTTLWAEVS-----KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS 161
           G  V+  A  + Q K  + +++      K  +L      F++ +  +    W    +   
Sbjct: 91  GTCVLIAAKRKKQAKLLITSKILGDLYLKSDTLKREIKSFQVNAQEVSIDFWNGSRIEAV 150

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD-VINLGILGFLTERNA 220
           +  D        R Y                  +I DE     +  +N  ++ FLT    
Sbjct: 151 VSNDD------ARGYRAN--------------VLIVDEYRMVDEGTVNDVLVPFLTNPRQ 190

Query: 221 NRFWIMTSNPRR-----------LSGKFYEIFNKPLDDWKRFQI---------------D 254
                   NP+            LS  +Y          +  +                 
Sbjct: 191 PG---YLQNPKYRYMQEENKEIYLSSGWYSQHWSYKKFMETVKGMLSGEDMFACSIPFTC 247

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI----------------P 298
           +     +        + +  +      +E CG F  +  D+F                 P
Sbjct: 248 SLEHGLLTKKRILKEMKKESMSDASFMMEYCGVFYNESDDAFFKSSWVNPCRVLESMFYP 307

Query: 299 LNIIEEALNREPCPDPY-------APLIMGCDI--AEEGGDNTVVV------LRRGPV-- 341
            + IE   N++     Y          I+G DI  A    ++  +          G    
Sbjct: 308 PSDIEYLENKKKRDKKYHLNKIKGEIRIIGADIALARGVKNDNSIYTLMRMLPNEGTYKR 367

Query: 342 -IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART--------CDYLEMLGY 392
            + H+  ++  +      ++  L   ++ D +I+D    G            D      Y
Sbjct: 368 CVVHIEAYNGMEAEKQAIRLKQLFSDFQADYMILDTQGIGTTVWSYIQKANYDSDRDEWY 427

Query: 393 HVYRVLGQKRAVDL-------------EFCRNRRTELHVKMADWLEFASL------INHS 433
             Y    +   VD              +   +   ++ + + D L   +L      I   
Sbjct: 428 DAYTCFNEDNTVDKSLAKKSLPVVYSMKAYADENHKMAMSLRDVLTNRTLELPISDIEAK 487

Query: 434 GLIQNLKSLKSFIVPNTGELAIESK 458
            +I   + +K+  +    E  +E+K
Sbjct: 488 EMILEKEMIKADEIDKKAE--LEAK 510


>gi|197249763|ref|YP_002147654.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197213466|gb|ACH50863.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 588

 Score = 57.8 bits (138), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 48/143 (33%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|152982949|ref|YP_001353896.1| hypothetical protein mma_2206 [Janthinobacterium sp. Marseille]
 gi|151283026|gb|ABR91436.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 436

 Score = 57.8 bits (138), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 84/276 (30%), Gaps = 35/276 (12%)

Query: 82  ISAGRGIGKT-TLNAWLVLWLMSTRP-GISVICLANSETQLKTTLWAEVSKWLSLLPNKH 139
           + A R  GKT      L+   ++          +A    Q K+  W  V ++ +++P   
Sbjct: 29  VVAHRRAGKTVACVNELIKAALTFHGNDGRFAYVAPFYRQAKSVAWDYVKRFSAVIPGIS 88

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
             E +    +P                       + +  +  D   G        ++ DE
Sbjct: 89  INESELRIDYPNGSR------------------IQLFGADNADALRGLFFDG---VVADE 127

Query: 200 ASGTPDVINL-GILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP--LDDWKRFQIDTR 256
                  +    I   L +R    + ++   P+  +  + EI+      +DW    I   
Sbjct: 128 YGDWKPSVWGYVIRPALADRGG--WAVIIGTPKGRNQFW-EIYQHAGVNEDWLCLTIRAS 184

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA 316
               + P   E +  +  L  D  R E+   F      +     I +   +     D Y 
Sbjct: 185 ESGLLPPKEIEAL--QLELTEDAWRQEMECDFDAALPGAIFGKEIWQAEQDGRVKDDLYD 242

Query: 317 P---LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS 349
           P   +    D+     D  +   + G  +  +  +S
Sbjct: 243 PELKVHAVLDLG-FTDDTAIWWFQVGKELRIIDCYS 277


>gi|331656886|ref|ZP_08357848.1| terminase, ATPase subunit [Escherichia coli TA206]
 gi|331055134|gb|EGI27143.1| terminase, ATPase subunit [Escherichia coli TA206]
          Length = 531

 Score = 57.8 bits (138), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 291 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 347

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 348 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 407

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 408 QYNVTYIGIDSTGVGHGVYENVK 430


>gi|78355964|ref|YP_387413.1| hypothetical protein Dde_0917 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218369|gb|ABB37718.1| hypothetical protein Dde_0917 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 507

 Score = 57.8 bits (138), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 62/394 (15%), Positives = 109/394 (27%), Gaps = 69/394 (17%)

Query: 38  WGEKGTPLEGFSAPRSW--QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNA 95
           WG+        S    W  Q+E +     + ++                GR +GK+ + +
Sbjct: 20  WGQAYLYNRDGSGRDYWPHQVEDLRCPAKNIIHLD--------------GRDVGKSIVLS 65

Query: 96  WLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYS 155
              L    T  G   +  A  +  L T +  E+   L   P+     M S++L       
Sbjct: 66  TDALHYAFTTRGGQGLVAAPHQGHLDTII-EEIEFQLDTNPD----LMNSIALTKYGKPK 120

Query: 156 DVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFL 215
                   ++  + S +    +    D F   H      +  DE +   +     +   L
Sbjct: 121 IHRKPYFRLEFTNGSVLYFRPAGAYGDAFRSLHVGR---VWVDEGAWLTERAWKALRQCL 177

Query: 216 TERNANRFWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARY- 273
                 R +   S P  L    +Y +     + +  F+  +             ++  Y 
Sbjct: 178 KAGGTLRIY---STPNGLRDTTYYRL--TSSEQFHVFRWPSWLNPLWTEDREAELLEFYG 232

Query: 274 GLDSDVTRVEVCGQFPQQDIDSF-----------------IPLNII--------EEALNR 308
           G DS   + EV G+  +    +F                 I +           E A +R
Sbjct: 233 GRDSSGWQHEVAGEHGKPSYGAFNVEQFNLCRQDLLEYQKIVITDSELRDCDTEEAAHDR 292

Query: 309 -----EPCPDPYAPLIMGCDIAEEGGDNTVVVL-------RRGPVIEHLFDWSKTDLRTT 356
                   P      + G D+        +VV        R    +              
Sbjct: 293 LEMLLNLTPRSGQFWVGG-DLGYTNDPTEIVVFQEMEVGERTLLKMILRVHLEHVSYPHI 351

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              I+ L   Y P  I +D    G      L  L
Sbjct: 352 AQIIALLERYYTPAGIGVDNGGNGLAVVQELLTL 385


>gi|34335039|gb|AAQ65014.1| unknown [synthetic construct]
 gi|301159280|emb|CBW18795.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|323131065|gb|ADX18495.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 48/143 (33%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|200387487|ref|ZP_03214099.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199604585|gb|EDZ03130.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 48/143 (33%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|221196218|ref|ZP_03569265.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221202891|ref|ZP_03575910.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221176825|gb|EEE09253.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221182772|gb|EEE15172.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 424

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 67/240 (27%), Gaps = 35/240 (14%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTL-NAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
              +     E  +  I  GR  GKTTL       W      G+ V     +         
Sbjct: 14  QAEIGRAFNESRRVVIRCGRRFGKTTLLERCASKWA---YNGLKVGWFGPTYK------- 63

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
                 L+L   K         ++       V+  + G   + ++           D   
Sbjct: 64  ------LNLPTYKRILRTVQPVVYSKSKIDQVIELNSGGCIEFWTL---------QDEDA 108

Query: 186 GHHNTYGMAIINDEASGTPD---VINLGILGFLTERNANRFWIMTSNPRR--LSGKFYEI 240
           G    Y   +I DE S  P     I    +   T  +     IM   P+       FYE 
Sbjct: 109 GRSRFYD-RVIIDEGSLVPKGLRSIWEQAI-APTLLDRKGHAIMAGTPKGIDPENFFYEA 166

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
                  W+ F   T +   +DP     +   Y   + V + E    F   +  +F    
Sbjct: 167 CTDKTLGWREFHAPTASNPMLDPEAVARLKDEY--PALVYQQEYLADFVDWNGAAFFSEE 224


>gi|16763092|ref|NP_458709.1| terminase subunit [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|25315565|pir||AH1037 probable terminase chain [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16505400|emb|CAD06749.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 50/143 (34%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFID-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDNT---VVVL--RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+    V+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVIAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|309797383|ref|ZP_07691776.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
 gi|308119007|gb|EFO56269.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
          Length = 418

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 48/335 (14%), Positives = 105/335 (31%), Gaps = 46/335 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           + +V  H        +P  FK  + AGR  GK+ L+   ++   +      V  +A +  
Sbjct: 7   LSLVQLHSGQMKVFQSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ 65

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
             +  LW ++ + L                 P  W       ++ I  K+ S +      
Sbjct: 66  MARQILWDDLQEVL-----------------PRKWVRKKNDTTMTIVLKNGSEIALK-GA 107

Query: 179 ERPDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
           ++PDT  G        ++ DE      D     +   L+        ++   P+    +F
Sbjct: 108 DKPDTLRGV---ALHFVVLDEFQDMKADTWYKVLRPTLSS--TRGGALIIGTPKG-FSEF 161

Query: 238 YEIFN-------KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
           ++++        +    WK +Q  T     +  +  E       +D      E    F  
Sbjct: 162 HKLWTIGQNVELQRKGQWKSWQFVTADSPFVPTAEIEAAKND--MDPKSFAQEYLASFEN 219

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
                + P +       +    +P  P+ +G D      D    V+ +      L+   +
Sbjct: 220 MSGRVYYPFD--RNVHVKPLQFNPRLPIWVGQD---FNIDPMSSVILQPQPNGELWAIDE 274

Query: 351 -----TDLRTTNNKISGLVEKYRPD-AIIIDANNT 379
                ++     +++     +++    +  D    
Sbjct: 275 LVLFSSNTAEVCDELERRFWRWKSQVTVFPDPAGA 309


>gi|163801735|ref|ZP_02195633.1| hypothetical protein 1103602000597_AND4_09782 [Vibrio sp. AND4]
 gi|159174652|gb|EDP59454.1| hypothetical protein AND4_09782 [Vibrio sp. AND4]
          Length = 546

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 34/260 (13%), Positives = 71/260 (27%), Gaps = 55/260 (21%)

Query: 195 IINDEASGTP--DVINLGILGFLTERNANRFWIMTSNPRRLSGKFY-----EIFNKPLDD 247
           +  DE    P  D +N       T +N  +     S P   + + Y     + + +  D 
Sbjct: 211 VYVDEYFWIPKFDELNKLASAMATHKNWRKT--YFSTPSAKTHQAYTFWTGDQWRRGRDT 268

Query: 248 WKRFQIDT----RTVEGIDPSF--------------------HEGIIARYGLDSDVTRVE 283
               +  T    R    + P                       + +   Y  D       
Sbjct: 269 RANIEFPTFDEYRDGGRLCPDKQWRYVVTIEDAAAGGCELFDIDELRDEYSKDD--FDNL 326

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNT- 332
               F      S    + +E+A+        + P          + +G D +    +   
Sbjct: 327 FMCIFVDGAS-SVFKFSALEKAMVDISRWQDFKPNDNDPFERREVWLGYDPSRTRDNACL 385

Query: 333 ------VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
                 V+ + +   +     W   + +    ++S + E+Y    + ID    GA   D 
Sbjct: 386 VVVAPPVIAIEK-FRVLEKHYWRGLNFQYQAQQVSKVFERYNVSYLGIDTTGIGAGVYDL 444

Query: 387 L-EMLGYHVYRVLGQKRAVD 405
           L +        +     + +
Sbjct: 445 LSKKHPRETVAIQYSNESKN 464


>gi|253689540|ref|YP_003018730.1| hypothetical protein PC1_3171 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756118|gb|ACT14194.1| protein of unknown function DUF264 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 589

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 62/205 (30%), Gaps = 30/205 (14%)

Query: 246 DDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
             W++   ++     G +    + ++  Y       +  +  +F      S  P   ++ 
Sbjct: 329 GQWRQIVTVEDALSGGCNLFDLDQLMLEY--SPAEYQNLLMCEFVDDKA-SVFPFEELQR 385

Query: 305 ALNREPCPDP-----------YAPLIMGCDIAEEGGDNTVVVLRR----GPVIEHL--FD 347
            +                   Y P+ +G D +  G     VVL      G     L  F 
Sbjct: 386 CMVDALEEWEDFNPYALRPFAYKPVWIGYDPSHTGDSAGCVVLAPPQAPGGKFRILERFQ 445

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE 407
           W   D     + I  L EKY  + I IDA   G      +               A +++
Sbjct: 446 WKGMDFAAQADAIKLLTEKYIVEYIGIDATGIGQGVYQLVRG---------FFPAAREIK 496

Query: 408 FCRNRRTELHVKMADWLEFASLINH 432
           +    +T + +K  D +    L   
Sbjct: 497 YSPEIKTAMVLKAKDTITSGRLEYD 521


>gi|213650797|ref|ZP_03380850.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
          Length = 518

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 278 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 334

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 335 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 394

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 395 QYNVTYIGIDSTGVGHGVYENVK 417


>gi|309795387|ref|ZP_07689805.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308121037|gb|EFO58299.1| conserved hypothetical protein [Escherichia coli MS 145-7]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|16766035|ref|NP_461650.1| terminase-like protein [Enterobacteria phage Fels-2]
 gi|169936048|ref|YP_001718747.1| P2 gpP-like protein [Enterobacteria phage Fels-2]
 gi|16421269|gb|AAL21609.1| Fels-2 prophage protein [Enterobacteria phage Fels-2]
 gi|312913743|dbj|BAJ37717.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 48/143 (33%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFID-DLASVFPLSELQACMVDSWEVWTDFQALALRPFG 404

Query: 315 YAPLIMGCDIAEE---GGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+    G     VV+      G     L    W   D R   + I  L +
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQ 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|323938219|gb|EGB34479.1| terminase [Escherichia coli E1520]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|291335343|gb|ADD94958.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C148]
          Length = 234

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 73/187 (39%), Gaps = 23/187 (12%)

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEE----RPDTFVGHHNTYGMAIINDEASG 202
            L P PW        L ++  + ST+    +E     R  +  G        ++ DEA+ 
Sbjct: 12  KLVPKPWIKTKNETDLKLELVNGSTIELKGTENAMALRGRSLSG--------VVLDEAAF 63

Query: 203 T-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF----NKPLDDWKRFQIDTRT 257
              +V    I   L ++    + +  S P   +  FY+++    + P ++WKR+   T  
Sbjct: 64  MDAEVWFEVIRPALADKQG--WALFISTPDGTASWFYDLWCYCEDDPTNEWKRWCYTTIE 121

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
              +     E   A+  LD    R E    F  +++   + ++  ++ ++ +       P
Sbjct: 122 GGNVPQEEVEAARAQ--LDPRTFRQEFEASF--ENLTGLVAISFSDDNISTDAKDISIQP 177

Query: 318 LIMGCDI 324
           L++G D 
Sbjct: 178 LLLGVDF 184


>gi|198245759|ref|YP_002216726.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197940275|gb|ACH77608.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624483|gb|EGE30828.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 588

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|170020778|ref|YP_001725732.1| hypothetical protein EcolC_2777 [Escherichia coli ATCC 8739]
 gi|169755706|gb|ACA78405.1| protein of unknown function DUF264 [Escherichia coli ATCC 8739]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|306812733|ref|ZP_07446926.1| Terminase, ATPase subunit (GpP) [Escherichia coli NC101]
 gi|305853496|gb|EFM53935.1| Terminase, ATPase subunit (GpP) [Escherichia coli NC101]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|300907199|ref|ZP_07124862.1| hypothetical protein HMPREF9536_05153 [Escherichia coli MS 84-1]
 gi|301303626|ref|ZP_07209748.1| hypothetical protein HMPREF9347_02221 [Escherichia coli MS 124-1]
 gi|300401074|gb|EFJ84612.1| hypothetical protein HMPREF9536_05153 [Escherichia coli MS 84-1]
 gi|300841125|gb|EFK68885.1| hypothetical protein HMPREF9347_02221 [Escherichia coli MS 124-1]
 gi|315257856|gb|EFU37824.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWSDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|253774139|ref|YP_003036970.1| hypothetical protein ECBD_2764 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160943|ref|YP_003044051.1| Terminase, ATPase subunit [Escherichia coli B str. REL606]
 gi|242376647|emb|CAQ31358.1| ybl37 [Escherichia coli BL21(DE3)]
 gi|253325183|gb|ACT29785.1| protein of unknown function DUF264 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972844|gb|ACT38515.1| Terminase, ATPase subunit [Escherichia coli B str. REL606]
 gi|253977058|gb|ACT42728.1| Terminase, ATPase subunit [Escherichia coli BL21(DE3)]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEIWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|16762249|ref|NP_457866.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143738|ref|NP_807080.1| terminase ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|215485952|ref|YP_002328383.1| predicted terminase, ATPase subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312969111|ref|ZP_07783318.1| terminase, ATPase subunit [Escherichia coli 2362-75]
 gi|25315563|pir||AB0927 terminase, ATPase chain [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504553|emb|CAD09436.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139373|gb|AAO70940.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|215264024|emb|CAS08365.1| predicted terminase, ATPase subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286513|gb|EFR14426.1| terminase, ATPase subunit [Escherichia coli 2362-75]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|324112701|gb|EGC06677.1| terminase [Escherichia fergusonii B253]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|323953478|gb|EGB49344.1| terminase [Escherichia coli H252]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|157160343|ref|YP_001457661.1| terminase, ATPase subunit [Escherichia coli HS]
 gi|218559567|ref|YP_002392480.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|256021061|ref|ZP_05434926.1| Terminase, ATPase subunit (GpP) [Shigella sp. D9]
 gi|300817075|ref|ZP_07097294.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|331662228|ref|ZP_08363151.1| terminase, ATPase subunit [Escherichia coli TA143]
 gi|331676606|ref|ZP_08377302.1| terminase, ATPase subunit [Escherichia coli H591]
 gi|332282288|ref|ZP_08394701.1| DNA-dependent ATPase terminase subunit [Shigella sp. D9]
 gi|157066023|gb|ABV05278.1| terminase, ATPase subunit [Escherichia coli HS]
 gi|218366336|emb|CAR04087.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|300530427|gb|EFK51489.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|315615257|gb|EFU95893.1| terminase, ATPase subunit [Escherichia coli 3431]
 gi|323172219|gb|EFZ57857.1| terminase, ATPase subunit [Escherichia coli LT-68]
 gi|323190830|gb|EFZ76098.1| terminase, ATPase subunit [Escherichia coli RN587/1]
 gi|323942735|gb|EGB38900.1| terminase [Escherichia coli E482]
 gi|323946304|gb|EGB42336.1| terminase [Escherichia coli H120]
 gi|323963883|gb|EGB59377.1| terminase [Escherichia coli M863]
 gi|327252355|gb|EGE64027.1| terminase, ATPase subunit [Escherichia coli STEC_7v]
 gi|331060650|gb|EGI32614.1| terminase, ATPase subunit [Escherichia coli TA143]
 gi|331075295|gb|EGI46593.1| terminase, ATPase subunit [Escherichia coli H591]
 gi|332104640|gb|EGJ07986.1| DNA-dependent ATPase terminase subunit [Shigella sp. D9]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|312970940|ref|ZP_07785119.1| terminase, ATPase subunit [Escherichia coli 1827-70]
 gi|310336701|gb|EFQ01868.1| terminase, ATPase subunit [Escherichia coli 1827-70]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|307314499|ref|ZP_07594102.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905922|gb|EFN36444.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|315060102|gb|ADT74429.1| terminase, ATPase subunit [Escherichia coli W]
 gi|323379340|gb|ADX51608.1| terminase ATPase subunit [Escherichia coli KO11]
 gi|332342200|gb|AEE55534.1| phage terminase, ATPase subunit [Escherichia coli UMNK88]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|26246838|ref|NP_752878.1| terminase, ATPase subunit [Escherichia coli CFT073]
 gi|26107238|gb|AAN79421.1|AE016758_25 Terminase, ATPase subunit [Escherichia coli CFT073]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|300916285|ref|ZP_07133032.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300416374|gb|EFJ99684.1| conserved hypothetical protein [Escherichia coli MS 115-1]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|271499312|ref|YP_003332337.1| hypothetical protein Dd586_0742 [Dickeya dadantii Ech586]
 gi|270342867|gb|ACZ75632.1| protein of unknown function DUF264 [Dickeya dadantii Ech586]
          Length = 591

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/162 (16%), Positives = 54/162 (33%), Gaps = 20/162 (12%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  E +  RY +D+    +     F   + D+    + +
Sbjct: 329 PDGQWRYVITMEDAIRGGFNLASLEKLRNRYNVDT--FNMLYMCVFVD-NKDAVFSFDDL 385

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTV------VVLRRGPVIEHLF 346
           E           + P          +  G D A  G  +T       +       +  + 
Sbjct: 386 ERCGVDPATWQDHDPTAPRPFGNREVWGGYDPARSGDLSTFVIVAPPIYEGEKFRVLLVV 445

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +W   + R   N+I  L ++Y    I ID    GA   + ++
Sbjct: 446 NWHGMNFRYQANQIKKLFQRYHFTYIGIDVTGIGAGVFENIQ 487


>gi|222034345|emb|CAP77086.1| Terminase, ATPase subunit [Escherichia coli LF82]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|218690765|ref|YP_002398977.1| terminase, ATPase subunit (GpP) [Escherichia coli ED1a]
 gi|218428329|emb|CAR09255.2| Terminase, ATPase subunit (GpP) [Escherichia coli ED1a]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|300896792|ref|ZP_07115295.1| terminase, ATPase subunit family protein [Escherichia coli MS
           198-1]
 gi|300359367|gb|EFJ75237.1| terminase, ATPase subunit family protein [Escherichia coli MS
           198-1]
          Length = 391

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 51/184 (27%), Gaps = 29/184 (15%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--------- 316
            E +       +D  +     +F      S  P   ++  +                   
Sbjct: 218 IEQLKRE--NSADDFKNLFMCEFVDDKA-SVFPFEELQRCMVDTLEEWEDYAPFAAHPFG 274

Query: 317 --PLIMGCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL      G     L    W   D  T    I  L EKY 
Sbjct: 275 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 334

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 335 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPELKTAMVLKAKDVIRRGC 385

Query: 429 LINH 432
           L   
Sbjct: 386 LEYD 389


>gi|320199051|gb|EFW73648.1| Phage terminase, ATPase subunit [Escherichia coli EC4100B]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|304360765|ref|YP_003856886.1| gp8 [Mycobacterium phage Angelica]
 gi|302858349|gb|ADL71097.1| gp8 [Mycobacterium phage Angelica]
          Length = 473

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 69/389 (17%), Positives = 123/389 (31%), Gaps = 57/389 (14%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             WQ +  ++V A    S      ++F  +I   R  GKT     +V       PG +VI
Sbjct: 43  DQWQDDLGKLVCAK--RSDGLYAADMFAMSIP--RQTGKTYFLGAIVFAFCKMNPGTTVI 98

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             A+     +T   AE  K +  L  +       L++H             G ++  ++ 
Sbjct: 99  WTAH-----RTRTAAETFKSMQALAKREQIAPHILNVH----------TGNGKEAVLFTN 143

Query: 172 MCRTYSEERPDTF-VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
             R     R   F  G        +I DEA    +     ++   T  + N   +    P
Sbjct: 144 GSRILFGAREKGFGRGF--AKVDVLIFDEAQILSENAMDDMIPA-TNASPNGLILFAGTP 200

Query: 231 RRLS--GKFY-----EIFNKPLDD--WKRFQIDTRTVEGIDPSFHEGI------------ 269
            + +  G+ +     +  N   DD  +     D       + ++ +              
Sbjct: 201 PKPTDPGEVFTNLRMDALNGESDDVAYVEISADENDDPDEESTWRKMNPSYPHRTSARAI 260

Query: 270 -IARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC----PDPYA-PLIMGCD 323
              R  L  D  R E  G + +  + +     +I+  L R+      P+P A P  +G D
Sbjct: 261 RRMRKALSWDSFRREAMGIWDKISVHA----QVIKAGLWRDLADPLGPEPGAKPASLGVD 316

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFD-WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
           ++  G  +          + H+   W+ TD       I       R   ++ID  +    
Sbjct: 317 MSHGGAISIGGCWLIDDELRHVEQVWAGTDTAAAVEFIVERAG--RRIPVVIDDASPAKA 374

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRN 411
               L+     V        A      +N
Sbjct: 375 LVPELKRRKVKVRITYAGDMAKACGLFKN 403


>gi|82543312|ref|YP_407259.1| terminase, ATPase subunit [Shigella boydii Sb227]
 gi|81244723|gb|ABB65431.1| terminase, ATPase subunit [Shigella boydii Sb227]
 gi|320185726|gb|EFW60482.1| Phage terminase, ATPase subunit [Shigella flexneri CDC 796-83]
 gi|332097052|gb|EGJ02035.1| terminase, ATPase subunit [Shigella boydii 3594-74]
          Length = 588

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 23/143 (16%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-----------NREPCPDP 314
            + +   Y    D  +  +  +F   D+ S  PL+ ++  +                P  
Sbjct: 348 LDQLRMEY--SPDEYQNLLMCEFVD-DLASVFPLSELQACMVDSWEVWTDFHALALRPFG 404

Query: 315 YAPLIMGCDIAE--EGGDN--TVVVL---RRGPVIEHL--FDWSKTDLRTTNNKISGLVE 365
           +  + +G D A+  + GD+   VVV      G     L    W   D R   + I  L E
Sbjct: 405 WREVWIGYDPAKGTQNGDSAGCVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTE 464

Query: 366 KYRPDAIIIDANNTGARTCDYLE 388
           +Y    I ID+   G    + ++
Sbjct: 465 QYNVTYIGIDSTGVGHGVYENVK 487


>gi|307129625|ref|YP_003881641.1| hypothetical protein Dda3937_02574 [Dickeya dadantii 3937]
 gi|306527154|gb|ADM97084.1| Possible phage protein [Dickeya dadantii 3937]
          Length = 591

 Score = 57.4 bits (137), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 57/162 (35%), Gaps = 20/162 (12%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  E +  RY +D+    +     F   + D+    + +
Sbjct: 329 PDGQWRYVITMEDAIRGGFNLASLEKLRNRYNVDT--FNMLYMCVFVD-NKDAVFSFDDL 385

Query: 303 EEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVV----LRRGPVIEHLF-- 346
           E           + P          +  G D A  G  +T+V+    +  G     L   
Sbjct: 386 ERCGVDPATWQDHDPTAPRPFGNREVWGGYDPARSGDLSTLVIVAPPIYDGEKFRVLLVV 445

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +W   + R   N+I  L ++Y    I ID    GA   + ++
Sbjct: 446 NWHGMNFRYQANQIKKLFQRYHFTYIGIDVTGIGAGVFENIQ 487


>gi|260599032|ref|YP_003211603.1| Terminase, ATPase subunit [Cronobacter turicensis z3032]
 gi|260218209|emb|CBA33092.1| Terminase, ATPase subunit [Cronobacter turicensis z3032]
          Length = 590

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 40/143 (27%), Gaps = 18/143 (12%)

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY-----------APLIM 320
           +    ++  R     +F      S  P   ++  +                     P+ +
Sbjct: 355 KRENSAEDFRNLFMCEFVDDKA-SVFPFEELQRCMVDSLEEWEDFSPFAARPFGSRPVWI 413

Query: 321 GCDIAEEGGDNTVVVL----RRGPVIEHL--FDWSKTDLRTTNNKISGLVEKYRPDAIII 374
           G D +  G     VVL      G     L    W   D  T    I  L EKY+ + I I
Sbjct: 414 GYDPSHTGDSAGCVVLAPPVVSGGKFRILERHQWKGMDFATQAQAIRELTEKYQVEYIGI 473

Query: 375 DANNTGARTCDYLEMLGYHVYRV 397
           DA   G      +         +
Sbjct: 474 DATGIGQGVFQLVRAFWPAAREI 496


>gi|291334416|gb|ADD94071.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1035]
 gi|291334470|gb|ADD94124.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1161]
          Length = 223

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 34/235 (14%), Positives = 72/235 (30%), Gaps = 31/235 (13%)

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
                 +A +  Q K+  W  + ++ + +PN  + E +     P      +L        
Sbjct: 6   NPRFAYIAPTFKQAKSIAWDYMKQFTAKIPNTKFNETELRVDLPNGSRITLLG------- 58

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN-LGILGFLTERNANRFWI 225
                       E  D   G +       + DE +     +    I   L++R    + +
Sbjct: 59  -----------AENSDGLRGIYLDGC---VIDEYANIDGKLFAEIIRPALSDR--KGYCV 102

Query: 226 MTSNPRRLSGKFYEIFNKPLD--DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
               P  ++  FY+++       DW  ++      + +DP   E      G        E
Sbjct: 103 FIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKK--YLQE 160

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGG--DNTVVVL 336
               +      +     I +     +    PY P  +    A + G  D++ ++ 
Sbjct: 161 FECDWIANIEGAIYGEEIAKIEDKNQIARVPYDP-TLPVSTAWDLGVADHSSIIF 214


>gi|296103195|ref|YP_003613341.1| hypothetical protein ECL_02853 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057654|gb|ADF62392.1| hypothetical protein ECL_02853 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 591

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 55/169 (32%), Gaps = 20/169 (11%)

Query: 244 PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           P   W+    ++     G + +  E +  RY  ++    +     F     DS    + +
Sbjct: 328 PDGQWRYVITMEDAIAGGFNLANIEKLRNRY--NTATFDMLYMCVFVDSK-DSVFSFSDL 384

Query: 303 EEA---LNREPCPDPYA-------PLIMGCDIAEEGGDNTVVVL------RRGPVIEHLF 346
           E     ++     DP A       P+  G D A  G  +  V++           +  + 
Sbjct: 385 EACGVEMDTWQDHDPDAKRPFGDRPVWGGFDPARSGDLSCFVIVAPPMFAVEKFRVLKVI 444

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
            W   + R    +I  L ++Y    + +D    G    D ++     V 
Sbjct: 445 YWKGMNFRYQAKQIEKLFDQYNFTYLGVDVTGIGQGVFDNIQHFAMKVV 493


>gi|310815629|ref|YP_003963593.1| Putative large terminase [Ketogulonicigenium vulgare Y25]
 gi|308754364|gb|ADO42293.1| Putative large terminase [Ketogulonicigenium vulgare Y25]
          Length = 427

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 68/424 (16%), Positives = 113/424 (26%), Gaps = 75/424 (17%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGIS---------VICLANSETQLKTTLWAEVSKWL 132
           I  GRG GKT   A    W+ S   G           V  +A +  Q +  +        
Sbjct: 36  IMGGRGAGKTRAGA---EWVRSMVEGPRPDTPGRAKRVGLIAQTMDQAREVMV------- 85

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
                   F    L     P           +         R +S   P+   G      
Sbjct: 86  --------FGDSGLMACCPPARRPEWIAGRAMLRWPNGAEARLFSAHDPEALRGPQFD-- 135

Query: 193 MAIINDEASG--TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR 250
            AI  DE +           ++  L   +  R            G F             
Sbjct: 136 -AIWADEVAKWRLAQEAWDMLVMGLRLGDDPR---ACLTTTPRGGPFLRKLLAQSGTVMT 191

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
                     + P F   + A +   S + R E+ G    +   +  P ++++ AL R+ 
Sbjct: 192 HAPTRANRANLAPGFVAAVEAMF-EGSHLGRQELDGLLVDEAEGTLWPQHLLDAALQRQA 250

Query: 311 CPDPYAPLIMGCDI---AEEGGDNTVVVLRRGPVIEHLFDWS----------KTDLRTTN 357
            P     +++  D       G D   +++          DW                T  
Sbjct: 251 PP--LDRIVVAVDPPVTGHAGSDACGIIVAGVEQRGAPTDWRLWVIEDATVQGASPHTWA 308

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
           +       ++  D ++ + N  GA     L  L  H+       RAV     +  R E  
Sbjct: 309 SAAIAAFHRHGADRLVAEVNQGGALVESVLRQLDPHI-----PYRAVRASKSKGARAE-- 361

Query: 418 VKMADWLEFASLINHSGLI---QNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMY 474
             ++   E     +  GL      +  +        G             S D  D L++
Sbjct: 362 -PVSTIYERGRACHLPGLALLEAQMSLMTLQGFTGKG-------------SPDRVDALVW 407

Query: 475 TFAE 478
              E
Sbjct: 408 AAHE 411


>gi|258545857|ref|ZP_05706091.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
 gi|258518873|gb|EEV87732.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
          Length = 595

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 60/201 (29%), Gaps = 29/201 (14%)

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
             I+     G D    E +  ++          +  QF     DS   +  ++  +    
Sbjct: 339 ITIEDAINSGFDRVTLEKLRIKF--PPGQFENLLMCQFVNDG-DSIFKMAELQRCMVDAW 395

Query: 311 CPDPYA-----------PLIMGCDIAEEGGDNTVVVL----RRGPVIEHLFD--WSKTDL 353
                            P+ +G D +    D ++VV+      G V   +    ++  D 
Sbjct: 396 TVWQDYTPLAARPLGDVPVWIGYDPSRSQDDASLVVIAPPQVEGGVFRIIDKQSFNGLDF 455

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                KI      Y    I IDA   G    D +      V ++L    A +        
Sbjct: 456 DAQARKIRDFCRMYNVVHIAIDATGIGQAVYDLVRQFFPRVRKILYSVEAKN-------- 507

Query: 414 TELHVKMADWLEFASLINHSG 434
            E+ +K    +  A L   +G
Sbjct: 508 -EMVLKAKQLIAHARLQWDNG 527


>gi|291334530|gb|ADD94183.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C1201]
 gi|291334650|gb|ADD94297.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C695]
          Length = 223

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 32/240 (13%), Positives = 72/240 (30%), Gaps = 31/240 (12%)

Query: 102 MSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS 161
           M          +A +  Q K+  W  + ++   +P+  + E +     P      +L   
Sbjct: 1   MCPHKNPRFAYIAPTFKQAKSIAWDYMKQFTDKIPSTKFNETELRVDLPNGARITLLG-- 58

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN-LGILGFLTERNA 220
                            E  D   G +       + DE +     +    I   L++R  
Sbjct: 59  ----------------AENSDGLRGIYLDGC---VIDEYANIDGKLFAEIIRPALSDR-- 97

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLD--DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSD 278
             + +    P  ++  FY+++       DW  ++      + +D    +      G    
Sbjct: 98  KGYCVFIGTPAGMNNNFYDLYQHANGAEDWFNYKAKASETKIVDQEELDKAKEVMGEKK- 156

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGG--DNTVVVL 336
               E    +      +     I +    ++    PY P  +    A + G  D++ ++ 
Sbjct: 157 -YLQEFECDWIANIEGAIYGEEIAKLDDKKQLARVPYDP-TLPVSTAWDLGVADHSSIIF 214


>gi|51597451|ref|YP_071642.1| orf16-like phage protein [Yersinia pseudotuberculosis IP 32953]
 gi|51590733|emb|CAH22378.1| Possible [Haemophilus phage HP1] orf16-like phage protein [Yersinia
           pseudotuberculosis IP 32953]
          Length = 601

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 47/140 (33%), Gaps = 19/140 (13%)

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP-------- 317
            E +  +Y  ++    +    QF     D+    + +E+          + P        
Sbjct: 354 IERLRNKY--NATAFAMLYMCQFVDSK-DAVFKFSELEKCAVDAGMWQDHDPKAARPFGN 410

Query: 318 --LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
             +  G D +  G ++T V++           +  ++ W   +     ++I  L+ +Y  
Sbjct: 411 REVWGGFDPSRSGDNSTFVIVAPPLYDGERFRVLAVYYWQGLNFNYQADQIKQLMRRYNM 470

Query: 370 DAIIIDANNTGARTCDYLEM 389
             I ID    G    D +E 
Sbjct: 471 TYIGIDITGIGRGVFDLVER 490


>gi|332560992|ref|ZP_08415310.1| hypothetical protein RSWS8N_18139 [Rhodobacter sphaeroides WS8N]
 gi|332274790|gb|EGJ20106.1| hypothetical protein RSWS8N_18139 [Rhodobacter sphaeroides WS8N]
          Length = 468

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 70/237 (29%), Gaps = 18/237 (7%)

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMTSNPRR 232
           T     PDT  G        +I DE +       I   +   +++          S P  
Sbjct: 133 TALPANPDTARGFSAN----VILDEFAFHAKSREIWAALFPVISKGGQKLRV--ISTPNG 186

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
              KFYE+       W R  +D              ++     D D    E   ++  + 
Sbjct: 187 KGNKFYELMTAEGSVWSRHVVDIHEAVRQGLDRDIDMLRAGMADEDAWAQEYELKWLDEA 246

Query: 293 IDSFIPLNIIEEA---LNREPCPDPYAPLIMGCDIAEEGGDNTVVV----LRRGPVIEHL 345
            ++++  ++I          P      P  +G DIA    D  V+     +        +
Sbjct: 247 -NAWLDYDLISACEHPAAGMPGLYMGGPCFVGVDIAARN-DLFVIWVLELVGDVLWTREV 304

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG-ARTCDYLEMLGYHVYRVLGQK 401
               +   +  +  ++ +  ++R     ID    G     D     G  V  +L   
Sbjct: 305 IARRRVSFQEQDRLLAEVFRRFRVVRCRIDQTGMGEKPVEDAKRAHGDRVEGILFSA 361


>gi|188495109|ref|ZP_03002379.1| terminase [Escherichia coli 53638]
 gi|188490308|gb|EDU65411.1| terminase [Escherichia coli 53638]
          Length = 607

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 54/173 (31%), Gaps = 20/173 (11%)

Query: 244 PLDDWK-RFQIDTRTVEGID-PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF--IPL 299
           P   W+    ++    +G+      E +  RY        +    +F       F    L
Sbjct: 336 PDGIWRYVITMEDACAKGLSARVNIEKLRNRYSAT--AFAMLYMCEFTDSRDTVFKFSDL 393

Query: 300 NIIEEALNREPCPDPYA-------PLIMGCDIAEEGGDNTVVVL------RRGPVIEHLF 346
              E         DP A        +  G D +  G ++T V++      +    +  ++
Sbjct: 394 EKCEVEFGIWQDFDPSALRPFGNREVWGGFDPSRTGDNSTFVIVAPPVEPKEKFRVLAVY 453

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL-EMLGYHVYRVL 398
            W   +      +I  L+++YR   I +D    G    D L       V  + 
Sbjct: 454 QWVGLNFTWQVKQIEELMKRYRFTHIGVDITGIGRGVYDQLVRSAPREVMGIN 506


>gi|149911893|ref|ZP_01900493.1| putative bacteriophage terminase, ATPase subunit [Moritella sp.
           PE36]
 gi|149805043|gb|EDM65069.1| putative bacteriophage terminase, ATPase subunit [Moritella sp.
           PE36]
          Length = 601

 Score = 57.0 bits (136), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 56/350 (16%), Positives = 101/350 (28%), Gaps = 77/350 (22%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
           IG T   A+   +         +   A S  Q      AE+ K   +   +  F ++   
Sbjct: 181 IGATFYFAFEAFYDAVVNGRNKIFISA-SRDQ------AEIFKANIIALCREQFGIE--- 230

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD-- 205
           L  +P        +  +  K  ST  RT      D            +  DE    P   
Sbjct: 231 LSGSPLTMRNKGKTTTLYFK--STNARTAQSASGD------------LYIDEVFWIPKFK 276

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF 265
            +        T ++        S P   S + Y+++N     W R        E      
Sbjct: 277 ELRSLAQAMATHKDFRIT--YFSTPSVTSHEAYDLWN---GRWYRKTKACNDPEFAIDVS 331

Query: 266 HEGIIARYGLDSDVTRVEV------------------CGQFPQQDIDSFIPLNIIEEALN 307
           H+ +      D  + R ++                    ++ +++ D+      I++A +
Sbjct: 332 HKTLKHGLLCDDGIWRQKLNVYDVVEQGFDRIDISMLENEYSKEEFDNLFMCKFIDDAHS 391

Query: 308 ----------------------REPCPDPYAPLIMGCDIAEEGGDNTVVVL------RRG 339
                                     P    P+++G D A      +VVVL         
Sbjct: 392 AFSLKQLMACVGNSKKWTDFDPTWSRPYAMKPVVIGFDPARTRDIASVVVLSLPLGPDDK 451

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
             +    + S  D  T  ++I  L  KY    I +D    G    + ++ 
Sbjct: 452 FRLLESLNLSGNDFETMASEIKELTLKYHVVHIGVDTTGMGLGVFELIQK 501


>gi|329122644|ref|ZP_08251223.1| terminase [Haemophilus aegyptius ATCC 11116]
 gi|327472658|gb|EGF18087.1| terminase [Haemophilus aegyptius ATCC 11116]
          Length = 202

 Score = 57.0 bits (136), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 56/158 (35%), Gaps = 19/158 (12%)

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLV 364
            P     + +G D A  G    +V++           + H   +   D  T  ++I    
Sbjct: 16  RPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIKQFC 75

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL 424
           + Y    I+ID    G+     +      V  +         E+  + + E+ +K  + +
Sbjct: 76  DDYNVTRIVIDKTGMGSGVYQEVRKFYPMVQGL---------EYNADLKNEMVLKTQNLI 126

Query: 425 EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESKR 459
           +   L      + ++ +  ++K   +  TG++   S R
Sbjct: 127 QKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDR 163


>gi|83954308|ref|ZP_00963028.1| terminase, large subunit, putative [Sulfitobacter sp. NAS-14.1]
 gi|83841345|gb|EAP80515.1| terminase, large subunit, putative [Sulfitobacter sp. NAS-14.1]
          Length = 408

 Score = 57.0 bits (136), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 64/423 (15%), Positives = 114/423 (26%), Gaps = 73/423 (17%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGIS---------VICLANSETQLKTTLWAEVSKWL 132
           I  GRG GKT   A    W+ +   G           V  +  +  Q++  +        
Sbjct: 16  IMGGRGAGKTRAGA---EWVRAQVEGSRPLDAGRCRRVALVGETIEQVREVM-------- 64

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
             +         S +     W +                +   ++   P+   G      
Sbjct: 65  --IFGDSGILACSPADRRPDWEATRKRLVWPN-----GAVATVHTAHDPEGLRGPQFD-- 115

Query: 193 MAIINDEASGT--PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR 250
            A   DE +     +     +   L     +    +T+ P R  G    +   P      
Sbjct: 116 -AAWVDELAKWKKAEETWDQLQFAL-RLGEDPRACVTTTP-RNVGVLKNLLASPSTV-TT 171

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
                     +  SF E + ARY   + + R E+ G        +      IE    R+ 
Sbjct: 172 HAPTEANAANLAGSFLEEVRARY-RGTRLGRQELDGVLLADAEGALWTSERIEAGRVRDV 230

Query: 311 CPDPYAPLIMGCDIA---EEGGDNTVVVLRRGPVIEHLFDWS----------KTDLRTTN 357
                  +++G D A     G D   +V+          DW                   
Sbjct: 231 PL--LDRIVVGLDPATTAGAGADECGIVVVGAQTQGPPQDWRAVVLADCTVQGATPSGWA 288

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--YHVYRVLGQKRAVDLEFCRNRRTE 415
                 +E+Y  D ++ + N  G    + L  +     V  V   +  V        R E
Sbjct: 289 RAAISAMEQYGADRLVAEVNQGGQMVAEVLRQVDPLVPVKSVHASRGKV-------ARAE 341

Query: 416 LHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
               + +      ++    L   +       +   G         +G  S D  D L++ 
Sbjct: 342 PVAALYEQGRVGHVVGLDALEDQMC-----RMTARGY--------EGGGSPDRVDALVWA 388

Query: 476 FAE 478
             E
Sbjct: 389 LHE 391


>gi|169344384|ref|ZP_02865357.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
 gi|169297509|gb|EDS79616.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
          Length = 415

 Score = 57.0 bits (136), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 51/334 (15%), Positives = 107/334 (32%), Gaps = 37/334 (11%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            G G GK+      +++     PG   + +    + LK +++A     L       W   
Sbjct: 31  GGGGSGKSHFVVQKMIYKYLKYPGRKCLVVRKVNSTLKESIFA-----LFRSVLSDWQIY 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
               ++      ++        +K           E+  +  G  +     I+ +E +  
Sbjct: 86  DECKINKTDLTIELP-------NKSLFIFKGIDDPEKIKSIAGIDD-----IVVEECTEI 133

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK---PLDDWKRFQIDTRTVEG 260
            +     +   L  +N      +  NP   S   Y+ + K      D        +  + 
Sbjct: 134 DEFDFDQLNLRLRSKNPYNQIHVMFNPVSKSNWVYKRWFKNGYDTKDTIVLHTTYKNNKF 193

Query: 261 IDPSFHEGIIARYGLDSDVT-RVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAP 317
           +   + + ++ +   D+ V  R+   G+F    +D  I  N  EE+ + +     +    
Sbjct: 194 LPKDYIDSLL-KLEKDNPVYFRIYALGEF--ATLDKLIYTNWKEESFDYKEILKNNRNTK 250

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD-----LRTTNNKISGLVEKYRPDAI 372
            I   D          V      + + L+ + +             KI  L   YR + I
Sbjct: 251 AIFSLDFGYTNDPTAFVCSIIDKINKKLWIFDEFQEKGLLNDEIAEKIIDL--GYRKEVI 308

Query: 373 IIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
           + D+     ++ + L+  G    RV G  +  D 
Sbjct: 309 VCDS--AEPKSIEELKRNGLS--RVKGAVKGRDS 338


>gi|166012063|ref|ZP_02232961.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167427125|ref|ZP_02318878.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|2996304|gb|AAC13184.1| P-loop protein [Yersinia pestis KIM 10]
 gi|165988997|gb|EDR41298.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167053876|gb|EDR63708.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
          Length = 402

 Score = 57.0 bits (136), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 48/321 (14%), Positives = 102/321 (31%), Gaps = 46/321 (14%)

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
            +P  FK  + AGR  GK+ L+   ++   +      V  +A +    +  LW ++ + L
Sbjct: 5   QSPHRFKV-VCAGRRWGKSRLSISTIIRAAAKEKKQRVWYVAPTYQ