BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781215|ref|YP_003065628.1| putative phage terminase,
large subunit [Candidatus Liberibacter asiaticus str. psy62]
         (511 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040892|gb|ACT57688.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120680|gb|ADV02503.1| putative phage terminase large subunit [Liberibacter phage SC1]
 gi|317120824|gb|ADV02645.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 511

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI
Sbjct: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM
Sbjct: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP
Sbjct: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511
           PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR
Sbjct: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEYDSR 511


>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496304|gb|ADR52903.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 373/508 (73%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDP+FHE IIARYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPNFHENIIARYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPL+MGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLVMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNVSSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHPEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ +HSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPHHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2]
 gi|317120783|gb|ADV02604.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 516

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 391/507 (77%), Positives = 413/507 (81%), Gaps = 9/507 (1%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
           VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP  
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPQQ 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            I EAL R   PDPYAPLIMGCDIA EG D TVVVLRRG +IE +FDWS   +  TN KI
Sbjct: 301 YIVEALERVAIPDPYAPLIMGCDIAGEGEDKTVVVLRRGNIIERIFDWSGELIEVTNRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           S L+ +Y PDAI+ID N  G     YL  +    V  +LGQ+R+ + E   N R EL+  
Sbjct: 361 SSLINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRSTEPEQYHNLRAELYDL 420

Query: 420 MADWLEFASLINHS--GLIQNLKSLKSFIVPNTGELAIESKRV-K---GAKSTDYSDGLM 473
           M   +     +      LI  LKS+KS      G L IE KR  +   G +S D+ D L 
Sbjct: 421 MRSAITGGLQLPDDCPDLINELKSIKSISDT-LGRLLIEKKRQGRSEFGVRSPDFVDALC 479

Query: 474 YTFAENPPRSD-MDFGRCPSYQYEGVD 499
           YTFA +PPR D   +      +YE +D
Sbjct: 480 YTFAVDPPRKDNPLYQGQDISEYEALD 506


>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495342|gb|ADR51941.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 509

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 376/508 (74%), Positives = 428/508 (84%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+RELPT  E EQ+L +LM+SD+IKLSF+NFVL  FPW E  T L  FS PR WQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD  CL +V+NP+P++FKGA+SAGRGIGKTTLNAW++LWL+STRPG+S++CLANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K+TLWAEVSKWLS+LPNKHWFEMQSLSLHPA WY++ L  + GIDSKHY+  CRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVGHHNTYGMAI NDEASGTPDVIN  ILGF TE NANRFW+MTSNPRRL G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DW+RFQIDTRTVEGIDPSFHEGII+RYGLDSDVTRVEV GQFPQQDI+SFIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
            IEEALNREP  DPYAPLIMGCDIA EGGDNTVVVLRRG  IEH+FDWS   +  ++ KI
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRKI 360

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L+ KY+PDA+++DAN  G +T  YL   GY V+   GQ RA D E  RNRRTELHVKM
Sbjct: 361 EELINKYKPDAVVVDANGIGVQTYYYLADEGYSVHAEKGQNRADDHESYRNRRTELHVKM 420

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           A+WLE AS+ NHSGLIQNLKSL+SFI PNTG+LA+ESKRVKGA STDYSD L YTFA +P
Sbjct: 421 AEWLELASIPNHSGLIQNLKSLESFIEPNTGKLALESKRVKGAVSTDYSDALAYTFAVSP 480

Query: 481 PRSDMDFGRCPSYQYEGVDLLIERRFEY 508
            RSDM+FGRC SYQYE  +LL++RRF Y
Sbjct: 481 ARSDMNFGRCRSYQYEADELLVDRRFSY 508


>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861389|gb|EFL84326.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3]
          Length = 500

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/490 (30%), Positives = 214/490 (43%), Gaps = 28/490 (5%)

Query: 25  KLSFSNFVLHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAIS 83
                 FVL  FPWG  G  L  +   P  WQ E +  +              V + A+S
Sbjct: 26  AADPLGFVLFAFPWG--GGALADYPDGPDVWQREILRGMGEQLSTGA--SAASVIREAVS 81

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           +G G+GK+ L AW++LW MST      +  AN+E QLK   WAE++KW  L    +WF+ 
Sbjct: 82  SGHGVGKSALVAWIILWAMSTFSDTRGVVTANTENQLKGKTWAELAKWHRLCLCGYWFDC 141

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASG 202
            + +L                  K +      +SE   + F G HN    + +I DEAS 
Sbjct: 142 TATALISTQ----------AGHEKTWRVDMVAWSERNTEAFAGLHNKGRRVLLIFDEASA 191

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
            PD I     G LT+ +    W    NP R +G+F E F +    W   ++D+RT    D
Sbjct: 192 IPDAIWEVSEGALTDADTEIIWCCFGNPTRNTGRFRECFGRYAHRWNTRRVDSRTAAMTD 251

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--APLIM 320
            +     +  YG DSD  RV V G+FP+     FI  +I+ EA  R   PD Y  AP I+
Sbjct: 252 KNQLAQWVEDYGEDSDFVRVRVRGEFPRAGDRQFISSDIVHEARGRSLKPDQYSFAPRIL 311

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A  G D +V+  R+G        +   D  T    ++    ++  D I +D    G
Sbjct: 312 GVDVARSGSDQSVITRRQGLACLEQRKFRGLDTVTLAGIVAEECREWGADKIFVDGIGVG 371

Query: 381 ARTCDYLEM---LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL-EFASLINHSGLI 436
           A   D L     LG+ V   +    A+  E   NRR E+   M  WL E  ++ + + L 
Sbjct: 372 AGVVDALRQVYGLGHLVVDAVAGATALQPERFLNRRAEMWTAMRKWLAEGGAVPDDAELA 431

Query: 437 QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
           + L  L+ + V  +G+L +ESK   + +G  S D +D L  TF    P +    G     
Sbjct: 432 EQLCGLE-YAVTVSGKLKLESKDDMKARGLTSPDCADALALTFYAPVPVTL--HGAAQRK 488

Query: 494 QYEGVDLLIE 503
                DL  E
Sbjct: 489 ARTEYDLFGE 498


>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
 gi|212686517|gb|EEB46045.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM
           30120]
          Length = 493

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/495 (29%), Positives = 222/495 (44%), Gaps = 26/495 (5%)

Query: 6   PTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAH 65
             +PE EQ + D+           ++ L+ FPWGE GT LE  S PR WQ E +  +  H
Sbjct: 4   TMSPE-EQLINDIGMFTH---DPLSYALYAFPWGEAGTELENASGPRQWQAEALNEIGEH 59

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
             N      P   + A ++G GIGK+   + ++ W M T     V+  AN+E QL+T  W
Sbjct: 60  LRNPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTW 117

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E++KW  L   K WF     +++                +  +      +SE   + F 
Sbjct: 118 PEIAKWQRLSITKDWFTCTKTAIYSNDPNH----------ANAWRADAVPWSENNTEAFA 167

Query: 186 GHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
           G HN    + ++ DEAS   D++     G LT+ N    WI   NP R +G+F E F K 
Sbjct: 168 GLHNQGKRIILVFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKF 227

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
              WK  QID+RTVEG +    E  I  YG+D D  +V V G FP      FIP  + + 
Sbjct: 228 KHRWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDA 287

Query: 305 ALNREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKIS 361
           A+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  SK  D      +I+
Sbjct: 288 AMKRTVTQAEVSHAPIILGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIA 347

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
              ++Y  DA+ ID    G          G +   V     + D +  +N+R E++  + 
Sbjct: 348 DYEDQYGADAVHID-FGYGTGIQSVGMNWGRNWQLVSFNGASTDPQM-QNKRGEMYNNVK 405

Query: 422 DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            WL+    I+   +  +L S   + V  +G++ +E K   + +  +S +  D L  TFA 
Sbjct: 406 SWLKIGGAIDDQEVADDL-STPEYKVQLSGKILLEKKEDIKKRIGRSPNKGDALALTFAY 464

Query: 479 NPPRSDMDFGRCPSY 493
              + +       S 
Sbjct: 465 PVTKKERHNISTSSQ 479


>gi|227355862|ref|ZP_03840255.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
 gi|227164181|gb|EEI49078.1| phage terminase, large subunit [Proteus mirabilis ATCC 29906]
          Length = 494

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/499 (27%), Positives = 217/499 (43%), Gaps = 25/499 (5%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           MS  L  +PE EQ + D+            +  + FPWGE G  LE ++ PR WQ E + 
Sbjct: 1   MSEALQKSPE-EQLIEDIASFTH---DPLGYAYYAFPWGEAGGELEEYNGPRQWQAEALN 56

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            +  H  N      P +   A ++G GIGK+   + ++ W M T     V+  AN+E QL
Sbjct: 57  EIGEHLRNPKTRHQPLLL--ARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQL 114

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           +T  W E++KW  L    +WF     +++                +  +      +SE  
Sbjct: 115 RTKTWPEIAKWQRLSLTNNWFTCTKTAIYSNDPNH----------ANAWRADAVPWSENN 164

Query: 181 PDTFVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
            + F G HN    + ++ DEAS   D++     G LT+      WI   NP R +G+F E
Sbjct: 165 TEAFAGLHNKGKRIILVFDEASNIADLVWEVAEGALTDEGTEIIWIAFGNPTRNTGRFRE 224

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
            F K    W   QID+RTVEG +    +     YG DSD  +V V G FP      FIP 
Sbjct: 225 CFRKFKHRWNTKQIDSRTVEGSNKEQIKNWEEDYGEDSDFFKVRVRGVFPSASELQFIPT 284

Query: 300 NIIEEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTT 356
            + +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+   K TD    
Sbjct: 285 GLTDEAMKRIVTQAEVAHAPVIIGVDPAYSGIDDAVIYLRQGLFSKCLWTGFKTTDDVVM 344

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             +I+   ++Y+ DA+ ID    G          G     V     + D +   N+R E+
Sbjct: 345 AKRIADFEDQYKADAVHID-FGYGTGIHSIGTSWGRVWRLVKFGGASTDPQM-LNKRGEM 402

Query: 417 HVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLM 473
           +  +  WL+    I+      +L   +  +     ++ +E K   + +  +S    D L 
Sbjct: 403 YNSVKTWLKIGGAIDDQETADDLSCGEYKVRVIDSKIVLEDKTEIKKRLGRSPGKGDALA 462

Query: 474 YTFAENPPRSDMDFGRCPS 492
            TFA    + D ++    S
Sbjct: 463 LTFAYPVTKIDRNYSSPHS 481


>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1]
 gi|166859242|gb|ABY97649.1| putative phage terminase, large subunit [Pseudomonas putida GB-1]
          Length = 499

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 226/499 (45%), Gaps = 29/499 (5%)

Query: 12  EQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVN 71
           EQ+L + + S         +VL+ FPWGE G  L   + PR WQ E +E +         
Sbjct: 11  EQELANDIAS--FSDDPLGYVLYAFPWGEAGGELANKTGPRKWQREVLESIGEQLRAGA- 67

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
               EV + A+++G GIGK+ L +W++ W + T      +  AN+E+QL+T  W EV+KW
Sbjct: 68  KDRGEVIREAVASGHGIGKSALVSWVIKWALDTEVDTRGVVTANTESQLRTKTWPEVAKW 127

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
             L    HWF++   +L       +            +      +S+   + F G HN  
Sbjct: 128 NRLSITAHWFKLTGTALISTDPDHEKN----------WRIDAVPWSDTNTEAFAGLHNEG 177

Query: 192 -GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR 250
             + +I DEAS   D++     G LT+ +    W    NP R SG+F E F K    W+ 
Sbjct: 178 KRILLIFDEASAIADLVWEVAEGALTDADTEIIWAAFGNPTRNSGRFRECFTKFKHRWRH 237

Query: 251 FQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            Q+D+RTV+G + +     IA YG DSD  R+ V G FP+      IP + + EA+ R+ 
Sbjct: 238 RQVDSRTVDGTNKTQIAKWIADYGEDSDFVRIRVRGMFPRASDLQLIPTDWVAEAMRRDG 297

Query: 311 CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW-----SKTDLRTTNNKISGLVE 365
                  L+ G DIA  G DN V+  RRG   + +           +      K+  LV 
Sbjct: 298 VYGLDDALVCGIDIARGGMDNNVIRFRRGMDAKSIKPIKIPGSETRNTTPFIAKVCTLVV 357

Query: 366 KYRPDAIIIDANNTGARTCDYLEML--GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
           ++RPDA+ +D+   G    D L  L  G  +  V    +A D     N RT +  +M + 
Sbjct: 358 EHRPDAVFVDSTGVGGPVADQLRRLLPGVMIIDVNFASQAPDR-HYANMRTYIWWRMREA 416

Query: 424 LEFA-SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
           ++   ++ + + L   L S   +   ++ ++A+E K   + +   S D  D L  TF   
Sbjct: 417 IKLGLAIESDTELETELTS-PEYDHNSSDQIALEKKKDIKKRLGISPDDGDALALTFTMP 475

Query: 480 PPRSDM--DFGRCPSYQYE 496
             ++    + G   S+Q +
Sbjct: 476 VMKAQYQGNGGVNGSHQSD 494


>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291315400|gb|EFE55853.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 493

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/488 (29%), Positives = 223/488 (45%), Gaps = 26/488 (5%)

Query: 6   PTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAH 65
             +PE EQ + D+           ++ L+ FPWGE GT LE  + PR WQ E +  +  H
Sbjct: 4   TMSPE-EQLINDIGMFTH---DPLSYALYAFPWGEAGTELENANGPRQWQAEALNEIGEH 59

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
             N      P   + A ++G GIGK+   + ++ W M T     V+  AN+E QL+T  W
Sbjct: 60  LRNPETRHQP--LQLARASGHGIGKSAFISMIIKWGMDTCEDCKVVVTANTENQLRTKTW 117

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
            E++KW  L   K WF     +++                +  +      +SE   + F 
Sbjct: 118 PEIAKWQRLSITKDWFTYTKTAIYSNDPNH----------ANAWRADAVPWSENNTEAFA 167

Query: 186 GHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
           G HN    + +I DEAS   D++     G LT+ N    WI   NP R +G+F E F K 
Sbjct: 168 GLHNQGKRIILIFDEASNIADLVWEVAEGALTDENTEIIWIAFGNPTRNTGRFRECFRKF 227

Query: 245 LDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
              WK  QID+RTVEG +    E  I  YG+D D  +V V G FP      FIP  + + 
Sbjct: 228 KHRWKTKQIDSRTVEGTNKEQIEKWIQDYGVDDDFVKVRVRGIFPSTSEKQFIPTGLTDA 287

Query: 305 ALNREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKIS 361
           A+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  SK  D      +I+
Sbjct: 288 AMKRTVTQAEVSHAPIIIGVDPAYSGDDDAVIYLRQGLHSKCLWTGSKTIDDVIMAKRIA 347

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
              ++Y  DA+ ID    G          G +   V     + D +  RN+R E++  + 
Sbjct: 348 DFEDQYGADAVHID-FGYGTGIQSVGMNWGRNWQLVQFNGASTDPQM-RNKRGEMYNNVK 405

Query: 422 DWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            WL+    I+   + ++L S   + V  +G++ +ESK   + +  +S    D L  TFA 
Sbjct: 406 SWLKIGGAIDDQEVAEDL-STPEYKVELSGKILLESKDDIKKRIGRSPGKGDALALTFAY 464

Query: 479 NPPRSDMD 486
              + + +
Sbjct: 465 PVTKKERN 472


>gi|309702815|emb|CBJ02146.1| putative terminase, large subunit [Escherichia coli ETEC H10407]
          Length = 493

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 135/504 (26%), Positives = 226/504 (44%), Gaps = 25/504 (4%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 +PE EQ + D+            + L+ FPWGE+GT L   + PR WQ +    
Sbjct: 1   MTAAAMSPE-EQLVEDIAGFTY---DPLGYALYAFPWGEEGTELAHATGPRKWQADAFRE 56

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
           +  H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+
Sbjct: 57  IRDHLQNPATRHQPIML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLR 114

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
           T  W E+ KW +L   K WF   + +++      D          K +      +SE   
Sbjct: 115 TKTWPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNT 164

Query: 182 DTFVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           + F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E 
Sbjct: 165 EAFAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFREC 224

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           F K    WK  QID+RTVEG +    +  +  YG DSD  +V V G FP    + FIP  
Sbjct: 225 FRKYKHRWKCAQIDSRTVEGTNKEQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSG 284

Query: 301 IIEEALNREPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTN 357
           + + A+ R   P    +A +++G D + +G D  V+ LR+G   + L +W + TD     
Sbjct: 285 LTQPAVGRVITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRTTDDVLFA 344

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
             I+   ++Y+ DA+ ID    G       +  G +   ++      D E   N+R E++
Sbjct: 345 KVIADFEDQYQADAVFIDY-GYGTGLKSVGDNWGRNWTLIMFGSGTADPEM-GNKRGEMY 402

Query: 418 VKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
               D L+  + ++   L   L + +  +        ++ K   +    +S + +D  + 
Sbjct: 403 KSARDALKLGAQLDSQELADELSAPEYKVRLKDSRKILQDKDEVKELLGRSPNNADAYVL 462

Query: 475 TFAENPPRSDMDFGRCPSYQYEGV 498
           T+A    +   ++G+  S Q + +
Sbjct: 463 TYAAPVTKKQFNYGQQQSQQGKAL 486


>gi|215487825|ref|YP_002330256.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265897|emb|CAS10306.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 493

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 133/496 (26%), Positives = 223/496 (44%), Gaps = 23/496 (4%)

Query: 10  ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNS 69
             E++L + + S         + L+ FPWGE GT L   + PR WQ +    +  H  N 
Sbjct: 7   SPEEQLVEDIAS--FTYDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNP 64

Query: 70  VNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS 129
                P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ 
Sbjct: 65  ATRHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEII 122

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           KW +L   K WF   + +++      D          K +      +SE   + F G HN
Sbjct: 123 KWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFAGLHN 172

Query: 190 TY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
               + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K    W
Sbjct: 173 ERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRW 232

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K  QID+RTVEG +    +  +  YG DSD  +V V G FP    + FIP  + + A+ R
Sbjct: 233 KCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASENQFIPSGLTQPAVGR 292

Query: 309 EPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVE 365
              P    +A +++G D + +G D  V+ LR+G   + L +W + TD       I+   +
Sbjct: 293 VITPAQVQHAAVVLGVDPSHQGKDPAVIYLRQGLHCKKLGEWQRTTDDVLFAKIIADFED 352

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           +Y+ DA+ ID    G       +  G +   +       D E   N+R E++    D L+
Sbjct: 353 QYQADAVFIDY-GYGTGLKSVGDNWGRNWTLIQFGSGTADPEM-GNKRGEMYKSARDALK 410

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
             + ++   L   L + +  +        ++ K   +    +S + +D  + T+A    +
Sbjct: 411 LGAQLDSQNLADELSAPEYKVRLKDSRKILQDKEEVKELLGRSPNDADAYVLTYAAPVTK 470

Query: 483 SDMDFGRCPSYQYEGV 498
              ++G+  S Q + +
Sbjct: 471 KQFNYGQQQSQQGKAL 486


>gi|323156136|gb|EFZ42295.1| terminase large subunit [Escherichia coli EPECa14]
          Length = 491

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 139/497 (27%), Positives = 222/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A+++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPATRYQPLML--ALASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        YAP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAYAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRLPGQQNQQ 480


>gi|282848875|ref|ZP_06258265.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282581380|gb|EFB86773.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 483

 Score =  366 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 132/472 (27%), Positives = 209/472 (44%), Gaps = 24/472 (5%)

Query: 27  SFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGR 86
               FV   +PWGE GTPLE    P  WQ++ ++ +                + A+++G 
Sbjct: 17  DPLAFVYFAYPWGEPGTPLENMEGPDEWQIQILKDIGEQLKKGK--DLQTAIQEAVASGH 74

Query: 87  GIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
           GIGK+ L +WL+ + +ST      +  AN+E QL+T  W E+SKW ++   K  F   + 
Sbjct: 75  GIGKSALISWLIHFAISTHENTRGVVTANTEGQLRTKTWPELSKWHNMFIAKDLFTYTAT 134

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASGTPD 205
           ++  +               K +      +S+  P++F G HN    + ++ DEAS   D
Sbjct: 135 AIFSSD----------KDYEKTWRIDAIPWSKNSPESFAGLHNQGNRILVLFDEASAIDD 184

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF 265
           VI     G LT+ N    W    NP R SG+F E F K    W  +QID+RTV+  + + 
Sbjct: 185 VIWEVTEGALTDANTEIIWCAFGNPTRNSGRFRECFRKYRKFWNTYQIDSRTVKISNKTK 244

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA--PLIMGCD 323
            E  +  YG DSD  +V V G FP      FI   I ++A  +   P  +   P+I+G D
Sbjct: 245 IEEWLEAYGEDSDFFKVRVRGVFPSASDLQFISTEIADKAQKQVYKPGQFEHLPVIIGVD 304

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRT-TNNKISGLVEKYRPDAIIIDANNTGAR 382
            A  G D+  +V+R+G  ++ L    K D        I+   ++Y+ DA+ ID    G  
Sbjct: 305 PAWTGSDSLEIVMRQGYYMKSLASIPKNDDDWRMAQLIAQFEDEYKADAVFIDM-GYGTG 363

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASL--INHSGLIQNLK 440
                + LG     +    ++ D     N R  +  +M +WL        N   L  ++ 
Sbjct: 364 IYSIGKQLGRKWRLIEFGGKSNDP-VYLNMRAYMWGQMKEWLREGGSIPPNDQALYDDIV 422

Query: 441 SLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
             ++ I+   G + +ESK   + +G  S +  D L  TFA    +      R
Sbjct: 423 GPEA-IIDKNGRIQLESKKDMKDRGLPSPNKGDALALTFAARVVKKSETGNR 473


>gi|218700994|ref|YP_002408623.1| putative phage terminase, large subunit [Escherichia coli IAI39]
 gi|218370980|emb|CAR18807.1| putative phage terminase, large subunit [Escherichia coli IAI39]
          Length = 491

 Score =  366 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 140/502 (27%), Positives = 224/502 (44%), Gaps = 25/502 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L D +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIDDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSYQYEGV 498
           A    +  ++     S Q   +
Sbjct: 464 AFPVSKR-INIPGQQSQQGRAI 484


>gi|332344357|gb|AEE57691.1| terminase, large subunit [Escherichia coli UMNK88]
          Length = 491

 Score =  366 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
                   E++L + + S         + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTAAAMSPEEQLVEDIAS--FTYDPLGYALYAFPWGEEGTELAHATGPRKWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPATRHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRLPGQQNQQ 480


>gi|324008564|gb|EGB77783.1| hypothetical protein HMPREF9532_01752 [Escherichia coli MS 57-2]
          Length = 491

 Score =  365 bits (937), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 139/502 (27%), Positives = 224/502 (44%), Gaps = 25/502 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDLGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSYQYEGV 498
           A    +  ++     S Q   +
Sbjct: 464 AFPVSKR-INIPGQQSQQGRAI 484


>gi|327252187|gb|EGE63859.1| terminase large subunit [Escherichia coli STEC_7v]
          Length = 491

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPATRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|300898423|ref|ZP_07116764.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300357890|gb|EFJ73760.1| conserved hypothetical protein [Escherichia coli MS 198-1]
          Length = 491

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRKWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|294491573|gb|ADE90329.1| putative phage terminase, large subunit [Escherichia coli IHE3034]
          Length = 491

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSTAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|298381721|ref|ZP_06991320.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|301019339|ref|ZP_07183525.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|298279163|gb|EFI20677.1| terminase large subunit protein [Escherichia coli FVEC1302]
 gi|299882256|gb|EFI90467.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|323948690|gb|EGB44595.1| hypothetical protein ERKG_04913 [Escherichia coli H252]
          Length = 491

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|117624715|ref|YP_853628.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
 gi|115513839|gb|ABJ01914.1| putative phage terminase, large subunit [Escherichia coli APEC O1]
          Length = 491

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 137/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        ++P+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHSPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|301046412|ref|ZP_07193572.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300301638|gb|EFJ58023.1| conserved hypothetical protein [Escherichia coli MS 185-1]
          Length = 491

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 138/491 (28%), Positives = 220/491 (44%), Gaps = 24/491 (4%)

Query: 10  ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNS 69
             E++L + + S         + L+ FPWGE GT L   + PR WQ +    +  H  N 
Sbjct: 7   SPEEQLVEDIAS--FTYDPLGYALYAFPWGEDGTELAHATGPRQWQADAFREIRDHLQNP 64

Query: 70  VNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS 129
                P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ 
Sbjct: 65  ETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEII 122

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           KW +L   K WF   + +++      D          K +      +SE   + F G HN
Sbjct: 123 KWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFAGLHN 172

Query: 190 TY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
               + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K    W
Sbjct: 173 ERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRW 232

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + +EA+ R
Sbjct: 233 KTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKR 292

Query: 309 --EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVE 365
                   +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+   +
Sbjct: 293 VVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFED 352

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           +Y+ DA+ ID    G       +  G     V     + D +   N+R E+      WL 
Sbjct: 353 QYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNSCKTWLR 410

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
              +++      +L + + + V   G++ IE K   + +  +S    D L+ TFA    +
Sbjct: 411 LGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPVSK 469

Query: 483 SDMDFGRCPSY 493
                G+    
Sbjct: 470 RLRLPGQQNQQ 480


>gi|89152423|ref|YP_512256.1| putative terminase large subunit [Escherichia phage phiV10]
 gi|74055446|gb|AAZ95895.1| putative terminase large subunit [Escherichia phage phiV10]
          Length = 491

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 137/497 (27%), Positives = 220/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG  SD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEGSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNS 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKTWLRLGGMLDDQETADDLSTAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|331648179|ref|ZP_08349269.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331043039|gb|EGI15179.1| conserved hypothetical protein [Escherichia coli M605]
          Length = 491

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 221/497 (44%), Gaps = 24/497 (4%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
              T    E++L + +           + L+ FPWGE+GT L   + PR WQ +    + 
Sbjct: 1   MTDTALSPEEQLIEDIAG--FTHDPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPETRYQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKDWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  ++ V G FP      FIP  + 
Sbjct: 227 KYKHRWKTAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFNA 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL    +++      +L + + + V   G++ IE K   + +  +S    D L+ TF
Sbjct: 405 CKIWLRLGGMLDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDMDFGRCPSY 493
           A    +     G+    
Sbjct: 464 AFPVSKRLRIPGQQNQQ 480


>gi|330007152|ref|ZP_08305894.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
 gi|328535499|gb|EGF61959.1| hypothetical protein HMPREF9538_03583 [Klebsiella sp. MS 92-3]
          Length = 495

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 139/501 (27%), Positives = 221/501 (44%), Gaps = 27/501 (5%)

Query: 4   ELPTNPETEQKLFDLMWSD--EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                   E++L + +  D          + L+ FPWGE GT L   S PR WQ +    
Sbjct: 1   MTDAALSPEEQLKEQLIDDIASFTHDPLGYALYAFPWGEDGTELAHASGPRQWQADAFRE 60

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
           +  H  N      P +   + ++G GIGK+   + L+ W MST     V+  AN++ QL+
Sbjct: 61  IGEHLQNPATRHQPLM--ISRASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLR 118

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
           T  W E+ KW +L   K WF   + +++      D          K +      +SE   
Sbjct: 119 TKTWPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNT 168

Query: 182 DTFVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           + F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E 
Sbjct: 169 EAFAGLHNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFREC 228

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           F K    WK  QID+RTVEG +    +  +  YG DSD  +V V G FP      FIP  
Sbjct: 229 FRKYKHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTG 288

Query: 301 IIEEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTN 357
           + +EA+ R        +AP I+G D A  G D+ V+ LR+G   + L+  +K TD     
Sbjct: 289 LTDEAMKRVVTAAQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMA 348

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            +I+   ++Y+ DA+ ID    G       +  G     V     + D +   N+R E+ 
Sbjct: 349 KRIADFEDQYQADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASADPQM-LNKRGEMF 406

Query: 418 VKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
                WL+    ++      +L + + + V   G++ +E K   + +  +S    D L+ 
Sbjct: 407 NACKTWLKLGGALDDQETADDLSAAE-YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLL 465

Query: 475 TFAENPPRSD---MDFGRCPS 492
           TFA    +        G+ P+
Sbjct: 466 TFAYPVTKRSDFPAAGGKQPN 486


>gi|304398406|ref|ZP_07380280.1| terminase, large subunit [Pantoea sp. aB]
 gi|304354272|gb|EFM18645.1| terminase, large subunit [Pantoea sp. aB]
          Length = 490

 Score =  363 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 133/494 (26%), Positives = 217/494 (43%), Gaps = 23/494 (4%)

Query: 5   LPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDA 64
           + +  + E +L + +           + L+ FPWGE+GT L     PR WQ +  + + A
Sbjct: 1   MSSAADLEIQLIEDI--GAFTHDPFGYALYAFPWGEEGTDLAYSKGPRQWQEDAFKQIGA 58

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
           H  N      P +     ++G GIGK+   + LV W M T     V+  AN+E QL+T  
Sbjct: 59  HLQNPDTRHQPLM--IGRASGHGIGKSAFISMLVKWGMDTCEDCKVVVTANTENQLRTKT 116

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
           W E++KW  L   + WF   + +++                +K +      +SE   + F
Sbjct: 117 WPEIAKWQRLSITQDWFTCTATAIYSNDPSH----------AKSWRADAIPWSENNTEAF 166

Query: 185 VGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK 243
            G HN    + +I DEAS   D++     G LT+ N    W+   NP R +G+F E F K
Sbjct: 167 AGLHNERKRIILIFDEASNIADLVWEVAEGALTDENTEIIWVAFGNPTRNTGRFRECFRK 226

Query: 244 PLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
               WK  QID+R+VEG +    +  +  YG DSD  +V V G FP      FIP  + +
Sbjct: 227 LRHRWKTAQIDSRSVEGTNKEQIQKWVDDYGEDSDFVKVRVRGLFPSASEAQFIPTGLTD 286

Query: 304 EALNREPCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHL-FDWSKTDLRTTNNKI 360
            A+ R   P    +A  ++G D A +GGD  V+ LR+G   + L      TD       +
Sbjct: 287 AAVGRVITPGQVAHAATVIGVDPAHQGGDPAVIYLRQGLHTKKLGEYQRTTDDVLFAKIV 346

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
           +   ++YR DA+ ID    G       +  G +   +     + D +   N+R E++  +
Sbjct: 347 ASFEDEYRADAVFIDY-GYGTGLKSVGDNWGRNWQLIQFGGGSTDPQM-ANKRGEMYNAV 404

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
             WL+    ++   + + L + +  +      + +E K   + +  KS + +D L  TFA
Sbjct: 405 KTWLKDGGQLDSQQVAEELSAAEYKVRLKDSRIVLEDKTSIKERLGKSPNDADALALTFA 464

Query: 478 ENPPRSDMDFGRCP 491
               +     G   
Sbjct: 465 FPVVKKLHYVGSND 478


>gi|320175050|gb|EFW50163.1| terminase B protein, putative [Shigella dysenteriae CDC 74-1112]
          Length = 480

 Score =  363 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 135/474 (28%), Positives = 215/474 (45%), Gaps = 22/474 (4%)

Query: 27  SFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGR 86
               + L+ FPWGE+GT L   + PR WQ +    +  H  N      P +   A ++G 
Sbjct: 11  DPLGYALYAFPWGEEGTELAHATGPRQWQADAFREIRDHLQNPETRYQPLML--ARASGH 68

Query: 87  GIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
           GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ KW +L   K WF   + 
Sbjct: 69  GIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEIIKWSNLAITKDWFTCTAT 128

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY-GMAIINDEASGTPD 205
           +++      D          K +      +SE   + F G HN    + ++ DEAS   D
Sbjct: 129 AMYSNDPGHD----------KRWRADAIPWSEHNTEAFAGLHNERKRIIVVFDEASNIAD 178

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF 265
           ++     G LT+ +    W+   NP R +G+F E F K    WK  QID+RTVEG +   
Sbjct: 179 LVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRWKCAQIDSRTVEGTNKQQ 238

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR--EPCPDPYAPLIMGCD 323
            +  +  YG DSD  ++ V G FP      FIP  + +EA+ R        +AP+I+G D
Sbjct: 239 LQKWVDDYGEDSDFVKIRVRGIFPDASELQFIPTGLTDEAMKRVVTAAQVAHAPVIIGVD 298

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
            A  G D+ V+ LR+G   + L+  +K TD      +I+   ++Y+ DA+ ID    G  
Sbjct: 299 PAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFEDQYQADAVFID-FGYGTG 357

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSL 442
                +  G     V     + D +   N+R E+ +    WL    +++      +L + 
Sbjct: 358 LKSIGDGWGRTWQLVPFGGASTDPQM-LNKRGEMFISCKTWLRLGGMLDDQETADDLSAA 416

Query: 443 KSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
           + + V   G++ IE K   + +  +S    D L+ TFA    +     G+    
Sbjct: 417 E-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPVSKRLRIPGQQNQQ 469


>gi|30387381|ref|NP_848210.1| terminase large subunit [Enterobacteria phage epsilon15]
 gi|30266036|gb|AAO06065.1| terminase large subunit [Salmonella phage epsilon15]
          Length = 491

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 138/491 (28%), Positives = 221/491 (45%), Gaps = 24/491 (4%)

Query: 10  ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNS 69
            TE++L + + S         + L+ FPWGE GT L   + PR WQ +    +  H  N 
Sbjct: 7   STEEQLVEDIAS--FTYDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIRDHLQNP 64

Query: 70  VNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS 129
                P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T  W E+ 
Sbjct: 65  ATRHQPLML--ARASGHGIGKSAFISMLINWGMSTCEDCKVVVTANTDNQLRTKTWPEII 122

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           KW +L   K WF   + +++      D          K +      +SE   + F G HN
Sbjct: 123 KWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEAFAGLHN 172

Query: 190 TY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
               + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F K    W
Sbjct: 173 ERKRIIVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFRKYKHRW 232

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K  QID+RTVEG +    +  +  YG +SD  +V V G FP      FIP  + +EA+ R
Sbjct: 233 KCAQIDSRTVEGTNKQQLQKWVDDYGEESDFVKVRVRGIFPDASELQFIPTGLTDEAMKR 292

Query: 309 --EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGLVE 365
                   +AP+I+G D A  G D+ V+ LR+G   + L+  +K TD      +I+   +
Sbjct: 293 VVTAAQVAHAPVIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKRIADFED 352

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           +Y+ DA+ ID    G       +  G     +     + D +   N+R E+      WL+
Sbjct: 353 QYQADAVFID-FGYGTGLKSIGDGWGRTWQLIPFGGGSTDPQM-LNKRGEMFNSCKTWLK 410

Query: 426 FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
               ++      +L + + + V   G++ IE K   + +  +S    D L+ TFA    +
Sbjct: 411 LGGALDDQETADDLSAAE-YKVRVDGKIVIEPKEDIKERLGRSPGKGDALLLTFAFPVTK 469

Query: 483 SDMDFGRCPSY 493
                G+    
Sbjct: 470 HLRIPGQESQQ 480


>gi|262043569|ref|ZP_06016682.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039103|gb|EEW40261.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 491

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/499 (28%), Positives = 220/499 (44%), Gaps = 27/499 (5%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
                   E++L D + S         + L+ FPWGE GT L   + PR WQ +    + 
Sbjct: 1   MTDAALSPEEQLIDDIAS--FTHDPLGYALYAFPWGEDGTELAHATGPRKWQADAFREIR 58

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            H  N      P +   A ++G GIGK+   + L+ W MST     V+  AN++ QL+T 
Sbjct: 59  DHLQNPATRHQPLML--ARASGHGIGKSAFISMLINWAMSTCEDCKVVVTANTDNQLRTK 116

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
            W E+ KW +L   K WF   + +++      D          K +      +SE   + 
Sbjct: 117 TWPEIIKWSNLAITKEWFTCTATAMYSNDPGHD----------KRWRADAIPWSEHNTEA 166

Query: 184 FVGHHNTY-GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           F G HN    + ++ DEAS   D++     G LT+ +    W+   NP R +G+F E F 
Sbjct: 167 FAGLHNERKRIVVVFDEASNIADLVWEVAEGALTDEDTEIIWVAFGNPTRNTGRFRECFR 226

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
           K    WK  QID+RTVEG +    +  +  YG DSD  +V V G FP      FIP  + 
Sbjct: 227 KYKHRWKCAQIDSRTVEGTNKQQLQKWVDDYGEDSDFVKVRVRGIFPDASELQFIPTGLT 286

Query: 303 EEALNR--EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNK 359
           +EA+ R        +AP I+G D A  G D+ V+ LR+G   + L+  +K TD      +
Sbjct: 287 DEAMKRVVTAVQVAHAPRIIGVDPAYSGVDDAVIYLRQGLHSKVLWTGNKTTDDLIMAKR 346

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I+   ++Y  DA+ ID    G       +  G     V     + D +   N+R E+   
Sbjct: 347 IADFEDQYLADAVFID-FGYGTGLKSIGDGWGRTWQLVPFGGASADPQM-LNKRGEMFNA 404

Query: 420 MADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
              WL+    ++      +L + + + V   G++ +E K   + +  +S    D L+ TF
Sbjct: 405 CKTWLKLGGALDDQETADDLSAAE-YKVRVDGKIVMEPKEDIKERLGRSPGKGDALLLTF 463

Query: 477 AENPPRSDM---DFGRCPS 492
           A    +        G+ P+
Sbjct: 464 AYPVTKRSEFPAAGGKQPN 482


>gi|228911519|ref|ZP_04075310.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
 gi|228848128|gb|EEM92991.1| hypothetical protein bthur0013_56490 [Bacillus thuringiensis IBL
           200]
          Length = 459

 Score =  349 bits (894), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 129/494 (26%), Positives = 213/494 (43%), Gaps = 75/494 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +   F+  +L F+              P  WQ + +  +           
Sbjct: 2   EIIDVYWDDPVA--FAEDMLGFY--------------PDEWQRKVLMDLA---------- 35

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
             +  K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 36  --QSPKVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++                 + +    RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVYMIG------------SEERWFATARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA-- 371
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 -GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 372 -----IIIDANNTGARTCDYLE------MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                I +D +  G    D L+       L + VY V+   + +D E   N   E    +
Sbjct: 316 LKRVDIKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGAEGWAVV 375

Query: 421 ADWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
            D LE               + N   +I    S + + + + G++A+E K   + +G +S
Sbjct: 376 RDLLEENMKAFIQGEEPTMEIPNDEKMISQFSS-RKYRITSRGKIALERKEEMKKRGLQS 434

Query: 466 TDYSDGLMYTFAEN 479
            D +D ++  F + 
Sbjct: 435 PDRADAIVLAFYKP 448


>gi|228968731|ref|ZP_04129698.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228790961|gb|EEM38595.1| hypothetical protein bthur0004_54930 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 459

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 130/494 (26%), Positives = 214/494 (43%), Gaps = 75/494 (15%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
           ++ D+ W D +   F+  +L F+              P  WQ + +  +           
Sbjct: 2   EIIDVYWDDPVA--FAEDMLGFY--------------PDEWQRKVLMDLA---------- 35

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
             +  K ++ +G+G+GKT L + +V+W +  RP   VIC A ++ QL T LWAE++KWL 
Sbjct: 36  --QSPKVSVRSGQGVGKTGLESVVVIWFLCCRPNPKVICTAPTKEQLFTVLWAEIAKWLE 93

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++                 + +    RT +  +P+   G H  Y M
Sbjct: 94  GSAVKNLLKWTKTRVYMIG------------SEERWFATARTAT--KPENMQGFHEDY-M 138

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
             + DEASG  D I   ILG L+   A     +  NP R SG FY+  N+  D +K  ++
Sbjct: 139 LFVCDEASGIADPIMEAILGTLS--GAENKLFLCGNPTRTSGVFYDSHNRDRDLYKIHKV 196

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
            +           E +  +YG  SDV RV V G+FP+ + D+FIPL I+E+A + +  P 
Sbjct: 197 SSLDSPRTSKDNIEVLKKKYGEGSDVWRVRVLGEFPKAEADAFIPLEIVEQAASCKVEPT 256

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA-- 371
               L +G D+A  G D TV+  R G  +  L +  K D   T   +  L ++Y      
Sbjct: 257 -GETLDLGVDVARFGDDETVIAPRIGNKVFKLLNHYKQDTMETAGHVLKLAKEYMAKYKQ 315

Query: 372 -----IIIDANNTGARTCDYLE------MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                I +D +  G    D L+       L + VY V+   + +D E   N  TE    +
Sbjct: 316 LKRVDIKVDDSGVGGGVTDRLKEVIKSERLPFKVYPVVNNGKPLDDEHYDNAGTEGWAVV 375

Query: 421 ADWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
            D LE               + N   +I    S + + + + G++A+E K   + +G +S
Sbjct: 376 RDLLEENMKAFIQGEEPTMEIPNDEKMISQFSS-RKYRITSRGKIALERKEEMKKRGLQS 434

Query: 466 TDYSDGLMYTFAEN 479
            D +D ++  F + 
Sbjct: 435 PDRADAIVLAFYKP 448


>gi|290968649|ref|ZP_06560187.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781302|gb|EFD93892.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 487

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 136/466 (29%), Positives = 224/466 (48%), Gaps = 31/466 (6%)

Query: 24  IKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAIS 83
           +      FV   F W  +    +    P++WQ++ ++ V                + A +
Sbjct: 15  LASDPVAFVYFAFDWDSEELKGQN---PQTWQIKTLKEVGE------GLSLSTALQHATA 65

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
           +G GIGK+ L AWL+LW +STRP    +  AN+ TQL+T  WAE+SKW  L   K +F +
Sbjct: 66  SGHGIGKSALVAWLILWAISTRPDTRGVVTANTATQLETKTWAELSKWYHLFRGKKFFTL 125

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG-MAIINDEASG 202
            S ++           C      + +      +S +R ++F G HN    + +I DEAS 
Sbjct: 126 TSTAIF----------CRQEGHERTWRIDAIPWSVDRTESFAGLHNQGNRLLLIFDEASA 175

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
             + I     G LT+++    W++  NP R +G+F++ F+K    W   +ID+RTV+  +
Sbjct: 176 IDNKIWEVAEGALTDKDTEILWLVFGNPTRSTGRFFDCFHKYKKSWITQKIDSRTVDISN 235

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP---CPDPYAPLI 319
            +  +  I  YG+DSD  +V V G+FP      FI   I+  A  R P       +AP I
Sbjct: 236 KTQLQKWIQTYGIDSDFVKVRVLGEFPDTSDTQFISTAIVRTAWERRPLRTAEYDFAPCI 295

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD-LRTTNNKISGLVEKYRPDAIIIDANN 378
           +G D A  GGD+TV+ LR+G   E L ++ + D       +++   +KY  DA+ ID   
Sbjct: 296 IGMDPAWTGGDSTVIFLRQGFFSEKLAEYKQNDNDGVMAARLAEFEDKYHADAVFIDK-G 354

Query: 379 TGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH-SGLIQ 437
            G     +   +G     V   +++   +   N+R E+   M +WL+   +I    GLI+
Sbjct: 355 YGTGIYSFGVTMGRQWRLVSFAEKS-GAQAYANKRAEMWGNMKEWLQEGGVIPQVDGLIE 413

Query: 438 NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
            L + ++F +   GE+ +E K   + +G +S + +D L  TFA   
Sbjct: 414 ELTAPQAF-INARGEIQLEKKEDMKKRGIESPNMADALALTFAYPV 458


>gi|289578588|ref|YP_003477215.1| hypothetical protein Thit_1395 [Thermoanaerobacter italicus Ab9]
 gi|289528301|gb|ADD02653.1| conserved hypothetical protein [Thermoanaerobacter italicus Ab9]
          Length = 460

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 128/509 (25%), Positives = 201/509 (39%), Gaps = 71/509 (13%)

Query: 5   LPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDA 64
           +  N    +K+ D   +D +   F   VL   PW +              Q E ++ V  
Sbjct: 1   MKMNKTQAKKVLDRARNDPVF--FVRCVLKGDPWEK--------------QEEILKAVRD 44

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
           H             + A+ A  G+GKT + AW+ LW + T     VI  A +  Q++  L
Sbjct: 45  HK------------RVAVRACHGVGKTKVAAWVALWFLYTHHNSKVITTAPTWHQVENLL 92

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
           W E+    +        ++    +                  + +  +    S ++P+ F
Sbjct: 93  WREIHAAHAASRIPLGGKVLQTQIEL---------------GEQWFALGL--STDKPERF 135

Query: 185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
            G H  + + +I DEASG          GFLT   A    ++  NP +LSG+FY  F  P
Sbjct: 136 QGFHAEH-ILLIVDEASGVEQYTFDAAEGFLTSIGAK--LLLIGNPTQLSGEFYNAFRSP 192

Query: 245 LDDWKRFQIDTRTVEG-----------IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           L  + +  I                  + P + E    ++G DS +    V G+FP+Q  
Sbjct: 193 L--YHKIHISAFDSPNLKAGKIVRPYLVTPEWVEDKRLKWGEDSPLWYSRVLGEFPEQGN 250

Query: 294 DSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL 353
           D+ IPL  IE A  R    +   P+ +G D+A  G D TV++LRRG   E ++     D 
Sbjct: 251 DTLIPLAWIEAAQQRWHMTEAGEPVEIGADVARYGTDTTVIMLRRGDKAEIVYQLRGQDT 310

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                K+    +K   + I ID    GA   D L+  GY V  +   + A D     N+R
Sbjct: 311 MEVTGKVIDAFKKTGANVIKIDVVGIGAGVVDRLKEQGYPVQGLNVGESATDKGRFVNKR 370

Query: 414 TELHVKMADWLEFA--SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDY 468
            E +  + +  +    ++     L   L SLK +   + G + IESK   R +G  S D 
Sbjct: 371 AEWYWALRERFQEGTIAIPPDDELASQLASLK-YKFDSRGRIQIESKEELRRRGLPSPDK 429

Query: 469 SDGLMYTFAE----NPPRSDMDFGRCPSY 493
           +D LM  F+            D  R  S+
Sbjct: 430 ADALMLAFSSTGMKPVDEKIKDIFRRASF 458


>gi|150390341|ref|YP_001320390.1| hypothetical protein Amet_2579 [Alkaliphilus metalliredigens QYMF]
 gi|149950203|gb|ABR48731.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 469

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 130/493 (26%), Positives = 202/493 (40%), Gaps = 74/493 (15%)

Query: 15  LFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPN 74
           L D  W + +   F+  +L F+              P  WQ + +  +  H         
Sbjct: 8   LLDNYWDNPVW--FAEDMLGFY--------------PDPWQAKVLMDLAQH--------- 42

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL 134
               K ++ +G+G+GKT L +  + W + TRP   VI  A +  QL   LWAE+SKWLS 
Sbjct: 43  ---PKVSVRSGQGVGKTGLESIAITWYLCTRPFPKVIATAPTRQQLYDVLWAEISKWLSK 99

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                        ++   +             + +    RT    RP+   G H  Y M 
Sbjct: 100 SKVDKLLRWTKTKIYMNGFE------------ERWWATARTA--VRPENMQGFHEDY-ML 144

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
            + DEASG  D I   ILG LT        ++  NP + SG FY+  N+  D +K  ++ 
Sbjct: 145 FVVDEASGVADPIMEAILGTLTGYENK--LLLCGNPTKTSGTFYDSHNRDRDTYKSHKVS 202

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
           +           E +  +YG DSDV RV V G FP+ + DS I L + E+A         
Sbjct: 203 SMDSPRTSKENIEMLKKKYGADSDVFRVRVLGDFPKGEADSLISLEVTEQAAETVVDISN 262

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII- 373
              L +G DIA  G D T++  R G  +  L  +SK D   T   I   V++ +   +  
Sbjct: 263 AYTLNIGADIARFGDDKTIIAPRIGNRVLDLQQYSKKDTMETAGNILRTVDRLKTQHLQI 322

Query: 374 ------IDANNTGARTCDYLEM------LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
                 ID +  G    D L        LGY +  +    +A D E   N+  E+   + 
Sbjct: 323 NKIVIKIDDDGLGGGVTDRLREINRQQSLGYIIVPIKNGSKADDPEHYYNKAAEMWDNIR 382

Query: 422 DWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
           + L+               L     LI+ L S + + V + G + +ESK   + +  +S 
Sbjct: 383 ELLDENLSKFLQGEPGVIQLPKDDILIKQL-SNRKYKVDSKGRIELESKDEMKRRIGESP 441

Query: 467 DYSDGLMYTFAEN 479
           D +D ++Y+FA +
Sbjct: 442 DRADAVIYSFASD 454


>gi|228950291|ref|ZP_04112468.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228809453|gb|EEM55897.1| hypothetical protein bthur0007_63570 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 495

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 123/517 (23%), Positives = 201/517 (38%), Gaps = 79/517 (15%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           +S ++ T  E  Q +   +    +      FV                  P  WQ E + 
Sbjct: 3   VSNDVTTEEEVLQDIITQLLEIYV-DDPVAFVEDILEVE-----------PDPWQKEVLN 50

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            +  H               ++ +G+G+GKT + +W+ +W +  RP   +IC A ++ QL
Sbjct: 51  DIANHSH------------VSVRSGQGVGKTAMESWICIWFLCCRPYPKIICTAPTKQQL 98

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
              LWAE++KWL+    K   +     ++   +               +    +T +  R
Sbjct: 99  YDVLWAEIAKWLNSSQVKDLLKWTKTKIYMKGFE------------DRWFATAKTAT--R 144

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           P+   G H  Y M  I DEASG  D I   ILG L+   +     M  NP + SG F++ 
Sbjct: 145 PENMQGFHEDY-MLFIADEASGIADDIMEAILGTLS--GSENKLFMCGNPTKTSGVFFDS 201

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
            NK    +K  ++ +           E +  +YG  SDV RV V G+FP+ + D+FI L 
Sbjct: 202 HNKDRALYKSHKVSSADSPRTSKKNIEMLKKKYGEGSDVYRVRVEGEFPRGEADAFISLE 261

Query: 301 IIEEALNRE-----------------PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
             E A  RE                       A + +GCD+A  G D T++  RRG  + 
Sbjct: 262 TAEAARMREVYKVEVIENEEEESTVKEIIPDTAVVEIGCDVARFGSDETIIATRRGWKVL 321

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDA--------IIIDANNTGARTCDYLEM------ 389
            L    + D    +  +    +KY            I ID    G    D L+       
Sbjct: 322 PLQVHHQRDTMYVSGLLVQEAKKYFSWCERTGKRIPIRIDDTGVGGGVTDRLKEVVAEND 381

Query: 390 LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD-WLEFASLINHSGLIQNLKSLKSFIVP 448
               V  +    +           + ++    D  LEF +L +   LI  L S++ + + 
Sbjct: 382 YPIDVIPINFASKG--NAEYACIVSVMYGHFKDNCLEFVALPDDEDLIAQL-SVRKYQIN 438

Query: 449 NTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
           + G + IE K   + +G KS D ++ ++  FA   P+
Sbjct: 439 SDGRIKIEPKKAMKDRGLKSPDRAEAVVMAFAPFYPK 475


>gi|54302246|ref|YP_132239.1| terminase large subunit [Photobacterium profundum SS9]
 gi|46915667|emb|CAG22439.1| hypothetical protein PBPRB0566 [Photobacterium profundum SS9]
          Length = 513

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 124/495 (25%), Positives = 198/495 (40%), Gaps = 34/495 (6%)

Query: 25  KLSFSNFVLHFFPWGEKG------------TPLEGFSAPRSWQLEFMEVVDAHCLNS--V 70
                 FV++ +PW                +  +    P +W  E  + +      +   
Sbjct: 21  YDDPLGFVMYAYPWDTDPDLQIVKLPEPWASKYDSVYGPDAWFCEMCDQLQEVIRKNDFN 80

Query: 71  NNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK 130
                + F  +IS+G GIGK+  ++WL+ ++MSTRP    +  +N+  QL+T  W E+ K
Sbjct: 81  GVDPVDAFLYSISSGHGIGKSCASSWLIHFVMSTRPNSKGVVTSNTSEQLRTKTWGELGK 140

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT 190
           W   L NKHWF   +   +   ++ D         ++ +    +T  EE  ++F G H  
Sbjct: 141 WTKKLINKHWFVYNNGKGNMNFYHKD--------YAETWRVDAQTCREENSESFAGLHCA 192

Query: 191 YGMAII-NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
                   DEAS  PD I     G LT+     FW +  NP R SG+F E + +    W 
Sbjct: 193 SSTPWYLFDEASAVPDKIWEVAEGGLTDG--EPFWFVFGNPTRNSGRFRECWRRFRQRWN 250

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
           R QID+ TV+  +        + YG DSD  RV V G FP    +  I   ++E A++R 
Sbjct: 251 RKQIDSSTVQVTNKKKISEWESDYGEDSDFYRVRVKGVFPSASSNQKISGALLEAAMSRT 310

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPV--IEHLFDWSKT---DLRTTNNKISGLV 364
               P +P +M  D+A  GGDN V   R G    +        +   D          L 
Sbjct: 311 AHVIPGSPRVMSLDVARGGGDNCVFRFRHGLNGGVRKKVTLPGSEYRDSMKLAAMAVQLC 370

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL 424
            +++PDA  ID    G    D +  LG++   +    +A D     N R  ++ +  +WL
Sbjct: 371 SEFKPDAFFIDETGVGGPVGDRIRQLGFNCIGINFASKAPDP-HYANMRAYMYHQWGEWL 429

Query: 425 EFAS-LINHSGLIQNLKSLKSFIVPNTGELAIESK--RVKGAKSTDYSDGLMYTFAENPP 481
           +    L    GL+  + +++        E+ I     +     STD  D      A    
Sbjct: 430 KAGGSLHYDEGLLTEVGAIEYTHDRKDREILIPKDVIKKAIGISTDDGDACALLHAYPVA 489

Query: 482 RSDMDFGRCPSYQYE 496
                +    +   E
Sbjct: 490 PRQQGYNSASNNMCE 504


>gi|209901239|ref|YP_002290878.1| putative terminase B [Clostridium phage phiCD27]
 gi|199612120|gb|ACH91293.1| putative terminase B [Clostridium phage phiCD27]
          Length = 469

 Score =  328 bits (841), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 133/499 (26%), Positives = 211/499 (42%), Gaps = 74/499 (14%)

Query: 9   PETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLN 68
            +    L D  W + +   F+  +L+F                  WQ + +  +      
Sbjct: 2   DKALLTLLDCYWDNPVW--FAEDMLNF--------------KADKWQSDVLMALA----- 40

Query: 69  SVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV 128
                  +  K +I +G+G+GKT L +   +W +STRP   V+  A +  QL   LWAE+
Sbjct: 41  -------QTPKVSIRSGQGVGKTGLESIATVWYLSTRPFPKVVATAPTRQQLYDVLWAEI 93

Query: 129 SKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHH 188
           +KWLS    +   E     ++   +             + +    RT    +P+   G H
Sbjct: 94  AKWLSNSKVEKLLEWTKTKVYMKGFE------------ERWWATARTA--VKPENMQGFH 139

Query: 189 NTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
             Y M  + DEASG  D I   ILG L+   A    ++  NP R SG FY+  N+  D +
Sbjct: 140 EDY-MLFVVDEASGVADPIMEAILGTLS--GAENKLLLCGNPTRTSGTFYDSHNRDRDLY 196

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K F++ +           E +  +Y   SD  RV V G+FP+ + DS I L  +E +  R
Sbjct: 197 KTFKVSSLDSPRTSKDNIEMLKRKYHEGSDPWRVRVLGEFPKGESDSLISLEAVETSTIR 256

Query: 309 EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR 368
           E        L +G DIA  G D T++  R G  +  L  +SK D   T   I   V+K++
Sbjct: 257 EVNISNDYILNIGADIARYGDDETIIAPRIGGKVFDLLTYSKKDTMETVGNILRAVDKFK 316

Query: 369 PDAIII-------DANNTGARTCDYLE------MLGYHVYRVLGQKRAVDLEFCRNRRTE 415
                I       D +  GA   D L+       L Y V  +     A++ +   N+ +E
Sbjct: 317 NMYHQINRVKIKTDDDGLGAGVTDRLKEVIRHERLKYEVIPIQNGSSAIEKDKYYNKASE 376

Query: 416 LHVKMADWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RV 460
           +   M + L+               L N   LI+ L S + + V + G++ IESK   + 
Sbjct: 377 MWDNMREELDANLSSFIQNKEAIIQLPNDDKLIKQL-SNRKYTVDSKGKIQIESKKEMKK 435

Query: 461 KGAKSTDYSDGLMYTFAEN 479
           +  +S D +D ++Y+FAEN
Sbjct: 436 RIGESPDRADAVIYSFAEN 454


>gi|150016512|ref|YP_001308766.1| hypothetical protein Cbei_1636 [Clostridium beijerinckii NCIMB
           8052]
 gi|149902977|gb|ABR33810.1| conserved hypothetical protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 470

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 134/500 (26%), Positives = 211/500 (42%), Gaps = 75/500 (15%)

Query: 9   PETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLN 68
            ++   L D  W + +   F+  +++F                  WQ E +  +      
Sbjct: 2   DKSLITLLDTYWDNPVW--FAEDMMNFHA--------------DKWQSEVLMALA----- 40

Query: 69  SVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEV 128
                  +  K ++ +G+G+GKT L + +V W + TRP   VI  A +  QL   LWAE+
Sbjct: 41  -------QSPKVSVRSGQGVGKTGLESIVVTWYLCTRPFPKVIATAPTRQQLYDVLWAEI 93

Query: 129 SKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHH 188
           SKWL+    ++  E     ++   +            S+ +    +T +  RP+   G H
Sbjct: 94  SKWLASSKIENLLEWTKTKIYMKGY------------SERWWATAKTAT--RPENMQGFH 139

Query: 189 NTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDW 248
             Y M  + DEASG  D I   ILG LT        +M  NP R SG FY+  N+  D +
Sbjct: 140 EDY-MLFVVDEASGVADPIMEAILGTLTGYENK--LLMCGNPTRTSGTFYDSHNRDRDLY 196

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           K F++ +           E +  +Y   SDV RV V G+FP+ + DS I L   E A   
Sbjct: 197 KTFKVSSLESPRTSKDNIEMLKRKYHEGSDVWRVRVEGEFPKGESDSLISLEYAETATIT 256

Query: 309 EP-CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY 367
           +         L +G DIA  G D +V+  R G  +  L  ++K D   T   I    +K+
Sbjct: 257 KINNIHNNFTLHIGADIARFGNDESVIAPRIGNKVFDLLTYTKKDTMETTGNILRATDKF 316

Query: 368 RPDA-------IIIDANNTGARTCDYLEM------LGYHVYRVLGQKRAVDLEFCRNRRT 414
           + +        I +D +  G    D L        LGY V  +    +A D E   ++  
Sbjct: 317 KNEYKHINKVKIRVDDDGLGGGVTDRLREVIRQEGLGYEVMPIKNGSKANDEEHYSDKSA 376

Query: 415 ELHVKMADWLEF------------ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---R 459
           E+   M D LE               L N+  LI+ L S + F + + G + +E K   +
Sbjct: 377 EMWGNMRDILEENFTNFVQGKEPTIELPNNDKLIKQL-SNRKFRIDSKGRIDLEKKEEMK 435

Query: 460 VKGAKSTDYSDGLMYTFAEN 479
            +  +S D +D ++Y+FAEN
Sbjct: 436 KRIGESPDLADAVIYSFAEN 455


>gi|282598712|ref|YP_003358792.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300860603|ref|ZP_07106690.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307292389|ref|ZP_07572245.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|258598082|gb|ACV83339.1| putative phage terminase B protein [Enterococcus phage phiEf11]
 gi|300849642|gb|EFK77392.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306496518|gb|EFM66079.1| hypothetical protein HMPREF9509_02682 [Enterococcus faecalis
           TX0411]
 gi|315146097|gb|EFT90113.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
          Length = 484

 Score =  326 bits (835), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 122/479 (25%), Positives = 212/479 (44%), Gaps = 51/479 (10%)

Query: 33  LHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
             F P+ + G  ++ +   P ++  + + +      + V +   +  K ++ +G+G+GKT
Sbjct: 3   KEFIPFADIGAAIDYYYDKPVAFCQDILHLDPDEWQDKVLDDLAKFPKVSVRSGQGVGKT 62

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            L A  +LW ++ RP   VI  A +  QL   LWAEV+KWL+    K   +     ++  
Sbjct: 63  ALEAGAILWFLTCRPYAKVIATAPTMKQLYDVLWAEVAKWLNNSLIKDLLKWTKTKIYMV 122

Query: 152 PWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI 211
                        DS+ +    RT +  +P+   G H  + M I+ DEASG  D I   I
Sbjct: 123 G------------DSERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVADPIMEAI 167

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA 271
           LG L+  +     +M  NP  + G FY+  N   D ++  ++ +   +  +    + +I 
Sbjct: 168 LGTLSGFDNK--LLMCGNPNNIEGVFYDSHNTDRDKYRTHKVSSYDSKRTNKENIQMLID 225

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN---REPCPDPYAPLIMGCDIAEEG 328
           +YG +SDV RV + G+FP+  +DSFI L I+E A +    +          +G D+A  G
Sbjct: 226 KYGENSDVARVRIYGEFPKGALDSFISLEIVEFAKDINISDSELKHVREGHIGVDVARFG 285

Query: 329 GDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGA 381
            D+T+V  R G        +SK D   T  ++    ++   D        I +D    G 
Sbjct: 286 DDSTIVFPRIGAKALPFEKYSKQDTMQTTGRVLKAAKRMMDDYPTIKKVFIKVDDTGVGG 345

Query: 382 RTCDYLEM------LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF--------- 426
              D L+       L Y V  V   + + D ++  N+ T++   + + LE          
Sbjct: 346 GVTDRLKEVISDEKLPYEVIPVNNGESSTD-DYYANKGTQIWGDVKELLEQNISNSINGQ 404

Query: 427 ---ASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                L +++ LI+ L S + F + + G++ +ESK   + +   S D +D L   F E 
Sbjct: 405 GPTIELPDNANLIKEL-STRKFKMTSNGKIRLESKEDMKKRNVGSPDIADALTLAFYEP 462


>gi|332981151|ref|YP_004462592.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
 gi|332698829|gb|AEE95770.1| hypothetical protein Mahau_0567 [Mahella australiensis 50-1 BON]
          Length = 461

 Score =  324 bits (831), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 130/445 (29%), Positives = 197/445 (44%), Gaps = 50/445 (11%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ E ++ +  +             + A+ +G G+GKT L AW +LW + TRP   +
Sbjct: 27  PDDWQAETLQALADN------------PRVAVRSGHGVGKTALEAWALLWFLFTRPYPKI 74

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
            C A +  QL   LWAE SKWL   P  K +FE Q   +    +               +
Sbjct: 75  PCTAPTREQLHDILWAEASKWLERAPALKPYFEWQKTRIVQKQY------------PGRW 122

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
               RT +  +P+   G H  + +  I DEASG  D I   I G LT  +A    +M  N
Sbjct: 123 FATARTSN--KPENMAGFHEEH-LLFIIDEASGIADNIFETIEGALTTSDAK--LLMCGN 177

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P + SG F++ F K    +   ++     + +   + E +  +Y  DSDV RV V G+FP
Sbjct: 178 PTKNSGVFHDAFFKDRSLYWTRKVSCLDSQRVTLEYAERLKRKYHEDSDVYRVRVLGEFP 237

Query: 290 QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS 349
           + + D+FI L+I+E A  R+  PD    L +G D+A  G D TV+  R G  + +L  ++
Sbjct: 238 KAEPDTFISLDIVEAATMRDVEPD--GVLEIGVDVARFGDDETVLAARAGLKLVYLKAYT 295

Query: 350 KTDLRTTNNKISGLVEKYRPDA------IIIDANNTGARTCDYLEM------LGYHVYRV 397
           K D  TT      L +    +       I ID +  G    D          L   V   
Sbjct: 296 KQDTMTTAGYAIALAKDLMKECGKPKCTIKIDDDGVGGGVTDRCREVVREEKLYIDVIDC 355

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEF--ASLINHSGLIQNLKSLKSFIVPNTGELAI 455
                  D E   N  TE    + D L+   A LIN   LI  L + + + + + G++A+
Sbjct: 356 HNGGAPEDKEHYENWGTEAWAYLRDLLQDEQAELINDEDLIGQLTT-RKYRITSKGKIAL 414

Query: 456 ESK---RVKGAKSTDYSDGLMYTFA 477
           ESK   + +G  S D +D ++  +A
Sbjct: 415 ESKDEMKRRGLMSPDRADAVVLAYA 439


>gi|257883493|ref|ZP_05663146.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294614775|ref|ZP_06694675.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|294622490|ref|ZP_06701512.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|257819151|gb|EEV46479.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291592387|gb|EFF23996.1| hypothetical protein EfmE1636_0865 [Enterococcus faecium E1636]
 gi|291598037|gb|EFF29147.1| conserved hypothetical protein [Enterococcus faecium U0317]
          Length = 471

 Score =  321 bits (823), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 119/470 (25%), Positives = 198/470 (42%), Gaps = 50/470 (10%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
            +  P ++  + + +       +V N   E  K ++ +G+G+GKT L A  +LW ++ RP
Sbjct: 18  YYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTALEAGAILWFLTCRP 77

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              VI  A +  QL   LWAEV+KWL+    K+  +     ++               DS
Sbjct: 78  YAKVIATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG------------DS 125

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           + +    RT +  +P+   G H  + M I+ DEASG  D I   ILG L+  +     +M
Sbjct: 126 ERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAILGTLSGFDNK--LLM 180

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP  + G FY+  N   D ++  ++ +   +  +    E I+ +YG +SDV RV + G
Sbjct: 181 CGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKKYGKESDVARVRIFG 240

Query: 287 QFPQQDIDSFIPLNIIEEALNR---EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           +FP+  +DSFI L  +E A  +   +   +      +G D+A  G D+T++  R      
Sbjct: 241 EFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGDDSTILFPRIATRAL 300

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGARTCDYLEM------L 390
               +SK     T   +  + +             I +D    G    D LE        
Sbjct: 301 EYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGGVTDRLEELIEDKHY 360

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF------------ASLINHSGLIQN 438
            + V+ V     + D +F  N  T+L   + + LE               L + S LI+ 
Sbjct: 361 PFEVFGVNNGSTSED-DFYDNLGTQLWGNIKEMLEENMTANLNGEQPVIELPSDSSLIKE 419

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDM 485
           L S + F + +   + +ESK   + +   S D +D L   F E P     
Sbjct: 420 L-STRKFKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPPSHYQF 468


>gi|261208032|ref|ZP_05922709.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289567088|ref|ZP_06447483.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260077749|gb|EEW65463.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161103|gb|EFD09008.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 471

 Score =  321 bits (822), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 119/470 (25%), Positives = 198/470 (42%), Gaps = 50/470 (10%)

Query: 47  GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
            +  P ++  + + +       +V N   E  K ++ +G+G+GKT L A  +LW ++ RP
Sbjct: 18  YYDKPVAFCQDILHLNPDEWQENVLNDLAEFSKVSVRSGQGVGKTALEAGAILWFLTCRP 77

Query: 107 GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS 166
              VI  A +  QL   LWAEV+KWL+    K+  +     ++               DS
Sbjct: 78  YAKVIATAPTMKQLYDVLWAEVAKWLNDSLIKNLLKWTKTKIYMVG------------DS 125

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
           + +    RT +  +P+   G H  + M I+ DEASG  D I   ILG L+  +     +M
Sbjct: 126 ERWFATARTAT--KPENMQGFHEDH-MLIVVDEASGVSDPIMEAILGTLSGFDNK--LLM 180

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
             NP  + G FY+  N   D ++  ++ +   +  +    E I+ +YG +SDV RV + G
Sbjct: 181 CGNPNNIEGVFYDSHNSDRDKYRVHKVSSYDSKRTNKDNIEMILKKYGKESDVARVRIFG 240

Query: 287 QFPQQDIDSFIPLNIIEEALNR---EPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           +FP+  +DSFI L  +E A  +   +   +      +G D+A  G D+T++  R      
Sbjct: 241 EFPKGALDSFISLETVELATEKQISDSLVNKTTVAHIGVDVARYGDDSTILFPRIATRAL 300

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGARTCDYLEM------L 390
               +SK     T   +  + +             I +D    G    D LE        
Sbjct: 301 EYEKYSKRSTMETTGYVINMAKNLMSQYPSIDKVMIKVDDTGVGGGVTDRLEELIEDKHY 360

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF------------ASLINHSGLIQN 438
            + V+ V     + D +F  N  T+L   + + LE               L + S LI+ 
Sbjct: 361 PFEVFGVNNGSTSED-DFYDNLGTQLWGNIKEMLEENMTANLNGEQPVIELPSDSSLIKE 419

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDM 485
           L S + F + +   + +ESK   + +   S D +D L   F E P     
Sbjct: 420 L-STRKFKMTSRSRIRLESKDDMKKRNIGSPDIADALALAFYEPPSHYQF 468


>gi|308069786|ref|YP_003871391.1| hypothetical protein PPE_03030 [Paenibacillus polymyxa E681]
 gi|305859065|gb|ADM70853.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 452

 Score =  318 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 120/467 (25%), Positives = 184/467 (39%), Gaps = 60/467 (12%)

Query: 50  APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
            P  WQ   +  +  +             + ++ +G+G+GKT L A   LW +S  P   
Sbjct: 5   YPDDWQASTLMDLANN------------PRVSVRSGQGVGKTGLEAATALWFLSCFPYPK 52

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
           VIC A +  QL   LWAE++KW S  P  K   +     ++   +             + 
Sbjct: 53  VICTAPTRQQLHDVLWAEINKWQSKSPVLKRILKWTKTKIYMKNYE------------ER 100

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
           +    RT +  +P+   G H  Y M  I DEASG  D I   ILG L+        +M  
Sbjct: 101 WFATARTAT--KPENMQGLHEDY-MLFIVDEASGVADPIMEAILGTLSGEFNK--ILMCG 155

Query: 229 NPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQF 288
           NP + SG FY+  NK   D+K  ++               +  +YG  SDV RV V G+F
Sbjct: 156 NPTKTSGVFYDSHNKDRADYKTRKVSCLDSPRTSKDNIAMLKRKYGEGSDVWRVRVEGEF 215

Query: 289 PQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW 348
           P+   D+FI L + E A            L +G D+A  G D T +    GP I      
Sbjct: 216 PRGGSDTFISLEVAEFAAKEVKLEPTGDMLTIGVDVARFGDDETSMFAGIGPRIVGEHHH 275

Query: 349 SKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGARTCDYLEM------LGYHVY 395
            K     T   +  L ++ +          I +D +  G    D L        L Y + 
Sbjct: 276 FKKGTMVTAGWVINLAKELQVAHPYLNRIRIRVDDSGVGGGVTDRLSEIVAEEGLPYEII 335

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFA------------SLINHSGLIQNLKSLK 443
            +     ++D E   N  TE+   + + LE               L +   LI  L + +
Sbjct: 336 PINNGSSSLD-EHYGNLVTEMWASIKEQLEQNMSNFMNGDSSILQLPDDDVLITQLTA-R 393

Query: 444 SFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            + + + G++ +ESK   + +G KS D +D  + TF E     D   
Sbjct: 394 KWNMTSKGKMLLESKKDMKKRGLKSPDRADAFVLTFGEYLIEPDTHI 440


>gi|332980681|ref|YP_004462122.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
 gi|332698359|gb|AEE95300.1| hypothetical protein Mahau_0077 [Mahella australiensis 50-1 BON]
          Length = 486

 Score =  313 bits (801), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 115/510 (22%), Positives = 191/510 (37%), Gaps = 88/510 (17%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCL 67
           +    ++L   M +D +   F   +L   PW +              Q++ +  V  +  
Sbjct: 3   DKVQVRQLAQKMQNDPVW--FVIEILGTRPWKK--------------QIDIISAVRDN-- 44

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
                      + A+ +  G GK+ +   ++LW + +     V+  A +  Q++  +W E
Sbjct: 45  ----------PRTAVRSCHGAGKSFIAGQVILWFLYSFYPSIVLSTAPTWRQVEKLIWKE 94

Query: 128 VSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           V                     P           + I    +  +    S   PD F G 
Sbjct: 95  VRASYRRSKV------------PLGGNLLPKRPEIQIIQDEWYAVGL--STNEPDRFQGF 140

Query: 188 HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD 247
           H    + ++ DEA+G P+ I   I G LT  +A    ++  NP  + G FY  F  P   
Sbjct: 141 H-EENILVVVDEAAGVPEEIFEAIEGVLTSEHAR--LLLLGNPTSVGGTFYNAFRTP--G 195

Query: 248 WKRFQIDTRTVEG-----------------------------IDPSFHEGIIARYGLDSD 278
           W+   I   T                                I P++      R+G +S 
Sbjct: 196 WENISISAFTTPNFTAFGITEDDIINKTWESKITNSLPNPKLITPAWVADKYRRWGPNSP 255

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRR 338
             +  V GQFP +  D+ IPL  IE A+ R        P+ +G D+A  G D TV+  RR
Sbjct: 256 AYQARVLGQFPSEGEDTLIPLAWIEAAMARWEDTPEGEPIEIGVDVARFGSDKTVIAARR 315

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
           G  +  L  ++K D   T   I  +  K       +D    GA   D L+  G+ V  + 
Sbjct: 316 GQKVLPLNVYAKQDTMETVGCIIMVHRKIGASKTKVDVIGVGAGVVDRLKEQGHPVIGIN 375

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWL--------EFASLINHSGLIQNLKSLKSFIVPNT 450
             + A D E   N R+EL   M + L        E  +L     L+ +L  +K + + + 
Sbjct: 376 VAEAATDTEKFANLRSELWWNMRELLDPNQRLNPEPIALPPDDELLADLSGVK-YKIDSR 434

Query: 451 GELAIESK---RVKGAKSTDYSDGLMYTFA 477
           G + +ESK   + +  +S D +D ++  FA
Sbjct: 435 GRIQVESKEDMKKRLGRSPDRADAVVLAFA 464


>gi|332976102|gb|EGK12970.1| hypothetical protein HMPREF9374_1123 [Desmospora sp. 8437]
          Length = 462

 Score =  312 bits (800), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 124/449 (27%), Positives = 198/449 (44%), Gaps = 51/449 (11%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ   ++ +  +             + A+ AG G+GKT   AW VLW + TRP   +
Sbjct: 33  PDEWQDIALQALADNQ------------RVAVRAGHGVGKTATEAWAVLWFLLTRPFPKI 80

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
            C A ++ QL   LW E++KWL   P    + E Q   +    +             + +
Sbjct: 81  PCTAPTKPQLMDVLWPEIAKWLMNAPELAPYVEWQKTRVVMKQYE------------ERW 128

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
               RT +  +P+   G H  + + +I DEASG  + I   I G LT   +    +M  N
Sbjct: 129 FATARTSN--KPENMAGFHEEHLLFVI-DEASGVDNAIFETIDGALTTAGSK--LVMFGN 183

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P R +G FY+ F++  D +  ++I     +     +   +  +YG DSD+ RV V G+FP
Sbjct: 184 PTRTNGVFYDAFHQDRDLYWTYKISCLDSKMASKDYARNMARKYGEDSDIYRVRVQGEFP 243

Query: 290 QQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS 349
           Q D DSFIPL ++E+A  R+        L +G D+A  G D TV+  R GPV   L  + 
Sbjct: 244 QGDPDSFIPLELVEDARVRDLEWIDEDELHIGVDVARFGSDETVLAARIGPVAFRLDRYG 303

Query: 350 K-TDLRTTNNKI----SGLVEKYRPDAII--IDANNTGARTCDYLEM------LGYHVYR 396
             T    T  ++      L+E++R D  +  +D    G    D L+       L   V  
Sbjct: 304 GRTPTTETVGRVLALARELMEEHRRDYAVVKVDDTGVGGGVTDQLQEIVAEEGLNIDVIP 363

Query: 397 VLGQKRAV-DLEFCRNRRTELHVKMADWLEFASL---INHSGLIQNLKSLKSFIVPNTGE 452
                    D +   +  TE    + D  +   +   I+   LI  L + +   + + G+
Sbjct: 364 CNNGATPEHDPDHYHDWGTESWGTLLDRFKAGEIALKIDDEDLIGQLTT-RKKEMTSKGK 422

Query: 453 LAIESK---RVKGAKSTDYSDGLMYTFAE 478
           + +ESK   + +G +S D +D L+  FAE
Sbjct: 423 IKLESKEKMKKRGQRSPDRADALVLAFAE 451


>gi|254781187|ref|YP_003065600.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040864|gb|ACT57660.1| putative phage terminase, large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 367

 Score =  303 bits (776), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 251/356 (70%), Positives = 297/356 (83%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300

Query: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTT 356
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ T
Sbjct: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQET 356


>gi|323486060|ref|ZP_08091391.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
 gi|323400627|gb|EGA92994.1| hypothetical protein HMPREF9474_03142 [Clostridium symbiosum
           WAL-14163]
          Length = 476

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 119/457 (26%), Positives = 185/457 (40%), Gaps = 62/457 (13%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ + +  +                K AI +G+G+GKT + A  +LW +   P   +
Sbjct: 36  PDDWQKQALMDLAE------------SPKVAIKSGQGVGKTGMEAVALLWFLCCYPYPRI 83

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLP-NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           +  A ++ QL   LW+EVSKW+S  P      +     ++                 K +
Sbjct: 84  VATAPTKQQLHDVLWSEVSKWMSKSPLLSDILKWTKTYIYMVGNE------------KRW 131

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + RT +  +P+   G H    M  I DEASG  D I   ILG L+  N     +M  N
Sbjct: 132 FAVARTAT--KPENMQGFHEDN-MLFIVDEASGVADPIMEAILGTLSGANNK--LLMCGN 186

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P R SG FY+ FN     ++   + +   +  +    E +I +YG DS+V  V V G+FP
Sbjct: 187 PTRTSGTFYDAFNVDRSIYRCHTVSSADSKRTNKQNIESLIRKYGKDSNVVLVRVFGEFP 246

Query: 290 QQDIDSFIPLNIIEEALNREPCPD-PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW 348
           +Q+ D FI L+I+E     +   D P   +  G D+A  G D TV+    G  I     +
Sbjct: 247 KQEDDVFIALSIVEHCCMLDLPDDVPIKRISFGVDVARYGSDETVIAKNVGGRITLPVSF 306

Query: 349 SKTDLRTTNNKISGLVEK--------YRPDAIIIDANNTGARTCDYLEMLGYH------- 393
               L TT  KI  L  +             I ID    G    D LE +          
Sbjct: 307 RGQSLMTTVGKIVQLYRQAITEFPRYRGKIYINIDDCGLGGGVTDRLEEVKQEEKLTRMV 366

Query: 394 VYRVLGQKRAVDL----------EFCRNRRTELHVKMADWL--EFASLINHSGLIQNLKS 441
           +  V    +  +           +   N  T L   + D L  E  SL N + L+     
Sbjct: 367 IVPVNAAGKVPEETLGDGKQKACDIYDNMTTYLWGTVKDALMMEEVSLENDNELVAQFTC 426

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYT 475
            + + + + G++ +ESK   + +G  S D +D +  +
Sbjct: 427 -RKYRLTSRGKMLLESKEEMKKRGIDSPDRADAVALS 462


>gi|255282256|ref|ZP_05346811.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255267204|gb|EET60409.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 506

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 110/477 (23%), Positives = 187/477 (39%), Gaps = 52/477 (10%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  +  E ++               E  + A+ +G+G+GKT + A  VLW +S      V
Sbjct: 38  PVLYAREVLQFEPDEWQRDALMDLAEESRVAVKSGQGVGKTGIEAVAVLWFLSCFRYARV 97

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLP-NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           +  A +  QL   LW+E++KW    P  K         ++   +             K +
Sbjct: 98  VATAPTRQQLHDVLWSEIAKWQERSPLLKAILRWTKTYVYVKGYE------------KRW 145

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + RT +  +P+   G H    M  I DEASG  D I   +LG L+  N     +M  N
Sbjct: 146 FAVARTAT--KPENMQGFHEDN-MLFIVDEASGVADPIMEAVLGTLSGGNNK--LLMCGN 200

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P R +G FY+ F K    +    + +      D +  + +I +YG DS++ RV V G FP
Sbjct: 201 PTRTTGTFYDAFTKDRSIFACHTVSSLDSSRTDKNNIDALIRKYGEDSNLVRVRVKGLFP 260

Query: 290 QQDIDSFIPLNIIEEALNREPCPDPYAPL---IMGCDIAEEGGDNTVVVLRRGPVIEHLF 346
           +QD D FI   +I++  +R+        +   I+G D+A  G D TV+       I+ + 
Sbjct: 261 KQDDDVFISQELIDQCTSRQYELPESRGMAQVILGVDVARYGNDETVIYRNFKGRIKMVR 320

Query: 347 DWSKTDLRTTNNKISGLVEK--------YRPDAIIIDANNTGARTCDYLEMLGYH----- 393
           +    +L  T   I                   I ID    G    D L  +        
Sbjct: 321 NRRGQNLMATAGDIVREYRHIVDGYPGFDGKIYINIDDTGLGGGVTDRLREVKKEQKLTR 380

Query: 394 --VYRVLGQKRAVD--------LEFCRNRRTELHVKMADWLEFAS--LINHSGLIQNLKS 441
             +  +   ++            E+  N  T +   + + LE     + + +  +  L S
Sbjct: 381 MVIIPINAAEKIETDTKAGKEAAEYYNNLTTHMWAAVRELLEKREIVIEDDAETVAQL-S 439

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           ++ + V + G++ IE K   + +G  S D +D L  T +    +     G  P+ + 
Sbjct: 440 MRKYTVASNGKIEIEPKKEMKKRGLDSPDRADAL--TLSCYLGKIKKHTGAAPNEKA 494


>gi|319956916|ref|YP_004168179.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
 gi|319419320|gb|ADV46430.1| hypothetical protein Nitsa_1177 [Nitratifractor salsuginis DSM
           16511]
          Length = 462

 Score =  292 bits (747), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 111/403 (27%), Positives = 173/403 (42%), Gaps = 24/403 (5%)

Query: 79  KGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNK 138
           K +I +G G GKTTL AW+VLW    R    +   A +  QL   L  E+ KW   +P +
Sbjct: 45  KISIRSGHGTGKTTLLAWIVLWWGLGREDAKIPMTAPTGHQLYDLLMPEIRKWREKMPVQ 104

Query: 139 HWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
                     +                +     + RT  +++P+   G H T    II D
Sbjct: 105 ----------YQNEVEVKTEKIDFANGN---FAVPRTARKDQPEALQGFHATNLAFII-D 150

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           EASG P VI     G +T  +     IM +NP R  G FY+  +K    W+ FQ +    
Sbjct: 151 EASGIPQVIFEVAEGAMTGEST--LVIMAANPTRTEGYFYDSHHKNRWQWECFQFNAEES 208

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
           E +   + E    +YG DSDV RV + G+FP+Q  ++   L  +++A  RE   D     
Sbjct: 209 ENVSKEWIEEKKRQYGEDSDVYRVRIKGEFPRQSSNAVFSLQEVDDATTRE-IVDDSGAE 267

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV--EKYRPDAIIIDA 376
           + G D+A+ G D +V+  R+G     +   S   L      +       K +P  I +DA
Sbjct: 268 VWGLDVADFGDDKSVLAKRKGKHFHEITARSGLTLPDLAGWLIYEYNQAKRKPAVIFVDA 327

Query: 377 NNTGARTCDYLEMLGYH-VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGL 435
              G+         G   V  V G   A + E   N+R E +  + D LE   + +   L
Sbjct: 328 IGIGSSLPAVCFEKGLDIVIGVKGSNSASNSEKYHNKRAEWYYNLKDLLEDGKIPDDDEL 387

Query: 436 IQNLKSLKSFIVPNTGELA-IESK--RVKGAKSTDYSDGLMYT 475
           +  L + K + + +TG++  +E K  + +  +S D +D    T
Sbjct: 388 VGELMAQK-YQISSTGKIQLVEKKEIKKELGRSPDKADACALT 429


>gi|167767949|ref|ZP_02440002.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|167710278|gb|EDS20857.1| hypothetical protein CLOSS21_02492 [Clostridium sp. SS2/1]
 gi|291560988|emb|CBL39788.1| hypothetical protein CL2_30180 [butyrate-producing bacterium SSC/2]
          Length = 473

 Score =  289 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 117/482 (24%), Positives = 183/482 (37%), Gaps = 59/482 (12%)

Query: 20  WSDEIKLSFSNFVLHFFPWGEKGTPLEG---FSAPRSWQLEFMEVVDAHCLNSVNNPNPE 76
             D +   F   V     W +          F  P  WQ E    +  +           
Sbjct: 1   MDDRVLHDFL--VESIPLWQQNPVQFFEEVLFFYPDEWQKEAAFALRDN----------- 47

Query: 77  VFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLP 136
             K  I +G+G+GKT   A  +LW +S      V+  A +  QL   LWAEVSKW S  P
Sbjct: 48  -SKVTIKSGQGVGKTGFEAATLLWFLSCFENARVVATAPTLHQLNDVLWAEVSKWQSKSP 106

Query: 137 -NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
             K   +     +                  + +  + RT +   P+   G H    M  
Sbjct: 107 LLKEILQWTKTKISMIG------------SKERWYAVARTAT--TPENMQGFHEDN-MLF 151

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
           I DEASG  D I   ILG LT  N     ++  NP + SG FY+        +    +++
Sbjct: 152 IVDEASGVADPIMEAILGTLTGSNNK--LLLCGNPTKASGTFYDSHTSDRKLYYCITVNS 209

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY 315
              +  +    + +I +YG +S+V RV V G FP+QD D ++PL ++E A        P 
Sbjct: 210 AESKRTNKDNIDSLIRKYGEESNVVRVRVKGLFPKQDDDVYMPLEMLE-ASIILEEIPPA 268

Query: 316 APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEK-------YR 368
               +G D+A  G D+TV+       I         DL  T   +              +
Sbjct: 269 DICTLGVDVARFGDDDTVIARNMNNKITLEKIRHGQDLMKTVGDVVVECRNIKEKFKYKK 328

Query: 369 PDAIIIDANNTGARTCDYLEML-------GYHVYRVLGQKRAVDL---EFCRNRRTELHV 418
              +IID    G    D L  L       G  +  V       D    E   +  +    
Sbjct: 329 TIYVIIDDTGLGGGVTDRLNELKSEGKLSGVVIVPVNFSAAVPDKKAAEKYHDITSYAWS 388

Query: 419 KMADWLEFAS--LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLM 473
            + D LE     L N + LI  L + + + + ++G++ +ESK   + +  +S D +D ++
Sbjct: 389 ILRDMLEEKEAVLPNDTELIAQLSA-RKYDLSSSGKIRLESKKAMKERIGESPDRADAVV 447

Query: 474 YT 475
            +
Sbjct: 448 LS 449


>gi|160940775|ref|ZP_02088117.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436295|gb|EDP14062.1| hypothetical protein CLOBOL_05669 [Clostridium bolteae ATCC
           BAA-613]
          Length = 484

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 110/492 (22%), Positives = 179/492 (36%), Gaps = 72/492 (14%)

Query: 41  KGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLW 100
               L     P  +  + +          +     +    ++ +G GIGK+ + AW V+W
Sbjct: 4   SDAVLFYADNPIYFVEDVIRAKPDEKQRDILRSLRDYPMTSVRSGHGIGKSAVEAWSVIW 63

Query: 101 LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLH 159
            M TRP   + C A +E QL   LWAE+SKW+   P  +         L+          
Sbjct: 64  YMCTRPFPKIPCTAPTEHQLMDVLWAEISKWMRNNPALRDDLIWTKEKLYMQG------- 116

Query: 160 CSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERN 219
                  + +  + RT +   P+   G H  + +  I DEASG  D +   +LG +T  +
Sbjct: 117 -----HPEEWFAVPRTAT--NPEALQGFHAEH-VLYIIDEASGVSDKVFEPVLGAMTGED 168

Query: 220 ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV 279
           A    +M  NP RL+G FY+  ++  + +    +D R  + +  +F + II  +G DSDV
Sbjct: 169 AK--LLMMGNPTRLAGFFYDSHHRNREQYSAIHVDGRDSQHVSRTFVQKIIDMFGEDSDV 226

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVV-LRR 338
            RV V GQFP+   DS I +   EEA N +    P   + +G D+A  G D++ +  L  
Sbjct: 227 FRVRVAGQFPKSTPDSLIAMEWCEEAANLQV-YAPGGQIDIGVDVARYGDDSSALYPLID 285

Query: 339 GPVIEHLFDWSKTDLRTTNN----KISGLVEKYRPDAIII--DANNTGARTCD------- 385
                    +               I      Y   AI +  D +  G    D       
Sbjct: 286 KKQSLPYELYHHNRTTEIAGYVVIMIKQFAMDYPDAAIRVKVDCDGLGVGVYDNLYDQRD 345

Query: 386 ---------YLEMLGYH-------------------VYRVLGQKRA-----VDLEFCRNR 412
                         G +                   +               D     N 
Sbjct: 346 QIIDAIWYDRCRRAGINPEDGNQWNECQNVPKLDLEIIECHFGGSGGKVDDNDPVEYSNS 405

Query: 413 RTELHVKMADWLEFASL--INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTD 467
              +  K+  +L+   L   +   L+  L   + ++V   G+L +E K   + +G  S D
Sbjct: 406 TGLMWGKVRKYLQEGKLQLPDDDTLVSQL-CNRRYLVNKDGKLELERKESMKKRGLTSPD 464

Query: 468 YSDGLMYTFAEN 479
            +D L     E 
Sbjct: 465 IADALALALYEP 476


>gi|266623290|ref|ZP_06116225.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
 gi|288864932|gb|EFC97230.1| putative terminase B protein [Clostridium hathewayi DSM 13479]
          Length = 484

 Score =  283 bits (724), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 107/493 (21%), Positives = 189/493 (38%), Gaps = 72/493 (14%)

Query: 40  EKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVL 99
                L     P  +  + + V        +     +    ++ +G G+GK+ + +W V+
Sbjct: 3   SDDAVLFYADEPIYFVEDIIRVTPDQKQRDILRSLRDYPMTSVRSGHGVGKSAVESWSVI 62

Query: 100 WLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVL 158
           W + TRP   + C A ++ QL   LWAE+SKWL   P  K+        ++   +     
Sbjct: 63  WFLCTRPFPKIPCTAPTQHQLYDILWAEISKWLRNNPELKNDIIWTQQRVYMNGY----- 117

Query: 159 HCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTER 218
                   + +  + RT +   P+   G H  + +  I DEASG  D +   +LG +T  
Sbjct: 118 -------PEEWFAVPRTAT--NPEALQGFHAEH-VLYIIDEASGVSDKVFEPVLGAMTGE 167

Query: 219 NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSD 278
           +A    +M  NP RLSG F++  +K   ++    ID R  + ++  F + II  +G+DSD
Sbjct: 168 DAK--LLMMGNPTRLSGFFFDSHHKSRSEYSAMHIDGRDSQHVNQKFVQKIINMFGMDSD 225

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVV-LR 337
           V RV V GQFP+   DS I ++  E A   +P       + +G D+A  G D++ +  + 
Sbjct: 226 VFRVRVAGQFPKSTPDSLIMMDWCEAATQLKPE-TVRNRVDIGVDVARYGDDSSALYPVI 284

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA------IIIDANNTGARTCDYLE--- 388
                +    +        +  +  ++++Y  +       + +D +  G    D L    
Sbjct: 285 DKVQSDGYELYHHNRTTEISGYVVQMIKRYAVECLDAVIRVKVDCDGLGVGVYDNLYDLT 344

Query: 389 --------------------------------MLGYHVYRVLGQKRA-----VDLEFCRN 411
                                            L   +               D     N
Sbjct: 345 DQIIDEVWRDRCRREGLDPDNGNQWNECQRIPQLDLEIVECHFGAAGGKIDEDDPVEYSN 404

Query: 412 RRTELHVKMADWLEFASL--INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKST 466
               +  K+   L+  +L   +   LI  L S + +IV   G+L +E K   + +G  S 
Sbjct: 405 STGLMWGKIRKLLQTGALQIPDDDALISQL-SNRRYIVNKDGKLELERKEAMKKRGLPSP 463

Query: 467 DYSDGLMYTFAEN 479
           D +D L     + 
Sbjct: 464 DIADALALALYDP 476


>gi|253578914|ref|ZP_04856185.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849857|gb|EES77816.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 473

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 106/452 (23%), Positives = 179/452 (39%), Gaps = 50/452 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             P  +  E +                   K +I +G+G+GKT L A + LW ++  P  
Sbjct: 4   DDPVMFFREVLNFEPDEWQAQAARDLAANPKVSIKSGQGVGKTGLEAAVFLWFVTCFPHP 63

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLP-NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
            ++  A ++ QL   LW+E+SKW+S         +     ++               + K
Sbjct: 64  RIVATAPTKQQLHDVLWSEISKWMSKSELLSILLKWTKTYVYMVG------------EEK 111

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            +  + RT +  +P+   G H    M  I DEASG  D I   ILG L+  N     ++ 
Sbjct: 112 RWFGVARTAT--KPENMQGFHEDN-MLFIVDEASGVADPIMEAILGTLSGANNK--LLLC 166

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
            NP + SG FY+   +    +K   + +      +    + ++ +YG DS+V RV V G+
Sbjct: 167 GNPTKTSGTFYDSHTRDRALYKCHTVSSMDSTRTNKENIDSLVRKYGWDSNVVRVRVRGE 226

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAPLI---MGCDIAEEGGDNTVVVLRRGPVIEH 344
           FP Q+ D FIPL++IE+  ++    D    +    +G D+A  G D T++        + 
Sbjct: 227 FPNQEDDVFIPLSLIEQCSSKLLELDDADGMQFVSLGVDVARFGDDETIIYRNYHGHCKI 286

Query: 345 LFDWSKTDLRTTNNKISGLVEK-YRPD-------AIIIDANNTGARTCDYLEM------- 389
           + +    +L  T   I    +K YR          + ID    G    D L+        
Sbjct: 287 VRNRRGQNLMATVGDIVQEFKKIYREHPTYESKVYVQIDDTGLGGGVTDRLKEVRKEQKL 346

Query: 390 LGYHVYRVLGQKRAVD--------LEFCRNRRTELHVKMADWLEFAS--LINHSGLIQNL 439
               V  +   ++            E   N  T +   M D L+     + +    I  L
Sbjct: 347 YKMQVIPINAAEKIETDTAAGKDAAERYNNLTTAMWASMRDLLDNKQIVIEDDEQTIGQL 406

Query: 440 KSLKSFIVPNTGELAIESK---RVKGAKSTDY 468
            S + + + + G+L IE K   + +G  S D 
Sbjct: 407 SS-RKYTMASNGKLEIEPKKEMKKRGLDSPDR 437


>gi|83593922|ref|YP_427674.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
 gi|83576836|gb|ABC23387.1| hypothetical protein Rru_A2590 [Rhodospirillum rubrum ATCC 11170]
          Length = 505

 Score =  256 bits (654), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 109/495 (22%), Positives = 180/495 (36%), Gaps = 61/495 (12%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNP-NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
           P  +  + + +V       + +   P   K  + AG G+GKTT  A  + W +       
Sbjct: 9   PVLYARQRLGMVPTAQQAGLLSAIAPAGAKVTVRAGHGVGKTTATAAAIWWHLECFDYSK 68

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP-WYSDVLHCSLGIDSKH 168
             C A + +QL+  LW+E+++       +        +L     +       +     + 
Sbjct: 69  TPCTAPTASQLEQILWSELARLRRRADARAQGTGLPAALRLEALFAVSGRAIADRGTPRE 128

Query: 169 YSTMCRTYSEERPDTFVGHHNTYG------------------MAIINDEASGTPDVINLG 210
           +  + RT   ++PD   G H +                    +  + +EASG PD +   
Sbjct: 129 WFVVARTARRDQPDALQGFHASDIDLEAGAGPRLSAKSGGAALMFVIEEASGVPDAVFEV 188

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGII 270
             G L+   A    +M  NP R +G F     +    +   ++       +DP +  G++
Sbjct: 189 AEGALSSPGAR--LLMVGNPTRNTGFFARSHKRDRASFTALRLRCADSPLVDPGYRAGLV 246

Query: 271 ARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE--PCPDPYAPLIMGCDIAEEG 328
            +YG +S+V RV   G FP+QD D  I L   E AL R             +G D+A  G
Sbjct: 247 RKYGAESNVVRVRADGAFPRQDDDVLIALETAEAALARPLPARMATEDERRLGVDVARFG 306

Query: 329 GDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
            D TV +LR GPV+  +   +  D      +   L E +R   I +D    GA   D L 
Sbjct: 307 DDRTVFLLRIGPVVGAIEVTAGRDTMAVAGRARRLAEIWRAGRIYVDEIGVGAGVVDRLR 366

Query: 389 MLG----YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF------------------ 426
             G             +RA   E  R  R  L + +  WL                    
Sbjct: 367 EDGAPVVAVNVAASAPERAAGEERGRLLRDHLWLMVRGWLRDEAPVFAGPGGGPASGSAA 426

Query: 427 --------ASLIN-HSGLIQNL---KSLKSFIVPNTGELAIESK---RVKGAKSTDYSDG 471
                     +    + L Q+L    +   +    +G + +ESK   + +G +S D +D 
Sbjct: 427 GLLSGMGSCLVPGVDADLAQDLAGELATPRYAFDGSGRVVVESKDAMKRRGLRSPDLADA 486

Query: 472 LMYTFAENPPRSDMD 486
           L  TF E      + 
Sbjct: 487 LALTFHEAAAAGRVA 501


>gi|153810665|ref|ZP_01963333.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
 gi|149833061|gb|EDM88143.1| hypothetical protein RUMOBE_01049 [Ruminococcus obeum ATCC 29174]
          Length = 469

 Score =  251 bits (641), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/476 (24%), Positives = 187/476 (39%), Gaps = 68/476 (14%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P   Q + +  +  + +             ++ +G GIGK+ + AW V+W M T P   +
Sbjct: 26  PDPEQKKILRSLVENQM------------TSVRSGHGIGKSAVEAWSVIWFMCTHPYPKI 73

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKH-WFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
            C A ++ QL   LWAE+SKW                 L+                ++ +
Sbjct: 74  PCTAPTQHQLFDILWAEISKWKRNNKTLDSELIWTKEKLYM------------KGHAEEW 121

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + RT S   PD   G H  + M  I DEASG  D I   +LG L+   A    +M  N
Sbjct: 122 FAVARTAS--TPDALQGFHAEH-MLYIIDEASGVEDKIFEPVLGALSTPGAK--LLMCGN 176

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
           P +LSG FY+  NK  + +  F ID R    +   F + II  YG DSDV RV V G FP
Sbjct: 177 PTQLSGFFYDSHNKNREQYSTFHIDGRNSTRVSQEFVQTIINMYGEDSDVFRVRVAGDFP 236

Query: 290 QQDIDSFIPLNIIEEALNREPCPDPYAPLI-MGCDIAEEGGDNTVVVLRRGPVIEHLFDW 348
             + D +IPL ++E+++  E  P  +  +I +GCD+A  G D TV+  R    ++     
Sbjct: 237 LAEDDIYIPLPLVEKSIATEYFPRRHPQIIHIGCDVARFGTDKTVIGYRTDEKVQFFKKR 296

Query: 349 SKTDLRTTNNKISGLVEKYRPDAII-----------IDANNTGARTCDYLEMLGYH---- 393
              D   T + I  L         +           ID    G    D L  +  +    
Sbjct: 297 VGQDTMKTADDIVSLGMLLVYQYGLKPDIDEPIPIKIDDGGVGGGVVDRLRQIKRNNPER 356

Query: 394 -----VYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-----------FASLINHSGLIQ 437
                VY V   ++     F  +  T +   +   L+              L +   L+ 
Sbjct: 357 FWWMEVYPVKFGQKIRHK-FFDDSTTYMMSVLKKLLQPFDDNGLPKDVEIILPDDDALVA 415

Query: 438 NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
            +   + + +    ++ +ESK   + +G +S D +D ++        R     G  
Sbjct: 416 QISG-RKYEMTENSKIRVESKKVMKARGVQSPDEADCILL-VCLPVKRPKKKKGAT 469


>gi|148653111|ref|YP_001280204.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
 gi|148572195|gb|ABQ94254.1| hypothetical protein PsycPRwf_1309 [Psychrobacter sp. PRwf-1]
          Length = 520

 Score =  250 bits (637), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 86/498 (17%), Positives = 176/498 (35%), Gaps = 65/498 (13%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
           +WQ E +            +      + ++++G G GK+     + LW +   P   ++ 
Sbjct: 41  TWQQELLF----------KSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLF 90

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
            A    QL+T +W E++  L  L N       +  +             +      +   
Sbjct: 91  TAPQIGQLRTVVWKEINICLQRLRNNKALGWLADYV-----VVLAEKIYIKGFKDTWFVF 145

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
            +T  + +P    G H  + M    DEA G  D +    +G LT  N     ++TS P +
Sbjct: 146 AKTAPKHQPTNIAGQHGDHYMVW-ADEACGIDDAVMEVAIGALTHENNRA--VLTSQPAK 202

Query: 233 LSGKFYEIFNKPLD----DWKRFQIDTRTVEGIDPS-FHEGIIARYGLDSDVTRVEVCGQ 287
            +G FY+  +K        W   + +      +      E +      +S    + + G+
Sbjct: 203 NTGFFYDTHHKLSHHNGGKWTALEFNGEMSPIVSKDKLIEALYQYGSRNSPGYLIRIRGK 262

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAPL--IMGCDI-AEEGGDNTVVVL-------- 336
           FP+   +  +     E    +    +       I+  D+  + G D++V+ +        
Sbjct: 263 FPELKGEYLLTRTDYENMKQQPCVIEEGDKWGIIVAVDVGGDVGRDSSVISVMQVVDKMI 322

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                R   +++     ++ ++ T   KI+ ++  Y    ++ID    G      L+  G
Sbjct: 323 KGRIERHVHLLDIPLFSNRANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQSLKADG 382

Query: 392 YHVYRVLGQKRAVD---LEFCRNRRTELHVKMADWLEFASLINHSGL---------IQNL 439
            +   V       +     +  N+R+  +V MA  +E         +         ++  
Sbjct: 383 VYFDEVHWGSPCFNNTLKRYYMNKRSHAYVSMAKAVEKGYFSVSDKVKKMYQVMTNLEEQ 442

Query: 440 KSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRS------DMDFGRC 490
            +   +         + SK+    KG KS D +D + + F EN   +      D++ G  
Sbjct: 443 MTRLPYYFDEKARWCMMSKKDMLKKGIKSPDIADTIAFGFMENISYAPVESYEDLNIGST 502

Query: 491 PSYQYEGV-----DLLIE 503
            S + + +     +LL E
Sbjct: 503 ESDELDLLKQAADELLGE 520


>gi|307308936|ref|ZP_07588619.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
 gi|306900570|gb|EFN31183.1| hypothetical protein SinmeBDRAFT_4503 [Sinorhizobium meliloti
           BL225C]
          Length = 472

 Score =  249 bits (634), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 103/433 (23%), Positives = 182/433 (42%), Gaps = 28/433 (6%)

Query: 80  GAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKH 139
             +    G GKT ++A  + W +     + V   A SE+ +K+ +W E+    S +    
Sbjct: 50  ITVKGSSGWGKTFISAISLWWSLIVFDPVKVTIFAPSESTIKSGIWNELQVLYSNMA--- 106

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
                   L    +             +      R  S++      G H+   + +I DE
Sbjct: 107 -------PLFRELFEVSATKIFRKSRGETCWAEYRLVSKDNIAAARGFHSKNNI-VIADE 158

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRT 257
           ASG  DVI  G L  +         ++ SNP + SG F++ +  P    DW +     R 
Sbjct: 159 ASGIEDVIFTGALLNVLNDGPGAKVVLVSNPDKASGFFFKTWRDPELSKDWIKVHGSIRD 218

Query: 258 VEGIDPSFHEGIIARY-GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-NREPCPDPY 315
                P   E     Y G+ S      V G+FP  D+D  I    ++EA+ N++  P+P 
Sbjct: 219 KPNYTPGEEERFARLYGGVTSRDYLTLVEGEFPLSDVDGLISREFLDEAVTNKDAIPNPK 278

Query: 316 APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLV----EKYRPDA 371
           AP+I G D A  G D +V+ +R   V+    +W+  +      ++  L     +K RP  
Sbjct: 279 APIIWGLDPAGAGKDKSVLAIRHDNVLRGFEEWAGLEPVALALRVKELYLKTSKKDRPAV 338

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV-DLEFCRNRRTELHVKMADWLEFA--S 428
           I +D N  GA   D L+     VY+ +  +    + +     R ++  +M +W+     S
Sbjct: 339 IAVDGNGLGAGVYDALKHFKIPVYKCMFAEVPKRNPDRYTRVRDQIWFEMREWIHTGDVS 398

Query: 429 LINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDM 485
           + NH  LI++L ++ ++    + ++ IE K   + +  +S DY+D L  TF+ +  R   
Sbjct: 399 IPNHKKLIEDL-AIPTYED--SPKIKIEDKKSLKKRLGRSPDYADALALTFSVSHTRYAS 455

Query: 486 DFGRCPSYQYEGV 498
            +      +Y+ +
Sbjct: 456 KYQWDKPIEYDNL 468


>gi|332974843|gb|EGK11758.1| hypothetical protein HMPREF9373_1714 [Psychrobacter sp. 1501(2011)]
          Length = 520

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 82/498 (16%), Positives = 172/498 (34%), Gaps = 65/498 (13%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
           +WQ E +            +      + ++++G G GK+     + LW +   P   ++ 
Sbjct: 41  TWQQELLF----------KSIVVPGSRTSVASGHGTGKSRSAGIIALWHLLFYPESVMLF 90

Query: 113 LANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
            A    QL+T +W E++  L  L N       +  +             +      +   
Sbjct: 91  TAPQIGQLRTVVWKEINICLQRLRNNKALGWLADYV-----VVLAEKIYIKGFKDTWFVF 145

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
            +T  + +P    G H  + M    DEA G  D +    +G LT  N     ++TS P +
Sbjct: 146 AKTAPKHQPTNIAGQHGDHYMVW-ADEACGIDDAVMEVAIGALTHENNRA--VLTSQPAK 202

Query: 233 LSGKFYEIFNKPLD----DWKRFQIDTRTVEGIDPS-FHEGIIARYGLDSDVTRVEVCGQ 287
            +G FY+  +K        W   + +      +      E +      +S    + + G+
Sbjct: 203 NTGFFYDTHHKLSHYNGGKWIALEFNGEMSPIVSKEKLIEALYQYGSRNSPGYLIRIRGK 262

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDI---AEEGGDNTVVVL-------- 336
           FP+   +  +     E                +   +    + G D++V+ +        
Sbjct: 263 FPELKGEYLLTRTDYENMKAHPCVIKEGDKWGIIVTVDVGGDVGRDSSVISVLQVVDKMV 322

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                R   +++     ++ ++ T   KI+ ++  Y    ++ID    G      ++  G
Sbjct: 323 KGRIERHVHLLDIPLFSNRANINTLKAKINDVMSDYPGATLVIDPLGAGMGLTQSVKADG 382

Query: 392 YHVYRVLGQKRAVD---LEFCRNRRTELHVKMADWLEFASLINHSGL---------IQNL 439
            +   V       +     +  N+R+  +V MA  +E         +         ++  
Sbjct: 383 VYFDEVHWGSPCFNNTLKRYYMNKRSHAYVSMAKAVEKGYFSVSDKIKKMYQVITNLEEQ 442

Query: 440 KSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRS------DMDFGRC 490
            +   +         + SK+    KG KS D +D + + F EN   +      D++ G  
Sbjct: 443 MTRLPYYFDEKARWCMMSKKDMLKKGIKSPDIADTIAFGFMENISYAPAESYEDLNIGST 502

Query: 491 PSYQYEGV-----DLLIE 503
            S + + +     +LL +
Sbjct: 503 ESDELDLLKQAADELLGD 520


>gi|292670767|ref|ZP_06604193.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292647388|gb|EFF65360.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 442

 Score =  241 bits (614), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 87/434 (20%), Positives = 158/434 (36%), Gaps = 32/434 (7%)

Query: 79  KGAISAGRG-IGKTTLNAWLVLWLMSTRPGI--SVICLANSETQLKTTLWAEVSKWLSLL 135
           + A+       GKT      ++               +A    Q K   W  +  + + +
Sbjct: 26  RFAVLVCHRRFGKTVGTVNEMIRKAILNDKKAPVYAYVAPYRNQAKRVAWEYLKYYTNPI 85

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
           P +                 +     + + ++H  +          D        Y   +
Sbjct: 86  PGR---------------VVNESELYIELPTRHARSPGARLYIIGADHPDALRGIYLDGV 130

Query: 196 INDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
           I DE +   P++    I   L +R     +I T   +    + Y+   K    W      
Sbjct: 131 ILDEYADIKPELWGGVIRPALADRQGWAVFIGTPKGQNQFYEMYQHAEKSAG-WYSCIYR 189

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
           T     +     + + A+        R E+   F     D  IP++++  A NR    D 
Sbjct: 190 TDETGVLPAEELKDMQAQMTEME--IRQELLCDFTASASDVVIPIDLVTAAANRLLKDDD 247

Query: 315 --YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAI 372
               P+I+G D+A  G D TV+ +R+G  ++ +  ++      T +++   + ++ P A 
Sbjct: 248 VLGQPVILGVDVARFGDDRTVLCVRQGLWLKEVRTFTGLSTMETASRVIDCINQHHPHAT 307

Query: 373 IIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS-LIN 431
            IDA   GA   D L  L Y V  V   + A+D     N R E++ K   WLE    +  
Sbjct: 308 FIDAGAMGAGVIDRLRQLRYQVSEVNFGEMAMDAARYANIRAEMYFKCRAWLEAGGAIPQ 367

Query: 432 HSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP---PRSDM 485
           ++ L   L +++ +    TG + +E K   + +  KS D +DG + TFA      P +  
Sbjct: 368 NAELKTELSTVE-YKFNPTGRIILEPKDKLKERTGKSPDLADGFVLTFARPVYINPSAGG 426

Query: 486 DFGRCPSYQYEGVD 499
                 S +Y+   
Sbjct: 427 IGDDASSAEYDPFA 440


>gi|269119479|ref|YP_003307656.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
 gi|268613357|gb|ACZ07725.1| hypothetical protein Sterm_0853 [Sebaldella termitidis ATCC 33386]
          Length = 499

 Score =  240 bits (613), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 94/460 (20%), Positives = 162/460 (35%), Gaps = 69/460 (15%)

Query: 76  EVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLL 135
           E  + ++ AG   GK++L   L  + + TRP   VI  A +  QLKT  WAEV+K  +  
Sbjct: 44  EYRRLSVPAGHSTGKSSLAGGLTTYWLITRPKSRVIVTAPTYRQLKTIYWAEVNKIYNRS 103

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG--- 192
             K         L+       ++  +     + +  +  T S   P+   G H       
Sbjct: 104 KLK--------QLNLFEINDKIMRINDKDLKREWFALPVTAS--TPEGMQGQHGDKTEVI 153

Query: 193 -----------------------------------------MAIINDEASGTPDVINLGI 211
                                                    + ++ DE+SG  + I   +
Sbjct: 154 EQIMKHLGIEEIGDDETIEIVSQILRGEKQIEGLTKEDKEKLLVMVDESSGVKNEIFEVL 213

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA 271
            G           ++  N  + +G FYE    P   + +  + +     +       +  
Sbjct: 214 EGT-----DYDKLVLFGNMTKNTGYFYESVYNPKSKFYKVTMSSYNSPFMKKEQIHDLEE 268

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAE-EGGD 330
            YG DS+V RV + G+ P  + +S    N I+ A  R      Y  + +G D+ +  GGD
Sbjct: 269 TYGPDSNVVRVRLKGEAPDGNENSIFSSNKIDSAFQRSLSLSEYETIKLGVDVGKGSGGD 328

Query: 331 NTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII--IDANNTGARTCDYLE 388
           ++ +  ++   +    D     L     +I     K R   II  ID    G      LE
Sbjct: 329 SSTIYEKKDNRVRKKLDRKDFTLPDVKREIIQYCYKNRDKLIIANIDGTGLGTGLVQELE 388

Query: 389 M---LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSF 445
                   V  +    +A + +   N+RTE++ +++  L+   L     L + L  ++ +
Sbjct: 389 EGEIENLVVNDIQFAGKAKNKKEFNNKRTEMYFELSRNLDKLDLEEDQELKRELL-IQIY 447

Query: 446 IVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPR 482
              N G   + SK   +     S D SD L     E   R
Sbjct: 448 EFDNNGRFKLISKDKIKEMLGHSPDKSDALALCNYEAETR 487


>gi|161789175|ref|YP_001595730.1| PacB [Vibrio sp. 0908]
 gi|161761461|gb|ABX77106.1| PacB [Vibrio sp. 0908]
          Length = 572

 Score =  237 bits (603), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 86/459 (18%), Positives = 162/459 (35%), Gaps = 41/459 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK-WL 132
            P   + ++++G G GK+ L A L L  + T P    +  ANS  Q+   +++ + + W+
Sbjct: 57  TPVGARVSVASGHGTGKSHLTAALCLHFIITHPESLCMLTANSLDQVTNVVFSYIKRCWV 116

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
            +   + W E          +               +    +T S+   +   G H    
Sbjct: 117 KICQRQPWLE--------QYFVITAKSFYAKGYKGVWQIFGKTCSKGNEEGLAGQHRRDY 168

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN--KPLDDWKR 250
           M ++ DEASG  D     + G LTE N     ++ S   R +G F +          +  
Sbjct: 169 M-VVVDEASGVSDRAFEVLRGALTEDNNK--MLLISQFTRPTGHFADSQMELAEQGLYTA 225

Query: 251 FQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +++     ++  F  E  I   G+ S    + V G  P       I  +++++     
Sbjct: 226 ITLNSEMSPFVNLKFIREKRIEYGGVTSPEYGIRVLGVCPDDASGFLISRSLVDKGFEAV 285

Query: 310 PCPDPYAPLIMGCDIAEEGG-DNTVVVL---------RRGPVIEHLFDWSKTDLRTTNNK 359
                    +   D+A   G D++V+ +         R+  V++ +   +  D       
Sbjct: 286 IEFADEWGWVAVADVAGGEGRDSSVLKIGKVCGFGSERQVEVVKAIEAPADMDGVQFARF 345

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRA---VDLEFCRNRRTEL 416
           I      Y   ++ IDA+  G  T    E LG +V R+   +        +     +   
Sbjct: 346 IHQETAGYTNISVGIDADGYGLTTAQECEKLGVNVTRIHWGRPPHANSVKQRFPKEKDFA 405

Query: 417 HVKMADWLEFASLINHS--------GLIQNLKSLKSFIVPNTGELAIESKR---VKGAKS 465
            V + + L    L  H          L +    +  +     G   I SK+    +G KS
Sbjct: 406 CVMVKEALGTGRLKLHRGETKQFEKKLQKQFVKIP-YEFDELGRWRIFSKKQLRSEGIKS 464

Query: 466 TDYSDGLMYTFA-ENPPRSDMDFGRCPSYQYEGVDLLIE 503
            D  D   + +  +  P  +   G+  +   + + LL E
Sbjct: 465 PDIFDATAFFWLVDYIPAGEQSDGQSDNALAKAMALLGE 503


>gi|48697461|ref|YP_024846.1| Pas60 [Actinoplanes phage phiAsp2]
 gi|47679679|gb|AAT36808.1| Pas60 [Actinoplanes phage phiAsp2]
          Length = 492

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 107/475 (22%), Positives = 174/475 (36%), Gaps = 56/475 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP-- 106
            +P +W  + ++V  A     + +  P   + A+    G+GK+   A LV W  +TR   
Sbjct: 21  DSPTAWAADCLDVRLAGYQGEILDAVPRERRVAVRGPHGLGKSFSGAILVNWFATTRDLM 80

Query: 107 --GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
                +I  A++   L+  LW E+ KW           +  ++L  AP+        L +
Sbjct: 81  GKDWKIITTASAWRHLEVYLWPEIHKWA--------GRINFVALGRAPYNPRTELLDLRL 132

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERN----A 220
              H +      +  +P+   G H    +  + DEA   P      I G  +        
Sbjct: 133 KLTHGAATAVASN--QPERIEGAHAEE-LLYLLDEAKIVPPATWDSIEGAFSNAGVDVAD 189

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPL--DDWKRFQIDTRT---VEGIDPSFHEGIIARYGL 275
           N +    S P   SG+FY+I  +    +DW    +          I  ++ +   +++G 
Sbjct: 190 NAYAFAMSTPGAPSGRFYDIHRRAPGYEDWWTRHVTLEEAIASGRISRAWADQRRSQWGS 249

Query: 276 DSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD------PYAPLIMGCDIAEEGG 329
           DS V    V G+F   D DS IPL  +E A+ R    D      P  PL  G D+   GG
Sbjct: 250 DSAVFHNRVLGEFHASDEDSVIPLAWLEAAIERWHEWDRQGRPSPGGPLWTGVDVGR-GG 308

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           D TV+  R G  +  L    + D   T   I       R    IID    GA   D L  
Sbjct: 309 DETVLAARDGWAVT-LETNRRRDTMATVGLIQA-----REGRAIIDVIGLGAGVFDRLRE 362

Query: 390 LGYHVYRVLGQKRAVDLEF-----CRNRRTELHVKMADWLEFA-----SLINHSGLIQNL 439
           LG       G   A   +        N R+  +  + + L+ A     +L     +I +L
Sbjct: 363 LGTRPLAYTGSAGATVRDRSGKFGFTNTRSAAYWNLRELLDPAFDPVLALPPDDLMISDL 422

Query: 440 KSLKSFIVPNT-GELAIESKRV---KGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
            +    +      ++ +E K     +  +S D  D +  +       +D   G  
Sbjct: 423 TTPHWEVTTGVPPKIKVEPKDKVVERLGRSPDRGDAIAMSL-----WADRHRGSS 472


>gi|323179619|gb|EFZ65182.1| terminase B protein [Escherichia coli 1180]
          Length = 453

 Score =  232 bits (590), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/443 (20%), Positives = 164/443 (37%), Gaps = 36/443 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +
Sbjct: 2   QETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWA 61

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +H +      L    +Y              +  +C+ Y     +   G H  + +
Sbjct: 62  NAVKRHGWLQTYFVLSDTMFYE-------RSRKGIWEVLCKGYRLGNEEALAGEHAAH-L 113

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-------KPLD 246
            +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P  
Sbjct: 114 LLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKG 171

Query: 247 DWKRFQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W    +++     + P F  + ++   G DS    V+V GQFP++     +  +  + A
Sbjct: 172 IWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRA 231

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNT-----VVVLRRGPVIEHLFDWSKTDLRT---TN 357
             R+   +     +   D+      +      V   R    + +                
Sbjct: 232 ARRKVLLEKNWGWVATADVGNGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPLAFA 291

Query: 358 NKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNR 412
           + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E   N+
Sbjct: 292 DFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERFVNQ 351

Query: 413 RTELHVKMADWLEFASLINH-SGLIQNLKSLKSFIVPNTGELAIESK----RVKGAKSTD 467
           R   ++   D ++   +            S   F++   G++A+  K    +    KS D
Sbjct: 352 RAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIKSPD 411

Query: 468 YSDGLMYTFAENPPRSDMDFGRC 490
             D   +T   +   ++ D G  
Sbjct: 412 RWDTYCFTMLVDYVPANEDIGAE 434


>gi|56266666|gb|AAV84947.1| DNA pacase B subunit [Enterobacteria phage D6]
          Length = 502

 Score =  231 bits (589), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/443 (20%), Positives = 165/443 (37%), Gaps = 36/443 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +
Sbjct: 51  QETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWA 110

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +H +      L    +Y              +  +C+ Y     +   G H  + +
Sbjct: 111 NAVKRHGWLQTYFVLSDTMFYE-------RSRKGIWEVLCKGYRLGNEEALAGEHAAH-L 162

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-------KPLD 246
            +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P  
Sbjct: 163 LLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKG 220

Query: 247 DWKRFQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W    +++     + P F  + ++   G DS    V+V GQFP++     +  +  + A
Sbjct: 221 IWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRA 280

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNT-----VVVLRRGPVIEHLFDWSKTDLRT---TN 357
             R+   +     +   D+      +      V   R    + +      +         
Sbjct: 281 ARRKVLLEKNWGWVATADVGNGRDKSVLNICKVSGHRDKRRVVNFKVMEMSGTMDPLAFA 340

Query: 358 NKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNR 412
           + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E   N+
Sbjct: 341 DFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERFVNQ 400

Query: 413 RTELHVKMADWLEFASLINH-SGLIQNLKSLKSFIVPNTGELAIESK----RVKGAKSTD 467
           R   ++   D ++   +            S   F++   G++A+  K    +    KS D
Sbjct: 401 RAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIKSPD 460

Query: 468 YSDGLMYTFAENPPRSDMDFGRC 490
             D   +T   +   ++ D G  
Sbjct: 461 RWDTYCFTMLVDYVPANEDIGAE 483


>gi|56266643|gb|AAV84926.1| DNA pacase B subunit [Enterobacteria phage phiW39]
          Length = 494

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/503 (18%), Positives = 184/503 (36%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + +++  +   PG   I +AN   Q+ T ++  +          +W    S     A
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI--------NWATATSRFPWLA 115

Query: 152 PWYSDVLHCSLGI-DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++         I     ++ + + +     +   G H  + +  I DEASG  D     
Sbjct: 116 DYFVLTETAFYEITGKGVWTVVPKGFRLGSEEALAGEHADH-LLYIIDEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD-------WKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K           +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHE-GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +    G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTT--NNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+  T    KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYLEM-LGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D +    G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|312964323|ref|ZP_07778627.1| terminase B protein [Escherichia coli 2362-75]
 gi|331655801|ref|ZP_08356790.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
 gi|312291036|gb|EFR18910.1| terminase B protein [Escherichia coli 2362-75]
 gi|323186470|gb|EFZ71817.1| terminase B protein [Escherichia coli 1357]
 gi|323969205|gb|EGB64507.1| terminase B protein [Escherichia coli TA007]
 gi|325495624|gb|EGC93488.1| DNA pacase B subunit [Escherichia fergusonii ECD227]
 gi|331046575|gb|EGI18664.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M718]
          Length = 494

 Score =  231 bits (588), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 92/503 (18%), Positives = 183/503 (36%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + +++  +   PG   I +AN   Q+ T ++  +          +W    S     A
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI--------NWATATSRFPWLA 115

Query: 152 PWYSDVLHCSLG-IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++               ++ + + +     +   G H  + +  I DEASG  D     
Sbjct: 116 DYFVLTETAFYEVTGKGVWTVVPKGFRLGSEEALAGEHADH-LLYIIDEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD-------WKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K           +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHE-GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +    G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTT--NNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+  T    KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYLEM-LGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D +    G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|324111095|gb|EGC05081.1| terminase B protein [Escherichia fergusonii B253]
          Length = 494

 Score =  230 bits (586), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 92/503 (18%), Positives = 183/503 (36%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ + +          + +   +  K ++S+G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQDLI----------IESVQEQGSKTSVSSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + +++  +   PG   I +AN   Q+ T ++  +          +W    S     A
Sbjct: 64  DMTSIMIMLFIIMYPGARAIIVANKIQQVMTGIFKYIKI--------NWATATSRFPWLA 115

Query: 152 PWYSDVLHCSLG-IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++               ++ + + +     +   G H  + +  I DEASG  D     
Sbjct: 116 DYFVLTETAFYEVTGKGVWTVVPKGFRLGSEEALAGEHADH-LLYIIDEASGVSDRAFGI 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD-------WKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  +K           +    +++     + P
Sbjct: 175 ITGALTGQDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPDGVYTAITLNSEESPLVTP 232

Query: 264 SFHE-GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           +F +  +    G D+ +  ++V G FP+      +  + +E A  R+         +   
Sbjct: 233 AFIKMKLAEYGGRDNPMYMIKVRGLFPKSQDGFLLGRDEVERATRRKVKIAKGWGWLACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTT--NNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+  T    KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRILEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYLEM-LGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D +    G  V R+   K+     D     ++R   +V+ A+ ++  
Sbjct: 353 IAIDGDGLGKATADLMYEYYGITVQRIRWGKKMHSREDKSLYFDKRAYANVQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    +  
Sbjct: 413 RMRLDKGNETIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLADYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|323948959|gb|EGB44853.1| terminase B protein [Escherichia coli H252]
          Length = 502

 Score =  230 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 93/443 (20%), Positives = 164/443 (37%), Gaps = 36/443 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +
Sbjct: 51  QETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWA 110

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +H +      L    +Y              +  +C+ Y     +   G H  + +
Sbjct: 111 NAVKRHGWLQTYFVLSDTMFYE-------RSRKGIWEVLCKGYRLGNEEALAGEHAAH-L 162

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-------KPLD 246
            +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P  
Sbjct: 163 LLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSRAKTPDNPKG 220

Query: 247 DWKRFQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W    +++     + P F  E ++   G DS    V+V GQFP++     +  +  + +
Sbjct: 221 IWTAIVLNSEESPFVTPQFIKEKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRS 280

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNT-----VVVLRRGPVIEHLFDWSKTDLRT---TN 357
             R+   +     +   D+      +      V   R    + +                
Sbjct: 281 ARRKVLLEKNWGWVATADVGNGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPLAFA 340

Query: 358 NKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNR 412
           + I      EKY    I +DA+  G+ TC  L   G +  R+   K      D E   N+
Sbjct: 341 DFIYNECTPEKYPNITIAVDADGFGSDTCAQLVRRGANPVRIRWGKPMFANKDRERFVNQ 400

Query: 413 RTELHVKMADWLEFASLINH-SGLIQNLKSLKSFIVPNTGELAIESK----RVKGAKSTD 467
           R   ++   D ++   +            S   F++   G++A+  K    +    KS D
Sbjct: 401 RAYANIMARDAIKSGRMRIDSDPKTAEQASKIPFLLNEEGKMAMMRKEHMRQKLNIKSPD 460

Query: 468 YSDGLMYTFAENPPRSDMDFGRC 490
             D   +T   +   ++ D G  
Sbjct: 461 RWDTYCFTMLVDYVPANEDIGAE 483


>gi|304399103|ref|ZP_07380971.1| DNA packaging protein [Pantoea sp. aB]
 gi|304353343|gb|EFM17722.1| DNA packaging protein [Pantoea sp. aB]
          Length = 503

 Score =  229 bits (583), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 101/525 (19%), Positives = 184/525 (35%), Gaps = 63/525 (12%)

Query: 13  QKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQ-LEFMEVVDAHCLNSVN 71
           +K    + +D         + + + W      L G     +WQ  E M  V         
Sbjct: 4   KKRIKSVTTDPRWRDMV--IRYRYNWALAVVELFGMIP--TWQQEEIMNSVQE------- 52

Query: 72  NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW 131
                  +  +++G G GK++L A ++L  M   P   VI +AN   Q+KT ++  V  +
Sbjct: 53  ----TGSQTTVTSGHGTGKSSLTAMMLLIYMIMYPDARVIIVANKIGQVKTGVFKYVKTY 108

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
            +    +H             +               +  +C+ Y     +   G H  +
Sbjct: 109 WANAARRH-------PWLQNYFTLTDTMFYEKSRKGIWEVLCKGYRLGNEEALAGEHAAH 161

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-------KP 244
            + +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P
Sbjct: 162 -ILLILDEASGISDKAIAIMRGALTEEDNR--MLMMSQPTRPSGYFYDSHHSLARHPDNP 218

Query: 245 LDDWKRFQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIE 303
              W    +++     +   F  E ++   G DS    V+V G+FP+      +  +  +
Sbjct: 219 NGFWNAIVLNSEEAPHVTLKFIREKLVEYGGRDSLEYMVKVLGRFPRNVSGYLLGRDECD 278

Query: 304 EALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL---------RRGPVIEHLFDWSKTDLR 354
            A  R+   +     +   D+     D +++ +         RR    + L      D  
Sbjct: 279 RAARRKVYLEKGWGWVATADVGNGR-DKSILNICKVSGYGDARRVVSFKLLEMPGTMDPI 337

Query: 355 TTNNKISGLV--EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL---EFC 409
           +  + I+     E+Y    I +D +  G+ T   LE  G +   +   +        E  
Sbjct: 338 SFGDYIANECTQERYPGITIAVDGDGVGSGTLKQLERRGVNAISIRWGQPPFSKKVRERF 397

Query: 410 RNRRTELHVKMADWLEFASLINH--SGLIQNLKSLKSFIVPNTGELAIESK----RVKGA 463
           +N+R   ++  AD +    +         +    +  + +   G + +  K    +    
Sbjct: 398 KNQRAWSNIMAADAIRSGRMRIDMSQHTAEQASKIP-YFMDEMGRIMMVPKPQMRQKLNI 456

Query: 464 KSTDYSDGLMYTF------AENPPRSDM-DFGRCPSYQYEGVDLL 501
           KS D  D   + F      AE     DM DF +    +   +D L
Sbjct: 457 KSPDRWDTYCFIFLIGYRPAEAELSEDMADFTQSKLDELSELDAL 501


>gi|256392042|ref|YP_003113606.1| hypothetical protein Caci_2856 [Catenulispora acidiphila DSM 44928]
 gi|256358268|gb|ACU71765.1| conserved hypothetical protein [Catenulispora acidiphila DSM 44928]
          Length = 484

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 82/469 (17%), Positives = 151/469 (32%), Gaps = 55/469 (11%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGIS- 109
           P  W  + +          +     +    A+ +  G GK+ + + L  W + T P    
Sbjct: 28  PARWVDDKLGEYLWSRQVDIATSVRDQRLTAVQSCHGTGKSFVASRLTAWWLDTHPPGEA 87

Query: 110 -VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            V+  A +  Q+K  LWAE++K  +    +         ++   W  D          K 
Sbjct: 88  FVVTTAPTGDQVKAILWAEINKAFAKAEAR--GTPLPGRINETDWKYD----------KF 135

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
                R  S+  P  F G H  Y + +I DEA G         L   T    +   +   
Sbjct: 136 LVAFGRKPSDYNPHAFQGIHAKY-VLVILDEACGISKQFWTAALAIAT--GVHCRILAIG 192

Query: 229 NPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE--------------GIIARYG 274
           NP      F ++     D W   +I  R                          +   +G
Sbjct: 193 NPDDPGSHFAQVC--KSDRWNMIKIAARDTPNFTGEEVPDDLADMLVSQAYVLDMAEEFG 250

Query: 275 LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN---REPCPDPYAPLIMGCDIAEEGGDN 331
            +S +   +V  +FP    D  + L+ +            PD   P+ +G D+   GGD 
Sbjct: 251 PESPIYLSKVDAEFPSDASDGVVRLSKLMACTREPVHPYAPDRLVPVELGVDLG-AGGDE 309

Query: 332 TVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
           T +  RRG      +   + D     + I   + +     + +D+   G      L+   
Sbjct: 310 TCIRERRGIAAGREWRNREKDSEKVVDHIVRAIRETGATKVKVDSIGIGWGIVGSLQARR 369

Query: 392 Y------HVYRVLGQKRAVDLEFCRNRRTELHVKM-ADWLEFASLI-------NHSGLIQ 437
                   V  V   + +   E     R+++  ++     E            +   L+ 
Sbjct: 370 KQGLHTAEVVGVNVSEASTQPEKYARLRSQIWWEVGRKLSEDGGWDLSQLDTTDRDRLVS 429

Query: 438 NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRS 483
            L +   + +  +G + +E K   + +  +S D +D L+  F       
Sbjct: 430 QLTA-PKYDLDASGRIVVEKKEETKKRIGRSPDNADALLLAFYTPSVPK 477


>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter
           asiaticus]
          Length = 255

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 250/255 (98%), Positives = 254/255 (99%)

Query: 88  IGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 147
           IGKTTLNAWLVLWLMS RPG+S+ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS
Sbjct: 1   IGKTTLNAWLVLWLMSIRPGMSIICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS 60

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI
Sbjct: 61  LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 120

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
           NLGILGFLTE+NANRFWIMTSNPRRLSGKFYEIFN+PLDDWKRFQIDTRTVEGIDPSFHE
Sbjct: 121 NLGILGFLTEQNANRFWIMTSNPRRLSGKFYEIFNRPLDDWKRFQIDTRTVEGIDPSFHE 180

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
           GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE
Sbjct: 181 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEE 240

Query: 328 GGDNTVVVLRRGPVI 342
           GGDNTVVVLRRGPVI
Sbjct: 241 GGDNTVVVLRRGPVI 255


>gi|168467778|ref|ZP_02701615.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|195629119|gb|EDX48493.1| DNA pacase B subunit [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
          Length = 494

 Score =  227 bits (577), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 93/504 (18%), Positives = 186/504 (36%), Gaps = 57/504 (11%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQL-EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGK 90
             + + W      + G +   +WQ  + +E V                K ++S+G G GK
Sbjct: 16  AQYRYDWIAAADVMFGKTP--TWQQDQIIESVQE-----------PGSKTSVSSGHGTGK 62

Query: 91  TTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHP 150
           + + + +++  +   PG   I +AN   Q+ T ++  +          +W    S     
Sbjct: 63  SDMTSIMIMLFIIMFPGARAIIVANKIQQVMTGIFKYLKI--------NWSTATSRFPWL 114

Query: 151 APWYSDVLHCSLGID-SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINL 209
           A ++         I     ++ + + +     +   G H  + +  I DEASG  D    
Sbjct: 115 AEYFVLTDTSFYEITSKGVWTVVPKGFRLGNEEALAGEHADH-LLYIIDEASGVSDKAFG 173

Query: 210 GILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD-------WKRFQIDTRTVEGID 262
            + G LT ++     +  S P R SG FY+  +K           +    +++     + 
Sbjct: 174 IMTGALTGKDNRILLL--SQPTRPSGYFYDTHHKLAKRPGNPNGIYTAITLNSEESPLVT 231

Query: 263 PSFHE-GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMG 321
           P F +  +    G DS +  ++V G FP+      +  + +E A  R+         I  
Sbjct: 232 PEFIKMKLAEYGGRDSPMYLIKVRGLFPKTQDGFLLGRDEVERASRRKVKIAKGWGWIAC 291

Query: 322 CDIA-EEGGDNTVVVL------RRGPVIE--HLFDWSKTDLRTTNNKISGLV--EKYRPD 370
            D+A   G D +V+ +      R    I    + ++S         KI+     ++Y   
Sbjct: 292 VDVAGGTGRDKSVINIMMVSGERNKRRIIGYRIIEYSDVTETQLAAKINAECSPDRYPNI 351

Query: 371 AIIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEF 426
            I+ID +  G  T D L +  G    R+   K+     D     ++R   +V+ A+ ++ 
Sbjct: 352 TIVIDGDGLGKSTADLLYDNYGITAQRIRWGKKMHSREDRSLYFDQRAYANVQAAEAVKS 411

Query: 427 ASLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTF-AEN 479
             +        I+    +    + + G+  + S    K+    +S D+ D   +   A  
Sbjct: 412 GRMRLDKGDATIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLRSPDHWDTYCFGMLANY 470

Query: 480 PPRSDMDFGRCPSYQYEGVDLLIE 503
            P++++      +   E +  L E
Sbjct: 471 VPQNEVLSFEDEAQVDEALAWLNE 494


>gi|331649955|ref|ZP_08351031.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
 gi|331041212|gb|EGI13366.1| terminase B protein (PACase B protein) (DNA packaging B protein)
           [Escherichia coli M605]
          Length = 494

 Score =  222 bits (566), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 89/503 (17%), Positives = 179/503 (35%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ +            + +   +    ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQD----------EIIESTQQDGSWTSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + + +  +   PG  VI +AN   Q+   ++  +          +W    S     +
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK--------SNWATAVSRFPWLS 115

Query: 152 PWYSDVLHCSLG-IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++               ++ + ++      +   G H  + +  I DEASG  D     
Sbjct: 116 KYFILTETSFFEVTGKGVWTILIKSCRPGNEEALAGEHADH-LLYIIDEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +    G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRT--TNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+       KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMQEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    N  
Sbjct: 413 RMRLDKGAATIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|46401730|ref|YP_006576.1| PacB [Enterobacteria phage P1]
 gi|301646767|ref|ZP_07246623.1| putative terminase B protein [Escherichia coli MS 146-1]
 gi|129547|sp|P27753|TERL_BPP1 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|68597607|sp|Q5XLR0|TERL_BPP7 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein B; AltName: Full=PACase B protein; AltName:
           Full=Terminase B protein; AltName: Full=Terminase large
           subunit
 gi|33323612|gb|AAQ07582.1|AF503408_106 PacB [Enterobacteria phage P7]
 gi|215636|gb|AAA21724.1| pacB [Enterobacteria phage P1]
 gi|33338757|gb|AAQ14080.1| PacB [Enterobacteria phage P1]
 gi|33338866|gb|AAQ14188.1| PacB [Enterobacteria phage P1]
 gi|54112354|gb|AAV28854.1| PacB [Enterobacteria phage P7]
 gi|301075042|gb|EFK89848.1| putative terminase B protein [Escherichia coli MS 146-1]
          Length = 494

 Score =  222 bits (565), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 89/503 (17%), Positives = 179/503 (35%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ +            + +   +    ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQD----------EIIESTQQDGSWTSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + + +  +   PG  VI +AN   Q+   ++  +          +W    S     +
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK--------SNWATAVSRFPWLS 115

Query: 152 PWYSDVLHCSLG-IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++               ++ + ++      +   G H  + +  I DEASG  D     
Sbjct: 116 KYFILTETSFFEVTGKGVWTILIKSCRPGNEEALAGEHADH-LLYIIDEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +    G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRT--TNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+       KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    N  
Sbjct: 413 RMRLDKGAATIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|260871239|ref|YP_003238019.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
 gi|257767818|dbj|BAI39311.1| DNA packaging protein [Escherichia coli O111:H- str. 11128]
          Length = 494

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 89/503 (17%), Positives = 179/503 (35%), Gaps = 55/503 (10%)

Query: 32  VLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKT 91
            L+ + W      L G +   +WQ +            + +   +    ++++G G GK+
Sbjct: 16  ALYRYDWIAAADVLFGKTP--TWQQD----------EIIESTQQDGSWTSVTSGHGTGKS 63

Query: 92  TLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
            + + + +  +   PG  VI +AN   Q+   ++  +          +W    S     +
Sbjct: 64  DMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIK--------SNWATAVSRFPWLS 115

Query: 152 PWYSDVLHCSLG-IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLG 210
            ++               ++ + ++      +   G H  + +  I DEASG  D     
Sbjct: 116 KYFILTETSFFEVTGKGVWTILIKSCRSGNEEALAGEHADH-LLYIIDEASGVSDKAFSV 174

Query: 211 ILGFLTERNANRFWIMTSNPRRLSGKFYEIFNK-------PLDDWKRFQIDTRTVEGIDP 263
           I G LT ++     +  S P R SG FY+  ++       P   +    +++     +D 
Sbjct: 175 ITGALTGKDNRILLL--SQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDA 232

Query: 264 SFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
            F    +    G D+ +  ++V G+FP+      +  + +E A  R+         +   
Sbjct: 233 KFIRAKLAEYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACV 292

Query: 323 DIA-EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRT--TNNKISGLV--EKYRPDA 371
           D+A   G D +V+ +      R    + +      TD+       KI      E++    
Sbjct: 293 DVAGGTGRDKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNIT 352

Query: 372 IIIDANNTGARTCDYL-EMLGYHVYRVLGQKR---AVDLEFCRNRRTELHVKMADWLEFA 427
           I ID +  G  T D + E  G  V R+   K+     D     + R   +++ A+ ++  
Sbjct: 353 IAIDGDGLGKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSG 412

Query: 428 SLINH--SGLIQNLKSLKSFIVPNTGELAIES----KRVKGAKSTDYSDGLMYTFAENPP 481
            +     +  I+    +    + + G+  + S    K+     S D+ D   +    N  
Sbjct: 413 RMRLDKGAATIEEASKIP-VGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYV 471

Query: 482 RSDMDFGRCPSYQY-EGVDLLIE 503
             D         Q  E +  L E
Sbjct: 472 PQDEVLSVEDEAQVDEALAWLNE 494


>gi|323516996|gb|ADX91377.1| hypothetical protein ABTW07_0941 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|323518424|gb|ADX92805.1| hypothetical protein ABTW07_2381 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 663

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 86/430 (20%), Positives = 152/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                E    +YG  +    ++ V G+FP    +  I     EE        D +    +
Sbjct: 379 SKQSLEEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYV 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V +A 
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGLAR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   +  G KS D  D   +
Sbjct: 559 AIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|299769795|ref|YP_003731821.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
 gi|298699883|gb|ADI90448.1| hypothetical protein AOLE_07785 [Acinetobacter sp. DR1]
          Length = 668

 Score =  221 bits (562), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 89/430 (20%), Positives = 151/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                E    +YG  D    ++ V G+FP    +  I     EE        D +    I
Sbjct: 379 SKQSLEEQRQKYGSRDDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYI 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVISKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V  A 
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGFAR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   R  G KS D  D   +
Sbjct: 559 AVASGRFKMKTKKHYVKIKDQLIHIP-YRFDDFARYKILSKDEMRRMGIKSPDLGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|294789575|ref|ZP_06754810.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
 gi|294482512|gb|EFG30204.1| putative terminase B protein [Simonsiella muelleri ATCC 29453]
          Length = 516

 Score =  221 bits (562), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 81/499 (16%), Positives = 151/499 (30%), Gaps = 75/499 (15%)

Query: 25  KLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISA 84
                 FVL                +P   Q + +  +                K ++ +
Sbjct: 17  ANDPVGFVLGVC---------GNSVSPD--QEKLLNAIID-----------PTAKVSVVS 54

Query: 85  GRGIGKTTLNAWLVLWLMSTRP----------GISVICLANSETQLKTTLWAEVSKWLSL 134
           G G GKT     + LW +   P          G +    A +  Q+   +W E++  +  
Sbjct: 55  GTGTGKTMSFGRIALWHLLCFPVAKYDGKIEIGSNTYIGAPAIKQVGDGVWKEITDAVQA 114

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
           +         + +              +      +        + +  +  G H  Y   
Sbjct: 115 MRANR-----ATAWLAEYIVVQAERVYIIDYKATWFITKFAMQQGQSVSIAGKHRFYQ-L 168

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKR 250
           II DEA+G  D     I G  T+          S   +  G FYE  +K   +    W  
Sbjct: 169 IIIDEAAGVSDEHYEVINGTQTQGGNRTLLA--SQGVKQGGFFYETHHKLNKENGGNWTA 226

Query: 251 FQIDTRTVEGIDPSFHEGII-ARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
               +     +   + E +     G ++   RV V G+F + + ++ +    IE  ++  
Sbjct: 227 LCFSSENSPFVTTEWLENVALQAGGKNTTEYRVRVLGKFAENEHENLLTRAQIEPRIDTL 286

Query: 310 PCPDPYAP----LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFD------WSKTDL 353
           P  +   P    L++     E   D+  +          G     +         +  ++
Sbjct: 287 PIIEKGEPFGWLLLVDVGAGEYRDDSVCIAAKVIGDDDFGENARRVEYEANPIITNTKNI 346

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCR 410
                 I     +     I++DA   G   C  LE  G+ V R+       +    E   
Sbjct: 347 HEFRGLIVEKAAQLSNVRILVDAGGIGLELCKMLENDGFDVERINWGNPCFKRAYKERFF 406

Query: 411 NRRTELHVKMADWLEFASLINH-------SGLIQNLKSLKS-FIVPNTGELAIESK---R 459
           N+R    V+  D +    ++            +     +   F    T    I  K   R
Sbjct: 407 NQRACAMVRWRDAIRQGRVLFPKMENGLREKFLMQASRIPYGFTDTGTARYQIAQKAEMR 466

Query: 460 VKGAKSTDYSDGLMYTFAE 478
            +G KS D +D + + F +
Sbjct: 467 KRGIKSPDIADAMSFAFLD 485


>gi|213156231|ref|YP_002318651.1| phage terminase [Acinetobacter baumannii AB0057]
 gi|301346399|ref|ZP_07227140.1| phage terminase [Acinetobacter baumannii AB056]
 gi|301594275|ref|ZP_07239283.1| phage terminase [Acinetobacter baumannii AB059]
 gi|213055391|gb|ACJ40293.1| phage terminase [Acinetobacter baumannii AB0057]
          Length = 663

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 85/430 (19%), Positives = 152/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                +    +YG  +    ++ V G+FP    +  I     EE        D +    +
Sbjct: 379 SEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYV 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V +A 
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGLAR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   +  G KS D  D   +
Sbjct: 559 AIANGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|332852816|ref|ZP_08434408.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332871045|ref|ZP_08439658.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
 gi|332729027|gb|EGJ60377.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013150]
 gi|332731805|gb|EGJ63085.1| intein splicing region-containing protein [Acinetobacter baumannii
           6013113]
          Length = 663

 Score =  220 bits (559), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 85/430 (19%), Positives = 152/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                +    +YG  +    ++ V G+FP    +  I     EE        D +    +
Sbjct: 379 SEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYV 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V +A 
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGLAR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   +  G KS D  D   +
Sbjct: 559 AIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|260551382|ref|ZP_05825582.1| phage terminase [Acinetobacter sp. RUH2624]
 gi|260405545|gb|EEW99037.1| phage terminase [Acinetobacter sp. RUH2624]
          Length = 663

 Score =  220 bits (559), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 85/430 (19%), Positives = 152/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                +    +YG  +    ++ V G+FP    +  I     EE        D +    +
Sbjct: 379 SEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYV 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVVSKVWGEAQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V +A 
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGLAR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   +  G KS D  D   +
Sbjct: 559 AIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|153806881|ref|ZP_01959549.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
 gi|149131558|gb|EDM22764.1| hypothetical protein BACCAC_01156 [Bacteroides caccae ATCC 43185]
          Length = 513

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 87/489 (17%), Positives = 148/489 (30%), Gaps = 84/489 (17%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP--------- 106
            + +         ++          A+++G   GK  + A   L  M   P         
Sbjct: 27  RDALCARLDREQQAIIESVQHNPMTAVASGTARGKDFVAACASLCFMYLTPRFNEKGVLV 86

Query: 107 -GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
               V   A +  Q+K  +  E+ + +     K  F      +             +  D
Sbjct: 87  GNTKVAMTAPTGRQVKNIMTPEIRRLIRAARTKFPFCCPGRLV----------ADDIRTD 136

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
            + +        +   +++ G H    M +I  EASG  +++   I G L     N   +
Sbjct: 137 YEEWFLTGFKADDNATESWSGFHAANTMFVI-TEASGISEIVYNAIEGNL---QGNSRML 192

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFH------------------- 266
           +  NP   +G  Y       D + +F++ +   E +                        
Sbjct: 193 IVFNPNITTG--YAARAMKSDRFAKFRLSSLNAENVVKKQIVIPGQVDYEWVKDKVINWC 250

Query: 267 --------------EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
                              +    +D+ RV+V G FP+   D  IP   IE A       
Sbjct: 251 SPIQQTDFNEGEGDFNWEGKLYRPNDLFRVKVLGMFPKVSEDVLIPYEWIEIANRNWQEL 310

Query: 313 D-----PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS---KTDLRTTNNKISGLV 364
                 P     +G D+A  G DN+V+  R G  +          + D           +
Sbjct: 311 QASGFIPAKSCKLGVDVAGMGRDNSVLCPRYGNYVPQFDVHQSAGRADHMHVVGMTIPYL 370

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEF-------CRNRRTELH 417
           +K       ID    GA     L    +            D            N R  L+
Sbjct: 371 KKKG-AKAFIDTIGEGAGVYSRLLEEEFTNAFSCKYSEGTDGLHDITGEYEFANMRAYLY 429

Query: 418 VKMADWLE-----FASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYS 469
             + DWL       A+L     L++     K +   + G++ IE K   + +  +S DY 
Sbjct: 430 WALRDWLNPKNGFGAALPPCDQLMEEATETK-WKFLSNGKVIIEPKEDVKKRIKRSPDYM 488

Query: 470 DGLMYTFAE 478
           D L  TF  
Sbjct: 489 DALANTFYP 497


>gi|228924410|ref|ZP_04087639.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228835241|gb|EEM80653.1| hypothetical protein bthur0011_53510 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 293

 Score =  219 bits (558), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 75/284 (26%), Positives = 124/284 (43%), Gaps = 30/284 (10%)

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
             +  NP R SG FY+  N+  D +K  ++ +           E +  +YG  SDV RV 
Sbjct: 1   MFLCGNPTRTSGVFYDSHNRDRDLYKIHKVSSLDSPRTSKDNIEVLKKKYGEGSDVWRVR 60

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           V G+FP+ + D+FIPL I+E+A + +  P     L +G D+A  G D TV+  R G  + 
Sbjct: 61  VLGEFPKAEADAFIPLEIVEQAASCKVEPT-GETLDLGVDVARFGDDETVIAPRIGNKVF 119

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDA-------IIIDANNTGARTCDYLE------ML 390
            L +  K D   T   +  L ++Y           I +D +  G    D L+       L
Sbjct: 120 KLLNHYKQDTMETAGHVLKLAKEYMAKYKQLKRVDIKVDDSGVGGGVTDRLKEVIKSERL 179

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF------------ASLINHSGLIQN 438
            + VY V+   + +D E   N   E    + D LE               + N   +I  
Sbjct: 180 PFKVYPVVNNGKPLDDEHYDNAGAEGWAVVRDLLEENMKAFIQGEEPTMEIPNDEKMISQ 239

Query: 439 LKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
             S + + + + G++A+E K   + +G +S D +D ++  F + 
Sbjct: 240 FSS-RKYRITSRGKIALERKEEMKKRGLQSPDRADAIVLAFYKP 282


>gi|184158505|ref|YP_001846844.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
 gi|183210099|gb|ACC57497.1| hypothetical protein ACICU_02185 [Acinetobacter baumannii ACICU]
          Length = 663

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 84/430 (19%), Positives = 151/430 (35%), Gaps = 41/430 (9%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
              GKT     + LW +       ++  A    QLK  +W E+S  L+ L       +  
Sbjct: 208 HNTGKTASAGIVALWHLLFFDESIMMFTAPQIGQLKKQVWKEISINLARLKQGPLAWLAD 267

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD 205
              +            +    + +    +T  + +P    G+H    M  + DEASG  D
Sbjct: 268 YVGY------QSELVYIKGYKEKWYVFAKTAPKHQPTNLAGNHGDNYMVWV-DEASGVDD 320

Query: 206 VINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDTRTVEGI 261
            +     G LT  +     +MTS P R +G FYE  +K        W     +      +
Sbjct: 321 AVLDVAFGALTHEDNRA--VMTSQPTRNAGMFYETHHKLSHRAGGVWIALTFNGEESPLV 378

Query: 262 DPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYA-PLI 319
                +    +YG  +    ++ V G+FP    +  I     EE        D +    +
Sbjct: 379 SEQSLQEQRQKYGSREDAQYKIRVLGEFPDLSDEFLITKRQTEEMYVGASIFDDHQFGYV 438

Query: 320 MGCDIAEE-GGDNTVVVL-------------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
           +  D+    G D++V+V+             RR  V++     ++ D+     KI+ L+ 
Sbjct: 439 ITVDVGGGVGRDDSVIVVSKVWGESQWGERARRVEVVDIPLCKNRDDILELFAKINELLL 498

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQK---RAVDLEFCRNRRTELHVKMAD 422
           +Y    +++D N  G     YL+  G     V          + +   N+R+  +V +  
Sbjct: 499 QYPNANLVVDDNGAGKGLGQYLKKQGIFYVPVYWGSQCFSNDNRKEFTNKRSLAYVGLQR 558

Query: 423 WLEFASLINHS-----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
            +        +      +   L  +  +   +     I SK   +  G KS D  D   +
Sbjct: 559 AIASGRFKIKTKKHNVKIKDQLIHVP-YRFDDFARYKILSKDEMKRMGIKSPDIGDAFAF 617

Query: 475 TFAENPPRSD 484
            F EN   ++
Sbjct: 618 LFLENVHYTE 627


>gi|111222161|ref|YP_712955.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
 gi|111149693|emb|CAJ61385.1| hypothetical protein FRAAL2741 [Frankia alni ACN14a]
          Length = 535

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 91/465 (19%), Positives = 144/465 (30%), Gaps = 59/465 (12%)

Query: 49  SAPRSWQLEFMEVVDAH-CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
             P  W  + +  V        + N      K A+ +    GK+ + A  V   + T P 
Sbjct: 54  DEPVRWARDRLGGVHLWSKQQEIINALRVHRKVAVPSCHDAGKSFVAAAAVAHWLDTHPP 113

Query: 108 IS--VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
            S   I  A +  Q++  LW E+ +   L+            ++   W  D         
Sbjct: 114 GSAFAITTAPTFPQVRAILWREIRRLSRLM------NPPLGRVNQTEWLID--------- 158

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
                   R  ++     F G H  Y   ++ DEA G P  + +      T  NA    +
Sbjct: 159 -DDLVAFGRKPADHDEGGFQGIHAQYP-LVVLDEAGGIPQQLWIAADSIATNENAR--IL 214

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI--------------DPSFHEGIIA 271
              NP   +  F ++   P   W    I                        ++ E    
Sbjct: 215 AIGNPDDPTSYFAQVCELPS--WHVITIPAAETPAFTGEQIPDDLRQALLSRAWAEEKRR 272

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY---APLIMGCDIAEEG 328
            +G D+ V   +V  QFP+      I  + + +       P P     P+ +G D+ E  
Sbjct: 273 EWGEDNPVYISKVLAQFPKDVAWKVIKASDVAKRRIGRDEPWPASKLRPVCLGVDVGEGR 332

Query: 329 GDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
            D TVV  RRG      +     +       I   V       + IDA   G      L 
Sbjct: 333 -DWTVVRERRGVQAGREWQARTPEPEQAVKLIGQAVLITGAKTVNIDAGGPGWGIAAALR 391

Query: 389 ML-------GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS------LINHSGL 435
                    G  V  +    ++ + E   N R EL   +   L          + N    
Sbjct: 392 GWLKQHKVRGVAVNPIRFGAKSREPEKYLNMRAELWWGVGRLLSEQGGWDLSVMENADDT 451

Query: 436 IQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
              L     +       + IESK   R +  +S D +D L+  FA
Sbjct: 452 TAQLLD-PIWREGAGDRIVIESKEELRKRTGRSPDNADALLLAFA 495


>gi|119386463|ref|YP_917518.1| PBSX family phage terminase large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377058|gb|ABL71822.1| phage terminase, large subunit, PBSX family [Paracoccus
           denitrificans PD1222]
          Length = 441

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 79/423 (18%), Positives = 138/423 (32%), Gaps = 25/423 (5%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T PG+S ICL + +  L  +++                  
Sbjct: 26  GGRGSGKSWDRAMHMIVRHLTEPGLSSICLRDVQKSLDQSVFK-------------LLVE 72

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +  L  A     V    +     +        +E   +               +EA+  
Sbjct: 73  TAARLGVAEAIRPVESDRIIRTPGNGIIAFNGMNEFNAENIKSL--EGFDIAWWEEAATA 130

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPR-RLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                  +   L +  +  ++      R            +  D     + + R      
Sbjct: 131 GQGPLDMLRPTLRKPGSQIWFTYNPRLRSDPVDVMMRQDARFADSRTVVEANWRDNPFRG 190

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGC 322
           P   E  +     D    R    G +  +    FI   ++ EA+ R+P       L++G 
Sbjct: 191 PELEEERLLDLAGDEARYRHIWEGDYEAESDMQFIGGGLVREAMARQPFSQIGDELVLGV 250

Query: 323 DIAEEGGDNTVVVLRRGPVI--EHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           D+A  G D +V+  RRG     E        D      ++   +++  PD + ID    G
Sbjct: 251 DVARFGDDRSVIWARRGRDAQTELPIIMKGADTMAVAARVMAEIDRLHPDGVFIDEGGVG 310

Query: 381 ARTCDYLEMLGYHVYRVLGQKRAVDL----EFCRNRRTELHVKMADWLEFASLINHSGLI 436
               D    +GY V  V    +A         CRN+R ++   M +WL     I  S  +
Sbjct: 311 GGVIDRCRQMGYSVVGVNFGGKADRAIEGVPKCRNKRAQMWATMREWLRSGGCIPDSRDL 370

Query: 437 QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
           +   +   +       + IE K   + +G  S D +D L  TFA       +   +    
Sbjct: 371 EMDLTGPLYSFDVNNAIEIEKKSDMKKRGVSSPDEADALALTFAYPVVPRSIQRQQEARA 430

Query: 494 QYE 496
           Q +
Sbjct: 431 QED 433


>gi|134287454|ref|YP_001109621.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
 gi|134131876|gb|ABO60570.1| hypothetical protein Bcep1808_7700 [Burkholderia vietnamiensis G4]
          Length = 509

 Score =  212 bits (540), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 84/456 (18%), Positives = 155/456 (33%), Gaps = 47/456 (10%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           ++    H +   ++ + +  + ++S+G G GKT+  A + LW +      + I  A   +
Sbjct: 34  LKAPTHHQIQMFDSVSKQGSRTSVSSGHGTGKTSGFAIIALWHLLCYYLSNTILTAPKIS 93

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
            +   +W E +   + + N         S     +  +     +     ++  + ++   
Sbjct: 94  TVSDGVWKEFADLSTKISNGPQ------SWIWEYFVIESERVYVRGYKLNWFVIAKSAPR 147

Query: 179 ERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFY 238
             P+   G H  + +  + DEASG PD     I G LT+          S P R SG FY
Sbjct: 148 GSPENLAGAHRDW-LLWLADEASGIPDDNFGVITGSLTDERNRMCLA--SQPTRSSGFFY 204

Query: 239 EIFNKPL----DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
           E  +         W     ++     +   F      +Y  +    +++V G+FP+    
Sbjct: 205 ETHHALSRAEGGPWNNLVFNSEFSPIVSAKFIAEKKLQYTEEE--YQIKVQGRFPENSSK 262

Query: 295 SFIPLNIIEEALNRE-PCPDPYAPLIMGCDIAEEG-GDNTV-------------VVLRRG 339
             +    IE  + R    PD +   ++  D+   G  D TV             +  RR 
Sbjct: 263 YLVGPQAIEACVGRTVIKPDEHWGWLLPVDVGGGGWRDETVMPALHVIGRGEYGMDARRA 322

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLG 399
            +I      +  D    +  I     +      +IDA   G   C  L++ G+  YR + 
Sbjct: 323 QLISVPLHSNTQDPAQLHGVIVHAARERSNATAMIDAGGMGLIVCKQLDLDGFSQYRKVN 382

Query: 400 QKRAV----DLEFCRNRRTELHVKMADWLEFASL-INHS-------GLIQNLKSLKSFIV 447
                      +   N+R +     A  +      IN          L++    +  F  
Sbjct: 383 WGNPNFAKEYKDRYVNQRAQACCGFARAITEGRFGINPDVPKSFVKKLVKQGSRIPYFWD 442

Query: 448 PNTGELAIESK----RVKGAKSTDYSDGLMYTFAEN 479
                  I  K      +   S D  D L + F E+
Sbjct: 443 EKARR-QIMKKEDMREKENLPSPDVFDALSFAFLED 477


>gi|68250076|ref|YP_249188.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058275|gb|AAX88528.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 447

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 69/441 (15%), Positives = 149/441 (33%), Gaps = 59/441 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  +++F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLQNFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIECAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNDNAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL--- 424
           A    + + L     V                     + +   N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 425 ----EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
               +   +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKHGDVYPDDELISLSSNIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMD 486
            + +D L+  +A   P+S +D
Sbjct: 426 PNMADALVMCYATTKPKSLLD 446


>gi|260580755|ref|ZP_05848581.1| phage terminase large subunit [Haemophilus influenzae RdAW]
 gi|260092572|gb|EEW76509.1| phage terminase large subunit [Haemophilus influenzae RdAW]
          Length = 447

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 69/441 (15%), Positives = 149/441 (33%), Gaps = 59/441 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLSLQAFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL--- 424
           A    + + L     V                     + +   N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 425 ----EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
               ++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMD 486
            + +D L+  +A   P+S +D
Sbjct: 426 PNMADALVMCYAPTKPKSLLD 446


>gi|189460514|ref|ZP_03009299.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
 gi|189432758|gb|EDV01743.1| hypothetical protein BACCOP_01155 [Bacteroides coprocola DSM 17136]
          Length = 556

 Score =  209 bits (532), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 88/499 (17%), Positives = 159/499 (31%), Gaps = 93/499 (18%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP--------- 106
            E + V        + +      + ++++G   GK  + A   +  +   P         
Sbjct: 57  REALGVTLDKEQQEILSSVQYNRRTSVASGTARGKDFVAACAAICFLYLTPRWRKNSLGE 116

Query: 107 -----GISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS 161
                   V   A ++ Q+K  +  E+S+  +    +    +  L+ +            
Sbjct: 117 IELVENTKVALTAPTDRQVKNIMMPEISRLFNRAKARGVELIGKLNAY-----------D 165

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN 221
           +  ++  +        E   + + G H  + M ++  EA+G  D     I G L + ++ 
Sbjct: 166 IRTNNDEWFLTGFKADEHNHEAWSGFHAVHTMFVV-TEATGIGDDTFAAIEGNL-QGDSR 223

Query: 222 RFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFH--------------- 266
              +   N        Y   ++  D W ++++++ T   I                    
Sbjct: 224 ILLVFNPNKT----VGYAAKSQKGDRWHKYRLNSLTAPNIASKKIIIPGQVDYDWVLDKL 279

Query: 267 EGIIA------------------RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
           E                      ++    D+ R +V G FP+ D D+ IP   +EEA  R
Sbjct: 280 ENWCEKISPDEIISEMDDFEFEGQWYRPEDLFRKKVLGLFPKVDEDTLIPRQWLEEAHER 339

Query: 309 EPCPDPYAPL-----IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK---TDLRTTNNKI 360
                   PL     I+G D+A  G D T  VLRR   +      +     D      KI
Sbjct: 340 WKQAKGREPLRADLNILGVDVAGMGRDATCYVLRRDNWVASFDTHNSGGVADHMKVAGKI 399

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDY---LEMLGYHVYRVLGQKRAVDL----------- 406
                +     + ID    GA        LE   +++      + A              
Sbjct: 400 MVARRQNIGLYVSIDTIGEGAGVYSRCVELEDEPHYILSCKYSESAKTPNGRELSDITGQ 459

Query: 407 EFCRNRRTELHVKMADWL----EFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---R 459
               N R  L   + DWL       +++          +   F V + G+L IE K   +
Sbjct: 460 NKFFNMRAYLFWAVRDWLNPRNNTGAMLPPDDKFDEEATEIKFSVKSNGKLYIEPKEDIK 519

Query: 460 VKGAKSTDYSDGLMYTFAE 478
            +  +S D  D L  TF  
Sbjct: 520 ERLGRSPDKFDALANTFYP 538


>gi|329119006|ref|ZP_08247700.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464879|gb|EGF11170.1| phage terminase large subunit [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 449

 Score =  209 bits (531), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 64/433 (14%), Positives = 122/433 (28%), Gaps = 56/433 (12%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L + +   R G  ++C    +  L  +++            +   E 
Sbjct: 20  GGRGSGKSYFLAELAVEVA-RRIGTVILCAREFQGSLDDSVY------------QLLTET 66

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +   +   +               +       +  +  +  G           +EA   
Sbjct: 67  IARLGYTQEFEILKSSIRHKGTGAKFVFYGVKNNITKIKSIQGV-----GICWVEEAEAV 121

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI-D 262
                  ++  +        W+  +    L   +      P  D    + +        D
Sbjct: 122 TKNSWDVLIPSIRGDKNAEIWVSFNPKNILDDTYQRFIVHPPKDSIVLKANYDINPHFAD 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
                 ++     D D+ R    G+       + I  + IE A++             I+
Sbjct: 182 TPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAAIDAHEKLGFSAAGRRIL 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D    VLR G V+  +  W   D+  + +K+    ++   D I+ D    G
Sbjct: 242 GFDVADEGDDANATVLRHGSVVTDMQQWRGQDVIYSADKVYLYAQEQNVDRIVYDNIGVG 301

Query: 381 ARTCDYLEMLGYHVYRVLGQKRA-------------VDLEFCRNRRTELHVKMADWL--- 424
           A            V  +                    + +   N + +    + D     
Sbjct: 302 AGVKAQFRRKNGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFANIKAQAWWMVRDRFYKT 361

Query: 425 ----EFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESK---RVKGAKS 465
                         LI                S         G +  ESK   + +G  S
Sbjct: 362 WRAVHHGDSYPEDQLISLSSSLHELEYLTAELSRPQVDYDQNGRVKAESKKDMKKRGIPS 421

Query: 466 TDYSDGLMYTFAE 478
            + +D L+  FA 
Sbjct: 422 PNRADALVMVFAP 434


>gi|145629503|ref|ZP_01785301.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145641440|ref|ZP_01797019.1| predicted phage terminase large subunit [Haemophilus influenzae
           R3021]
 gi|144978346|gb|EDJ88110.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145273983|gb|EDK13850.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.4-21]
 gi|309750959|gb|ADO80943.1| Probable bacteriophage terminase, large subunit [Haemophilus
           influenzae R2866]
          Length = 447

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 69/441 (15%), Positives = 148/441 (33%), Gaps = 59/441 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQVEMLGLQDFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL--- 424
           A    + + L     V                     + +   N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 425 ----EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
               ++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMD 486
            + +D L+  +A   P+S +D
Sbjct: 426 PNMADALVMCYAPTKPKSLLD 446


>gi|301170180|emb|CBW29784.1| predicted phage terminase large subunit [Haemophilus influenzae
           10810]
          Length = 447

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 67/441 (15%), Positives = 147/441 (33%), Gaps = 59/441 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQVEMLGLQDFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +  +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IEQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W    +  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGYVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL--- 424
           A    + + L     V                     + +   N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 425 ----EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
               ++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMD 486
            + +D L+  +A   P+S +D
Sbjct: 426 PNMADALVMCYAPTKPKSLLD 446


>gi|309379923|emb|CBX21334.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 449

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 66/450 (14%), Positives = 127/450 (28%), Gaps = 57/450 (12%)

Query: 68  NSVNNPNPEVFKGAIS-AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
           N    P     +  +   GRG GK+   A L +  +S R G  ++C    +  L  +++ 
Sbjct: 3   NPYFKPLIRKARYKVLYGGRGSGKSYFLAELAV-EVSRRIGTVILCAREFQGSLDDSVY- 60

Query: 127 EVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
                      +   E      +   +       +       +       +  +  +  G
Sbjct: 61  -----------QLLIETIERLGYTEEFDILKSTITHKGTGAKFVFYGIKNNVTKIKSIQG 109

Query: 187 HHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
                      +EA          ++  +        W+  +    L   +      P  
Sbjct: 110 V-----GVCWVEEAEAVTKNSWDVLIPSIRGDKNAEIWVSFNPKNILDDTYRRFIVHPPQ 164

Query: 247 DWKRFQIDTRTVEGI-DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
           D    + +        D      ++     D D+ R    G+       + I  + IE A
Sbjct: 165 DSIVLKANYDINPHFADTPLLADMLECKERDEDLYRHIWLGEPVADSELAIIKPSWIEAA 224

Query: 306 LNREPCP--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL 363
           ++             I+G D+A+EG D    VLR G V+  +  W   D+  + +K+   
Sbjct: 225 IDAHEKLGFQAAGKRILGFDVADEGDDANATVLRHGSVVTDMRQWRGQDVIYSADKVYLY 284

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRA-------------VDLEFCR 410
            ++   D I+ D    GA            V  +                    + +   
Sbjct: 285 AQEQDIDRIVYDNIGVGAGVKAQFRRKRGKVQTLGFNAGGAVYKPDAKYTDDKKNRDMFA 344

Query: 411 NRRTELHVKMADWL-------EFASLINHSGLIQ------------NLKSLKSFIVPNTG 451
           N + +    + D                   L+                S         G
Sbjct: 345 NIKAQAWWMVRDRFYKTWRAVHHGDSYPEDQLVSLSSSLHELEYLTAELSRPQVDYDQNG 404

Query: 452 ELAIESK---RVKGAKSTDYSDGLMYTFAE 478
            +  ESK   + +G  S + +D L+  FA 
Sbjct: 405 RVKAESKKDMKKRGIPSPNRADALVMAFAP 434


>gi|319776448|ref|YP_004138936.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319897217|ref|YP_004135412.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|329123931|ref|ZP_08252483.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|317432721|emb|CBY81084.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317451039|emb|CBY87270.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
 gi|327468126|gb|EGF13613.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 447

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 69/441 (15%), Positives = 148/441 (33%), Gaps = 59/441 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL--- 424
           A    + + L     V                     + +   N + +    + D     
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYKT 365

Query: 425 ----EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
               ++  +     LI            +   S       N G + +ESK   + +G  S
Sbjct: 366 YRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPS 425

Query: 466 TDYSDGLMYTFAENPPRSDMD 486
            + +D L+  +A   P+S +D
Sbjct: 426 PNMADALVMCYAPTKPKSLLD 446


>gi|159897183|ref|YP_001543430.1| hypothetical protein Haur_0654 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890222|gb|ABX03302.1| conserved hypothetical protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 472

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 88/490 (17%), Positives = 151/490 (30%), Gaps = 82/490 (16%)

Query: 45  LEGFSAPRSWQLEFMEVVDAHCLNSVNNPN-PEVFKGAISAGRGIGKTTLNAWLVLWLMS 103
           L     P ++  E +  V       +        ++  + A   +GKT L   LV W   
Sbjct: 2   LPYAHDPVAYAREVLGEVWWTKQELIARSLLTPPYRTLVKACHKVGKTHLGGGLVNWWYD 61

Query: 104 TRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
           +     V+  A ++ Q++  LW EV                         ++      L 
Sbjct: 62  SFDPGLVLTTAPTDRQVRDLLWKEVRMQRRG----------------RAGFTGPKSPRLE 105

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
               H+      ++ +  D+F GHH+ +    I DEA G   V          E  A   
Sbjct: 106 STPDHF---AHGFTAKDGDSFQGHHSPH-TLFIFDEAVGVASVFWETAESMFNEGGA--- 158

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI---------------------- 261
           W+   NP   S + Y    +    W    +       I                      
Sbjct: 159 WLAIFNPTDTSSQAY--AEELSGGWHVISMSVLEHPNILAELQGLPPPFPSAIRLSRVDT 216

Query: 262 ---------DPSFHEG-----IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN 307
                     P   +          +     +    + G++P Q  ++       + A  
Sbjct: 217 LLKKWCRALSPEEPKRATDIHWRDAWYRPGPIAEARLLGRWPSQATNNVWSDGAFQVA-E 275

Query: 308 REPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY 367
               P    P  +GCD+A  G D T + +RRG    +    +      T  ++  L  +Y
Sbjct: 276 SLLLPASDEPCELGCDVARYGDDFTEIHVRRGGHSLYHEAANGWSTVETAGRLKQLANEY 335

Query: 368 RPDAII--------IDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
                +        ID +  G    D  +  GY    V G + A D E   NRR+EL   
Sbjct: 336 GRRCGVDGRAVAVKIDDDGIGGGVVDLAD--GYTFLGVSGARTAYDPEKYPNRRSELWFS 393

Query: 420 MADWLEFASLIN---HSGLIQNL---KSLKSFIVPNTGELAIESK---RVKGAKSTDYSD 470
           +A+      L      +   + L       ++   + G   +E K   + +  +S D  D
Sbjct: 394 VAERAMEQRLSFVALDAETRRELRRQAMAPTWKQDSQGRRVVEPKADTKKRIKRSPDGMD 453

Query: 471 GLMYTFAENP 480
            +   +A  P
Sbjct: 454 AVNLAYAPAP 463


>gi|229844502|ref|ZP_04464642.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
 gi|229812751|gb|EEP48440.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
          Length = 452

 Score =  207 bits (527), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 64/434 (14%), Positives = 144/434 (33%), Gaps = 60/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T+P I V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
               E ++     D ++ R    G+         I    I+ A++             I+
Sbjct: 186 KELMEDMVQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWHGEDVIGSADRTRLNALEFGTNEIVYDSIGVG 305

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +   ++ D    
Sbjct: 306 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWRLRDRFYK 365

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 366 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 425

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 426 SPNKADALVMCFAP 439


>gi|329122215|ref|ZP_08250807.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|327474100|gb|EGF19511.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 452

 Score =  207 bits (525), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 64/434 (14%), Positives = 143/434 (32%), Gaps = 60/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++    T+P I V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYTQP-IRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDVLIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
               E +      D ++ R    G+         I    I+ A++             I+
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDKVIIKPLWIDAAVDAHKKLGFVAAGRKII 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D        G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 246 GFDVADEGSDANANAFVHGSVVLRMDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGVG 305

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +   ++ D    
Sbjct: 306 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDVEYVYGKTNRDMFANIKAQAWWRLRDRFYK 365

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 366 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 425

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 426 SPNKADALVMCFAP 439


>gi|282880015|ref|ZP_06288737.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
 gi|281306129|gb|EFA98167.1| hypothetical protein HMPREF9019_0946 [Prevotella timonensis CRIS
           5C-B1]
          Length = 459

 Score =  207 bits (525), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 83/466 (17%), Positives = 155/466 (33%), Gaps = 89/466 (19%)

Query: 80  GAISAGRGIGKTTLNAWLVLWLMSTRP----------GISVICLANSETQLKTTLWAEVS 129
            A+++G   GK  + A   +  M   P             +   A +  Q    +  EV+
Sbjct: 2   VAVASGTSRGKDFVAACAAMCFMYLTPRWNINHRLIQNTKIAMTAPTGRQCINIMIPEVA 61

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           +            +                  +  ++  +       S++  + + G H 
Sbjct: 62  RLFRNASVLPGRMLSDG---------------IRTNNAEWFLTAFKASDDNTEAWSGFHA 106

Query: 190 TYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
              M ++  EASG  +     I G L     N   ++  NP   +G  Y         +K
Sbjct: 107 VNTMFVV-TEASGVSETTFNAIEGNL---QGNSRLLLVFNPNVTTG--YAAKAMKSSRFK 160

Query: 250 RFQIDTRTVEGI-----------DPSFHEGIIARY----------------------GLD 276
           +F++++   E +           D  + +  +  +                         
Sbjct: 161 KFRLNSLNAENVIKKKNVIPGQVDYEWVKDKVHNWCELIQKEDFNNGEGDFMFEDSFYRP 220

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL-----IMGCDIAEEGGDN 331
           +D+ R++V G FP+   D+ IP   +E A +R    +    +      +G D+A  G D+
Sbjct: 221 NDLFRIKVLGLFPKASEDTLIPFEWLELAHDRWKKLNAEDFVPRKYARVGIDVAGMGRDS 280

Query: 332 TVVVLRRGPVIEHLFDWS---KTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +  VLR G  +  +       K D      +    + +     ++ID    GA     L 
Sbjct: 281 SCFVLRYGNYVPEIKIHQSGGKADHMKVAGEAVQWLVEKN-TKVMIDTIGEGAGVYSRLL 339

Query: 389 MLGY-HVYRVLGQKRAVDLE------FCRNRRTELHVKMADWLE-----FASLINHSGLI 436
            LGY + Y     +    L          N R   +  + DWL        +L     L 
Sbjct: 340 ELGYDNAYSCKFSEGTKGLHDITGQYEFANMRAYCYWAVRDWLNPKNGFNPALPPCDELD 399

Query: 437 QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
             L  +  +   ++G + IE K   + +  +S D +D L+ TF  N
Sbjct: 400 AELTEV-HWSFQSSGSIIIEPKENIKSRLKRSPDRADALISTFYPN 444


>gi|257459276|ref|ZP_05624390.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
 gi|257443289|gb|EEV18418.1| phosphatase, Ppx/GppA family [Campylobacter gracilis RM3268]
          Length = 431

 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/434 (19%), Positives = 145/434 (33%), Gaps = 35/434 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E    +             +     I  GR  G T   A   +  +    G  ++ +   
Sbjct: 3   ELALDLRYTPQQKAVFFQNDARFCTIEKGRRFGFTKGTANACIEWLL--EGQKILWVDTI 60

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
              LK          L  LP + W                    +     K         
Sbjct: 61  AANLKRYFERYFLPELRQLPKELW--------------------NWNAQDKQLKICGGYL 100

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGT---PDVINLGILGFLTE-RNANRFWIMTSNPRR 232
                +            +I +EA      P + +  I   L +  N+  F       + 
Sbjct: 101 DFRSAERPENIEGFGYDTVILNEAGIILKDPYLWDNAISPMLLDNPNSRAFIGGVPKGKN 160

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQ 291
                 +   +    W+ FQ  +     +     + ++A  G  DSDV R E+ G+F   
Sbjct: 161 KFFDLAQRGMRNEKGWRNFQFSSYDNPLLQKEEIDRLVAELGGADSDVARQEIFGEFLDT 220

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT 351
             +S   L  IE A  ++   D  AP+I   D+A EG D +V+  R+G  +E L  +   
Sbjct: 221 TSNSVFSLAAIEAAFRKQRYFDAGAPVIWALDVAREGDDESVLCKRQGDSVEPLKPYRIA 280

Query: 352 DLRTTNNKISGLVEK--YRPDAIIIDANNTGARTCDYLEMLGYH--VYRVLGQKRAVDLE 407
                  +I G  E+   +P AI ID    GA   D L  LG    V    G  +A D  
Sbjct: 281 STSELAREIYGEYERTDLKPHAIYIDTIGVGAGVFDTLCDLGLRGIVREAKGSFKASDER 340

Query: 408 FCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
              N+R E++  + + L   ++     L + L+++  +         +  K   + +  +
Sbjct: 341 KYANKRAEMYFNLREKLPLLAIAPDEELKRQLQTIAFY-FDKKERYLLMPKEGIKKEYGR 399

Query: 465 STDYSDGLMYTFAE 478
           S D +D L  +F +
Sbjct: 400 SPDRADALAMSFFD 413


>gi|298387330|ref|ZP_06996883.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259999|gb|EFI02870.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 500

 Score =  205 bits (521), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 95/493 (19%), Positives = 156/493 (31%), Gaps = 90/493 (18%)

Query: 53  SWQL---EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI- 108
            W     + +         +V     +    A+++G   GK  + A   L  M   P   
Sbjct: 15  DWCAFASDVLRANLDEEQKAVLRSVQKNPMTALASGTSRGKDFVAACAALCFMYLTPEWD 74

Query: 109 ---------SVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLH 159
                     +   A S+ Q++  +  EV +            +                
Sbjct: 75  DDGNLIRNTKIALSAPSQRQVENIMTPEVRRLFRNAGILPGRLV---------------A 119

Query: 160 CSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERN 219
             +  D + Y         +  + + G H    M +I  EASG  + I   I G L    
Sbjct: 120 NDIRTDYEEYFLTGFKADNKNQEVWSGFHAANVMFVI-TEASGVSETIFSAIEGNL---Q 175

Query: 220 ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP-----------SFHEG 268
            N   ++  NP   +G  Y       D + +F++D+     +              + E 
Sbjct: 176 GNSRLLLVFNPNITTG--YAANAMKSDRFAKFRLDSLNATNVTAKREIIPGQVNYEWVED 233

Query: 269 IIARY----------------------GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
            +  +                         +D+ R++V G FP+   D  IP   IE A 
Sbjct: 234 KVKHWCTPITKEEYNEGEGDFLFENNLYRPNDLFRIKVRGMFPKVAEDVLIPYEWIEIAN 293

Query: 307 NREPCPDPYAP---LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWS---KTDLRTTNNKI 360
            R     PY P     +G D+A  G DN+V   R G  +     +    K        K 
Sbjct: 294 KRWQENHPYRPRKSCKLGVDVAGMGRDNSVFCPRYGNYVSQFDVFQSAGKASHMHVVGKA 353

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGY-HVYRVLGQKRAVDLE------FCRNRR 413
               ++   D I ID    GA     L   G  +++ V   + A  L          N R
Sbjct: 354 LS-YKRTDRDIIFIDTIGEGAGVYSRLVEQGIRNIFSVKNSQGAKGLHDITGEYSFANMR 412

Query: 414 TELHVKMADWLEFA-----SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKS 465
             L+  + DWL+        L       +     K +   + G++ IE K   + +  +S
Sbjct: 413 AYLYWALRDWLDPKNNFFPMLPPCDQFTEEATETK-WKFRSDGKILIEPKEEIKKRIKRS 471

Query: 466 TDYSDGLMYTFAE 478
            DY D L  TF  
Sbjct: 472 PDYMDALSETFYP 484


>gi|145629819|ref|ZP_01785613.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148827544|ref|YP_001292297.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
 gi|144977965|gb|EDJ87753.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148718786|gb|ABQ99913.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
          Length = 449

 Score =  202 bits (514), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 60/434 (13%), Positives = 135/434 (31%), Gaps = 59/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++ +   R  + V C    +  +  ++   ++  +  L        
Sbjct: 23  GGRGSGKSWGVAQLLVEIAV-RTKVRVFCGRELQNSMSDSVIKLIADTIEDL-------- 73

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                +   +               +       +  +  +  G        +  +EA   
Sbjct: 74  ----GYLEEFEVQRNAIYCLKTGSEFMFYGIKNNPNKIKSLEGI-----DLVWIEEAENV 124

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
            +     ++  + +  +  +  +T NP+ +    Y+ F   P  +    +I+        
Sbjct: 125 SNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKINYDENPYFP 182

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
            +    +      D ++ R    G+         I    IE A++        P    I+
Sbjct: 183 ETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKIV 242

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 243 GFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRTRLNALEFGANEIVYDSIGVG 302

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +    + D    
Sbjct: 303 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFYK 362

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 363 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 422

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 423 SPNKADALVMCFAP 436


>gi|68249883|ref|YP_248995.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058082|gb|AAX88335.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 438

 Score =  202 bits (514), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 60/434 (13%), Positives = 136/434 (31%), Gaps = 59/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++ +   R  + V C    +  +  ++   ++  +  L        
Sbjct: 12  GGRGSGKSWGVAQLLIEIAV-RTKVRVFCGRELQNSMSDSVIKLIADTIEDL-------- 62

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                +   +               +       +  +  +  G        +  +EA   
Sbjct: 63  ----GYLEEFEVQRNAIYCLKTGSEFMFYGIKNNPNKIKSLEGI-----DLVWIEEAENV 113

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
            +     ++  + +  +  +  +T NP+ +    Y+ F   P  +    +I+        
Sbjct: 114 SNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKINYDENPYFP 171

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
            +    +      D ++ R    G+         I    IE A++        P    I+
Sbjct: 172 ETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKIV 231

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 232 GFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGVG 291

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +   ++ D    
Sbjct: 292 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWRLRDRFYK 351

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 352 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 411

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 412 SPNKADALVMCFAP 425


>gi|260583110|ref|ZP_05850891.1| phage terminase large subunit [Haemophilus influenzae NT127]
 gi|260093822|gb|EEW77729.1| phage terminase large subunit [Haemophilus influenzae NT127]
          Length = 445

 Score =  202 bits (514), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 60/434 (13%), Positives = 135/434 (31%), Gaps = 59/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++ +   R  + V C    +  +  ++   ++  +  L        
Sbjct: 19  GGRGSGKSWGVAQLLVEIAV-RTKVRVFCGRELQNSMSDSVIKLIADTIEDL-------- 69

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                +   +               +       +  +  +  G        +  +EA   
Sbjct: 70  ----GYLEEFEVQRNAIYCLKTGSEFMFYGIKNNPNKIKSLEGI-----DLVWIEEAENV 120

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
            +     ++  + +  +  +  +T NP+ +    Y+ F   P  +    +I+        
Sbjct: 121 SNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKINYDENPYFP 178

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
            +    +      D ++ R    G+         I    IE A++        P    I+
Sbjct: 179 ETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKIV 238

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 239 GFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRTRLNALEFGANEIVYDSIGVG 298

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +    + D    
Sbjct: 299 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFYK 358

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 359 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 418

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 419 SPNKADALVMCFAP 432


>gi|226227228|ref|YP_002761334.1| hypothetical protein GAU_1822 [Gemmatimonas aurantiaca T-27]
 gi|226090419|dbj|BAH38864.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 549

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/470 (18%), Positives = 160/470 (34%), Gaps = 67/470 (14%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFK-------GAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
             +    H  +   +P   V +        A+++G G GKT L A L+LW ++  P    
Sbjct: 41  LFDAYGTHEWDGTPDPLATVLEAIAKNQWVAVASGTGTGKTFLEAVLLLWWIAVEPDSIA 100

Query: 111 ICLANSETQLKTTLWAEVSK-WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
             +A    Q +  +W EV++ W          E+ +L +   PW  D             
Sbjct: 101 TTVATKADQQEKGIWREVARHWPRFQACFPEAELTTLRIRMEPWRGDAW-------GAWG 153

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
            T      EE      G H    + ++ DE  G P  +   ++   T            N
Sbjct: 154 ITAAPKAGEESSSAVQGLHAKRLLILV-DETPGVPQPVMTALVNTAT--GEENVIAAFGN 210

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI-----------DPSFHEGIIARYGLDSD 278
           P   +    +            +I       +                     +YG++S 
Sbjct: 211 PDYQADPLGQF--AETKRVTAIRISALDHPNVVLGVERIPGAATRLSIATREDKYGVESG 268

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY----APLIMGCDIAEEGG-DNTV 333
           V +  V G  P+Q   + I L     A +R            P  +G D+A+    D   
Sbjct: 269 VYQSRVRGIAPEQSASALIHLAWCVAAADRAESVQHAALALGPKALGVDVAQSENGDKAA 328

Query: 334 VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAIIIDANNTGARTCDYLEM-- 389
           V + +G  +  +   +  +      ++  L+      P+ + +D    GA T ++L+   
Sbjct: 329 VAMGQGARLLSVIAKACPNATKLGAEVWQLMRDEGIVPEYVGVDPIGVGAATVNHLDGEC 388

Query: 390 ----LGYHVYRVLGQKRAV----------------DLEFCRNRRTELHVKMADWLEFA-- 427
                G  V R  G  +A+                D    +N R ++  ++ + L     
Sbjct: 389 EKENAGRSVVRCSGGAKAMEASSRAADGSAMEWLADANKFKNLRAQMWWQLREDLRNGLI 448

Query: 428 SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
           +L     L + L +++     + G + +ESK   R +  +S D +D ++Y
Sbjct: 449 ALPRDRELFRELTTVQF--DEDGGIVTLESKDDIRKRLGRSPDRADAVVY 496


>gi|261381054|ref|ZP_05985627.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
 gi|284796087|gb|EFC51434.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
          Length = 450

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/436 (15%), Positives = 135/436 (30%), Gaps = 58/436 (13%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           ++  GRG  K+   A +++ L   R G   I  A            E+   +S       
Sbjct: 20  SLRGGRGGMKSWAVATVLVELA--RKGRFRIMCA-----------RELQNSISDSVISLL 66

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
            +    + +   +               +       +  +  +              +EA
Sbjct: 67  SDTIDRAGYTQEYEVQRNRIIHLSTGSEFLFYGIKNNPTKIKSIEAI-----DICWIEEA 121

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVE 259
               D     ++  + +  +  +   T NP+ +    Y+ F     D      ++     
Sbjct: 122 ENVSDESWNILIPTIRKAGSEIWL--TWNPKNILDPTYQRFVVNPPDDMVDIVVNYTDNI 179

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAP 317
            +         +    D D+ R    G+       S I    I+ A++       +    
Sbjct: 180 YLPEVLRLEAESCKARDYDLYRHIWLGEPVADSELSVIKPKWIDAAIDSHIKLGFEATGQ 239

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDAN 377
            I+G D+A+EG D +  +LR G V+  + +W   D+  + +K+    ++ + D I+ D+ 
Sbjct: 240 RILGFDVADEGDDASATILRHGSVVIDMDEWRGQDVIYSADKVYLYGQEAKADKIVYDSI 299

Query: 378 NTGARTCDYLEMLGYHVYRVLGQKRAV-------------DLEFCRNRRTELHVKMAD-- 422
             GA            V  +                    + +   N + +    + +  
Sbjct: 300 GVGAGVKAQFRRKTGKVQTIGFNAGGSVFKPEARYTDDKKNKDMFSNIKAQAWWMVRERF 359

Query: 423 -----WLEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESKR---VKG 462
                 +EF        LI            +   S       N G + +ESK+    +G
Sbjct: 360 YKTWRAIEFGDTYPIDELISISGSLKDLEYLKAELSRPRVDYDNNGRVKVESKKDMAKRG 419

Query: 463 AKSTDYSDGLMYTFAE 478
             S + +D L+  FA 
Sbjct: 420 IPSPNRADALIMAFAP 435


>gi|319775727|ref|YP_004138215.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319896735|ref|YP_004134928.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|317432237|emb|CBY80589.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317450318|emb|CBY86534.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
          Length = 449

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 60/434 (13%), Positives = 135/434 (31%), Gaps = 59/434 (13%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A L++ +   R  + V C    +  +  ++   ++  +  L        
Sbjct: 23  GGRGSGKSWGVAQLLVEIAV-RTKVRVFCGRELQNSMSDSVIKLIADTIEDL-------- 73

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                +   +               +       +  +  +  G        +  +EA   
Sbjct: 74  ----GYLEDFEVQRNAIYCLKTGSEFMFYGIKNNPNKIKSLEGI-----DLVWIEEAENV 124

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
            +     ++  + +  +  +  +T NP+ +    Y+ F   P  +    +I+        
Sbjct: 125 SNESWDILIPTIRKERSEIW--VTFNPKNILDPTYQRFVIAPPKNSFVRKINYDENPYFP 182

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIM 320
            +    +      D ++ R    G+         I    IE A++        P    I+
Sbjct: 183 ETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECAVDAHKKLGFLPAGRKIV 242

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A++G D+       G V+  + +W   D+  + ++      ++  + I+ D+   G
Sbjct: 243 GFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADRTRLNALEFGANEIVYDSIGVG 302

Query: 381 ART---CDYLEMLGYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL-- 424
           A        L+     +                     + +   N + +    + D    
Sbjct: 303 AGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKTNRDMFANIKAQAWWCLRDRFYK 362

Query: 425 --------------EFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAK 464
                         E  SL   I     ++   +         G + +ESK   + +G  
Sbjct: 363 TYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPYVDYDGNGRVKVESKKDMKKRGIP 422

Query: 465 STDYSDGLMYTFAE 478
           S + +D L+  FA 
Sbjct: 423 SPNKADALIMCFAP 436


>gi|303257560|ref|ZP_07343572.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
 gi|302859530|gb|EFL82609.1| putative terminase B protein [Burkholderiales bacterium 1_1_47]
          Length = 330

 Score =  196 bits (497), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 73/299 (24%), Positives = 115/299 (38%), Gaps = 13/299 (4%)

Query: 195 IINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI----FNKPLDDWK 249
           ++ DE +   P +    I   L +R     +I T     L  + Y+      +K   DW 
Sbjct: 6   VVIDEVAQIKPTLWGEVIRPALADRKGWAAFIGTPKGINLFSQLYDQALNLMSKGDPDWI 65

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
                      ID      +      +    R E    F     +  IP++ I  A N+ 
Sbjct: 66  AMLYSVEQTHVIDEKELAALKVEMSENE--FRQEFLCDFSAAQDNGLIPIDDIRAAANKF 123

Query: 310 PCPDP--YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY 367
                   APLI G D+A  G D +V+  RRG V        K D     ++I+  + K 
Sbjct: 124 YRESEYMGAPLIYGIDVARFGSDASVIFKRRGLVAFEPIVIRKFDNMALADRIAVEMAKE 183

Query: 368 RPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFA 427
           +PDA+ ID+   G    D L  + + V  V    +A+D E   NRR E+   MA W++  
Sbjct: 184 KPDAVFIDS-GAGQGVIDRLRQMRFDVVEVPFGAQAIDKEQFANRRMEMWWHMAQWIKQG 242

Query: 428 SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRS 483
             I    ++Q      ++     G   +E+K   + +  +S D +D L  TFA      
Sbjct: 243 GAIPPDPVLQGDLGAPTYGYTPKGPKILEAKDKLKERIGRSPDLADALALTFAAPVAPK 301


>gi|154175204|ref|YP_001409090.1| Ppx/GppA family phosphatase [Campylobacter curvus 525.92]
 gi|112803006|gb|EAU00350.1| phosphatase, Ppx/GppA family [Campylobacter curvus 525.92]
          Length = 433

 Score =  195 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/461 (18%), Positives = 156/461 (33%), Gaps = 58/461 (12%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI- 111
            WQ E           +            I  GR  G T   A   +  +    G  ++ 
Sbjct: 12  DWQREVF-------FKNKAKF------TTIEKGRRSGFTKGMANACIEWLI--EGKKILW 56

Query: 112 ---CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
                AN +   +     E+ +  + +                 W        L +   +
Sbjct: 57  VDTVTANLQRYFERYFVPELKQLPADM-----------------WKFHAQDKKLTVGEGY 99

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT---PDVINLGILGFLTE-RNANRFW 224
                        +            +I +EA        + +  I   L +  N+  F 
Sbjct: 100 L-------DMRSAERPENIEGFGYDVVILNEAGIILKNSYLWDNAIRPMLLDYPNSRAFI 152

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVE 283
                 +           +   DW  FQI +     +     + +IA  G +DSDV + E
Sbjct: 153 GGVPKGKNRFFDLASRGMRNEKDWVNFQISSFENPLLRKEEIDELIAELGGVDSDVVKQE 212

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIE 343
           + G+F     ++  PL+ IE A  +    +P A  I G D+A +G D +V+ +R G  ++
Sbjct: 213 IYGEFLDTTTNALFPLSQIEAAFGKVRAYEPNAVQIWGLDVARDGDDESVLCVREGYHVK 272

Query: 344 HLFDWSKTDLRTTNNKISGLVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVY--RVLG 399
           +L  +          +I    E  + +P+AI ID+   GA T D L   G          
Sbjct: 273 NLEGFRIASTTELAREIYRRYEMSEKKPEAIFIDSVGVGAGTFDRLCEFGLGAICREAKA 332

Query: 400 QKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK- 458
             +A +     N+R E++  + +     ++  H  L + L+ ++ F         I  K 
Sbjct: 333 SYKATNEAKFANKRAEMYFALKEKFHLLTMNAHEKLKKQLQMIE-FQYDRKERYLILPKD 391

Query: 459 --RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
             + +   S DY+D L  TF ++   +          +Y+G
Sbjct: 392 ELKKEYGTSPDYADALALTFFDDVMSARRT--EEKRQRYDG 430


>gi|85058727|ref|YP_454429.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779247|dbj|BAE74024.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 456

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/451 (15%), Positives = 135/451 (29%), Gaps = 66/451 (14%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
            P  +K A   GRG GK+   A L++     R G      A            E    ++
Sbjct: 13  QPHRYKIA-KGGRGSGKSWAIARLLVE--IARRGTYRFLCA-----------REFQASMA 58

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +   +      +   +     +         +       +  +  +  G       
Sbjct: 59  DSVIQLIADTIQREGYLKEFEIQKAYIRYLATDSLFMFYGIKNNVTKIKSLEGI-----D 113

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
               +EA          ++  + +  +   W+  +    L   +      PLDD     +
Sbjct: 114 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSFNPKNILDDTYQRFVVNPLDDICLLTV 172

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP- 312
                          +      D D+      G+       + I    I  A++      
Sbjct: 173 HYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHITLG 232

Query: 313 -DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
            +P     +G D+A+EG D+  ++L  G V+ HL  W+K D+  + +++    E    D 
Sbjct: 233 FEPAGKKRIGFDVADEGEDSNALILSHGSVVMHLETWNKGDVIQSADRVKNYAESVIADE 292

Query: 372 IIIDANNTGARTCDYLEML------GYHVYRVLGQKRA------VDLEFCRNRRTELHVK 419
           II D+   GA     L  +      G++    + +  A       + +   N + +    
Sbjct: 293 IIFDSIGVGAGVKARLRRVSRITASGFNAGGGVFKPDAKYVDGKTNKDMFVNLKAQAWWG 352

Query: 420 MADWLEF--------ASLINHSGLI---------------------QNLKSLKSFIVPNT 450
           + +                + S  +                     +   S       N 
Sbjct: 353 VRERFYNTWHAVEYIKHHPDDSDFVKGLRDDQLISLSSRLSSLDYLKAELSRPWVDYDNN 412

Query: 451 GELAIESK---RVKGAKSTDYSDGLMYTFAE 478
           G + +ESK   + +G  S + +D L+  FA 
Sbjct: 413 GRVKVESKKDMKKRGIPSPNRADALIMAFAP 443


>gi|212703250|ref|ZP_03311378.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
 gi|212673294|gb|EEB33777.1| hypothetical protein DESPIG_01292 [Desulfovibrio piger ATCC 29098]
          Length = 330

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/301 (21%), Positives = 112/301 (37%), Gaps = 18/301 (5%)

Query: 200 ASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDT 255
           A   P+V    +   L +R  +  +I T     L  + Y+            W       
Sbjct: 5   AQMKPEVWGEVVQPALADRRGSAVFIGTPKGANLFAELYQRGMAAQAQGDAAWCALSYPV 64

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP- 314
            + + +     E +        +  R E+   F     D  IPL  + EA  R+   D  
Sbjct: 65  TSTDVLPAEDVERLRRELSD--NAFRQEMLCDFTASSDDILIPLPDVLEAEARQLAWDDV 122

Query: 315 -YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII 373
              P+I+G D+A  G D++V+V R+G  ++        D     ++++  + + RP A+ 
Sbjct: 123 GGMPVILGVDVARFGADSSVIVRRQGLKVDGPVVMRGLDNMQLADRVAAAIMENRPHAVF 182

Query: 374 IDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS 433
           IDA   G    D L  LG+ V  V    + +      NRR+E+   +  WL+    +   
Sbjct: 183 IDA-GQGQGVIDRLRQLGHEVIEVPFGGKPLQEGRFANRRSEMWYGLRQWLKSGGKLPDE 241

Query: 434 -----GLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDM 485
                 L   L +   +     G + +E K   + +   S D +D L  TFA      + 
Sbjct: 242 GDDVPRLRAELSA-PLYWYDAAGRMVLEPKDKIKERLGASPDIADALALTFAAPVALPEP 300

Query: 486 D 486
            
Sbjct: 301 G 301


>gi|283956317|ref|ZP_06373797.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792037|gb|EFC30826.1| terminase B protein, putative [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 430

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 80/421 (19%), Positives = 145/421 (34%), Gaps = 40/421 (9%)

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
            +       ++ GR +G T  +A  V+  +    G +V+ +   +  L+       +  L
Sbjct: 18  DDKNPRFITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWVDTIQANLQNYYELYFTPEL 75

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
             LP K ++                                        +          
Sbjct: 76  KNLP-KDFYSWSVQDKKL-------------------IINGAVLHMRSAERSENIEGFGY 115

Query: 193 MAIINDEASGTPDV------INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
             +I +EA                I   L + N     I+   P+  +  +     +  D
Sbjct: 116 DLVILNEAGIILKGSKGEYLWYNAIRPMLLD-NPKSRAIIGGVPKGKNLFYELCRKELSD 174

Query: 247 D-WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
             WK FQ  +     +     + +I   G  DS+V + E+ G+F          L  IE 
Sbjct: 175 KNWKHFQFSSYDNPFLKEEQIKELIEEVGGEDSEVVKQEIYGEFIDSSSAELFALTEIEN 234

Query: 305 ALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A+++            I G D+A  G D +V+  R+G +++ +  +S+       N+I  
Sbjct: 235 AMSKNSFSIEKMQGENIWGLDVARYGDDKSVLAKRKGFIVDEIKKYSQLGTMELANRILA 294

Query: 363 LVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                + +P  I ID    G    D L   G  V+       A   E   N+R +++   
Sbjct: 295 EYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSNE-YLNKRAQMYFTF 353

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           A  L+   L+    L ++++ ++ +   + G L I SK   +    KS D SD +  TF 
Sbjct: 354 AKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVSKEQLKKNYGKSPDVSDAVALTFF 412

Query: 478 E 478
           E
Sbjct: 413 E 413


>gi|16273317|ref|NP_439561.1| terminase large subunit-like protein [Haemophilus influenzae Rd
           KW20]
 gi|1175785|sp|P44184|Y1410_HAEIN RecName: Full=Uncharacterized protein HI_1410
 gi|1574247|gb|AAC23058.1| predicted coding region HI1410 [Haemophilus influenzae Rd KW20]
          Length = 394

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 61/401 (15%), Positives = 128/401 (31%), Gaps = 46/401 (11%)

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
           ++ E+ K +S    +   +   +    A +            S+         +     +
Sbjct: 1   MFREIQKSISDSVIQMLADQIEMLSLQAFFDVQKTQIIGQNGSRFTFA-GLKTNITSIKS 59

Query: 184 FVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN- 242
             G        +  +E           ++  + E  +    I++ NP+ +    Y+ F  
Sbjct: 60  MTGI-----DVVWVEEGENVSKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVI 112

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
            P +  K   ++ +          E +      D ++ R    G+       + I    I
Sbjct: 113 HPPERCKSVLVNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWI 172

Query: 303 EEALNREPCP--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKI 360
           E A++              +G D+A+EG D+       G V+  +  W   D+  + N+ 
Sbjct: 173 EYAVDAHLKLGFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRT 232

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEML--GYHVYRVLGQKRA-----------VDLE 407
           +    K++ D II D+   GA    + + L     V                     + +
Sbjct: 233 NQSAVKFKADLIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQD 292

Query: 408 FCRNRRTELHVKMADWL-------EFASLINHSGLI------------QNLKSLKSFIVP 448
              N + +    + D         ++  +     LI            +   S       
Sbjct: 293 MFSNIKAQSWWALRDRFYKTYRAVKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYD 352

Query: 449 NTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMD 486
           N G + +ESK   + +G  S + +D L+  +A   P+S +D
Sbjct: 353 NNGRVKVESKKDMKKRGIPSPNMADALVMCYAPTKPKSLLD 393


>gi|216906085|ref|YP_002333619.1| terminase [Abalone shriveling syndrome-associated virus]
 gi|216263178|gb|ACJ72002.1| terminase [Abalone shriveling syndrome-associated virus]
          Length = 507

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 91/447 (20%), Positives = 163/447 (36%), Gaps = 28/447 (6%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             WQLE ++ +      + +     V   A+S G G GKT L+  L +W     PG    
Sbjct: 49  FDWQLEIVDYIAKFFRKNSD-EKHFVCAIAVSGGNGTGKTKLSKALNIWRFCCHPGSRQF 107

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
            L NSE Q K T +  + + +S L         +     A +YS  +     + +     
Sbjct: 108 ILTNSERQTKRTGFTMLVRRISKL-----LSCIAALESSAYYYSPAVADKPEVRTNDMWD 162

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           +             G H+   M    DE++   D +   +    T+     F     +  
Sbjct: 163 VTYLLQSSTEAALSGLHHP-MMTFSFDESTYFNDHVWQALENMWTQGQVLCFCTGNPSHD 221

Query: 232 RLSGK---FYEIFNKPLDDWKRFQIDTRTVE--GIDPSFHEGIIARYGLDSDVTRVEVCG 286
             +     F +  +K    W    +    +     + +    I   YG         V G
Sbjct: 222 NNNYFARLFNKSLHKKDSLWLTRCVSLLELPLKYRNDARARYIEEHYGKTHPRYIASVLG 281

Query: 287 QFPQQDIDSFIPLNIIEEALNREPCPD-PYAPLIMGCD--IAEEGGDNTVVVLRRGPVIE 343
           QFP+++  +   +  I EA+ RE   +  + P+IMG D  I+   G  + + +R G  + 
Sbjct: 282 QFPKKNTCNPFDITAISEAMEREVREEFIHHPVIMGIDVSISANNGSASAICVREGTAVR 341

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM-----LGYHVYRVL 398
            L ++          K+  L+++ +P  +++DAN  G    + L           VY V 
Sbjct: 342 VLREYRCH-YTEFRIKLLELLQEIKPTIVVVDANGVGFGLYEELHRTLPETSNVRVYGVR 400

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEF--ASLINHSGLIQNLKSLKSFIVPNTGELAIE 456
               A       ++ +EL  K ++W      S+  +   +  L SL       +G++ + 
Sbjct: 401 AHAEAFLKSEYADKMSELAKKSSEWFNNELVSIPKNYQFLNALTSLSF--ADASGKIKLI 458

Query: 457 SK---RVKGAKSTDYSDGLMYTFAENP 480
            K   + K   S D +D    TF +  
Sbjct: 459 GKTDAKKKVDLSMDMADAFFLTFLDGV 485


>gi|315929403|gb|EFV08605.1| phosphatase, Ppx/GppA family [Campylobacter jejuni subsp. jejuni
           305]
          Length = 430

 Score =  190 bits (482), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 81/421 (19%), Positives = 142/421 (33%), Gaps = 40/421 (9%)

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
            +       ++ GR +G T  +A  V+  +    G +V+ +   +  L+       +  L
Sbjct: 18  DDKNPRFITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWVDTIQANLQNYYELYFTPEL 75

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
             LP K ++                                        +          
Sbjct: 76  KNLP-KDFYSWSVQDKKL-------------------IINGAVLHMRSAERSENIEGFGY 115

Query: 193 MAIINDEASGTPDV------INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
             +I +EA                I   L + N     I+   P+  +  +     +  D
Sbjct: 116 DLVILNEAGIILKGSKGEYLWYNAIRPMLLD-NPKSRAIIGGVPKGKNLFYELCRKELSD 174

Query: 247 D-WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
             WK FQ  +     +     + +I   G   S+V + E+ G+F          L+ IE 
Sbjct: 175 KNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFIDSSSAELFSLSEIEN 234

Query: 305 ALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A+++            I G D+A  G D + +  R+G VI  +  +S+       NKI  
Sbjct: 235 AMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKKYSQLGTIELANKILA 294

Query: 363 LVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                + +P  I ID    G    D L   G  V+       A   E   N+R +++   
Sbjct: 295 EYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSNE-YLNKRAQMYFTF 353

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
           A  L+   L     L ++++ ++ +   + G L I SK   +    KS D SD +  TF 
Sbjct: 354 AKNLKHMELFKDEELKKDMRMIE-YEYSDKGLLKIVSKEYLKKNYGKSPDVSDAVALTFF 412

Query: 478 E 478
           E
Sbjct: 413 E 413


>gi|284162607|ref|YP_003401230.1| hypothetical protein Arcpr_1511 [Archaeoglobus profundus DSM 5631]
 gi|284012604|gb|ADB58557.1| protein of unknown function DUF264 [Archaeoglobus profundus DSM
           5631]
          Length = 435

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 79/478 (16%), Positives = 157/478 (32%), Gaps = 76/478 (15%)

Query: 10  ETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNS 69
           +T+++L   + SD        F   F  WG               Q + +          
Sbjct: 2   KTDKELKKKVLSD-----PVTFAKVFLDWGAHPA-----------QAQILRD-------- 37

Query: 70  VNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVS 129
                       + AGR  GKT   A   ++   T PG     +A S  Q    ++ ++ 
Sbjct: 38  --RHQF----ITVVAGRRFGKTECMAVSAIYYALTNPGSIQFVIAPSYDQ-SNIMFGQIV 90

Query: 130 KWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN 189
           ++LS              ++  P++  +      I ++                      
Sbjct: 91  QFLSKSI----LGCMIRRIYKTPFHHIIFKNDSVIHAR------------SASKPEFLRG 134

Query: 190 TYGMAIINDEASGTPDV-INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPL-DD 247
                II DEA+  PD  I+  I   L + N +   I T   +      Y     P   D
Sbjct: 135 HKAHRIILDEAAFIPDDVISNIIEPMLADYNGSWIKIGTPFGKNHFYDTYLKGQSPDFPD 194

Query: 248 WKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN 307
           +  ++  +     I   F E     YG +S + R E   +F +     F     I++ ++
Sbjct: 195 YSSYRFPSTVNPHISHEFIEKKKREYGENSIIFRTEYLAEFVEDQNAVFR-WADIQKNVD 253

Query: 308 REPCPDPYAP-----LIMGCDIAEEGGDNTVVVLR---RGPVIEHLFDWSKTDLRTTNNK 359
                   A       ++GCD+A+      +VVL    +   + H   +++        +
Sbjct: 254 NSIELIDSAENVSKQYVIGCDLAKYQDYTVIVVLDVTEKPYKLVHFERFNRRPYAEVIMR 313

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           +  L  ++    ++ID+   G    + L+ +G      +   ++         + +L  +
Sbjct: 314 LKELYRRFNYAKVLIDSTGVGDPVLEDLQDVG--AEGYVFTPKS---------KVQLIQR 362

Query: 420 MADWLEFA--SLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           +   LE           L++ L+  + + +  TG + +E+   +     DY   L   
Sbjct: 363 LQAALENGEIRYPYIEELVKELQFFE-YQLTRTG-IKMEA---RQGFHDDYVIALALA 415


>gi|153951273|ref|YP_001397540.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|153951467|ref|YP_001398214.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938719|gb|ABS43460.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152938913|gb|ABS43654.1| putative terminase B protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 430

 Score =  187 bits (475), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 83/428 (19%), Positives = 143/428 (33%), Gaps = 40/428 (9%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
                   +       ++ GR +G T      V+  +    G +V+ +   +  L+    
Sbjct: 11  RAQLKVFDDKNPRFITVAKGRRLGFTRGCVKYVIENLI--EGKNVLWVDTIQANLQNYYE 68

Query: 126 AEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFV 185
              +  L  LP K ++                                        +   
Sbjct: 69  LYFTPELKNLP-KDFYSWSVQDKKL-------------------IINGAVLHMRSAERSE 108

Query: 186 GHHNTYGMAIINDEASGTPDV------INLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
                    +I +EA                I   L + N     I+   P+  +  +  
Sbjct: 109 NIEGFAYDLVILNEAGIILKDSKGGYLWYNSIRPMLLD-NPKSRAIIGGVPKGKNLFYEL 167

Query: 240 IFNKPLDD-WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFI 297
              +  D  WK FQ  +     +     + +I   G   SDV R E+ G+F         
Sbjct: 168 CRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGESSDVVRQEIYGEFIDSSSAELF 227

Query: 298 PLNIIEEALNREPCPDPY--APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRT 355
            L+ IE A+++            I G D+A  G D +V+  R+G VI+ L  +S+     
Sbjct: 228 SLSGIENAMSKNSFSTQKMQGENIWGLDVARYGDDKSVLAKRKGFVIDELKKYSQLGTIE 287

Query: 356 TNNKISGLVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
             NKI    +  + +P  I ID    G    D L   G  V+       A   +   N+R
Sbjct: 288 LANKILAEYKQSEEKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSNQ-YLNKR 346

Query: 414 TELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSD 470
            +++   A  L+   L+    L  +++ ++ +   + G L I SK   +    KS D SD
Sbjct: 347 AQMYFTFAKNLKHMELVKDEELKNDMRRIE-YEYSDKGLLKIVSKEQLKKNYGKSPDLSD 405

Query: 471 GLMYTFAE 478
            +  TF E
Sbjct: 406 AVALTFFE 413


>gi|260868683|ref|YP_003235085.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|293446697|ref|ZP_06663119.1| phage terminase large subunit [Escherichia coli B088]
 gi|257765039|dbj|BAI36534.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|291323527|gb|EFE62955.1| phage terminase large subunit [Escherichia coli B088]
 gi|323177130|gb|EFZ62720.1| phage terminase, large subunit, PBSX family [Escherichia coli 1180]
          Length = 471

 Score =  187 bits (474), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 58/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|57237579|ref|YP_178593.1| terminase B protein, putative [Campylobacter jejuni RM1221]
 gi|57166383|gb|AAW35162.1| terminase B protein, putative [Campylobacter jejuni RM1221]
          Length = 430

 Score =  187 bits (474), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 80/421 (19%), Positives = 142/421 (33%), Gaps = 40/421 (9%)

Query: 73  PNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL 132
            +       ++ GR +G T  +A  V+  +    G +V+ +   +  L+       +  L
Sbjct: 18  DDKNPRFITVAKGRRLGFTRGSAKFVIENLLL--GQNVLWVDTIQANLQNYYELYFTPEL 75

Query: 133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
             LP K ++                                        +          
Sbjct: 76  KNLP-KDFYSWSVQDKKL-------------------IINGAVLHMRSAERSENIEGFGY 115

Query: 193 MAIINDEASGTPDV------INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
             +I +EA                I   L + N     I+   P+  +  +     +  D
Sbjct: 116 DLVILNEAGIILKGSKGEYLWYNAIRPMLLD-NPKSRAIIGGVPKGKNLFYELCRKELSD 174

Query: 247 D-WKRFQIDTRTVEGIDPSFHEGIIARYG-LDSDVTRVEVCGQFPQQDIDSFIPLNIIEE 304
             WK FQ  +     +     + +I   G   S+V + E+ G+F          L+ IE 
Sbjct: 175 KNWKHFQFSSYDNPFLKEEQIKELIEEVGGEGSEVVKQEIYGEFIDSSSAELFSLSEIEN 234

Query: 305 ALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG 362
           A+++            I G D+A  G D + +  R+G VI  +  +S+       NKI  
Sbjct: 235 AMSKNSFSIEKMQGENIWGLDVARYGDDKSALAKRKGFVIYEIKKYSQLGTIELANKILA 294

Query: 363 LVE--KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
                + +P  I ID    G    D L   G  V+       A   E   N+R +++   
Sbjct: 295 EYNQSEDKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSNE-YLNKRAQMYFTF 353

Query: 421 ADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
              L+   L+    L ++++ ++ +   + G L I SK   +    KS D SD +  TF 
Sbjct: 354 TKNLKHMELVKDEELKKDMRMIE-YEYSDKGLLKIVSKEQLKKNYGKSPDVSDAVALTFF 412

Query: 478 E 478
           E
Sbjct: 413 E 413


>gi|324019922|gb|EGB89141.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           117-3]
          Length = 471

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKCIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWL-----------------------EFASLINHSGLIQNLKSLKSFIVPNT 450
            + +  +AD L                       E         L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|157159763|ref|YP_001457081.1| PBSX family phage terminase large subunit [Escherichia coli HS]
 gi|300935792|ref|ZP_07150755.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
 gi|157065443|gb|ABV04698.1| phage terminase, large subunit, pbsx family [Escherichia coli HS]
 gi|300459025|gb|EFK22518.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
          Length = 471

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 58/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINDGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|294492319|gb|ADE91075.1| phage terminase, large subunit, PBSX family [Escherichia coli
           IHE3034]
          Length = 471

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               N                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPNDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|237704849|ref|ZP_04535330.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|226901215|gb|EEH87474.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|315288241|gb|EFU47640.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           110-3]
          Length = 471

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWL-----------------------EFASLINHSGLIQNLKSLKSFIVPNT 450
            + +  +AD L                       E         L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|91211665|ref|YP_541651.1| terminase large subunit [Escherichia coli UTI89]
 gi|117624554|ref|YP_853467.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|218559279|ref|YP_002392192.1| Terminase large subunit [Escherichia coli S88]
 gi|91073239|gb|ABE08120.1| terminase large subunit [Escherichia coli UTI89]
 gi|115513678|gb|ABJ01753.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|148566126|gb|ABQ88401.1| phage terminase large subunit [Enterobacteria phage CUS-3]
 gi|218366048|emb|CAR03793.1| Terminase large subunit [Escherichia coli S88]
 gi|307626097|gb|ADN70401.1| terminase large subunit [Escherichia coli UM146]
 gi|323948780|gb|EGB44679.1| phage terminase large subunit [Escherichia coli H252]
          Length = 471

 Score =  187 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 58/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|168260952|ref|ZP_02682925.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|205349913|gb|EDZ36544.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
          Length = 471

 Score =  187 bits (473), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 58/463 (12%), Positives = 124/463 (26%), Gaps = 76/463 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKTFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEVFSGKKITATMFKGSESPFDEDALYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSS 463


>gi|225155389|ref|ZP_03723881.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
 gi|224803845|gb|EEG22076.1| hypothetical protein ObacDRAFT_9437 [Opitutaceae bacterium TAV2]
          Length = 479

 Score =  186 bits (471), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 93/466 (19%), Positives = 158/466 (33%), Gaps = 55/466 (11%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAW-LVLWLMSTRPGISVI 111
           SWQ + M  V                  A +   G GKT++    L L L+   PG +V+
Sbjct: 37  SWQAKIMASV-----------WSGKPTVA-ATPNGAGKTSVIIVALALTLLHEFPGATVV 84

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             + +   +   ++A ++   +      W              +D               
Sbjct: 85  LTSATYRAVCDQIFASLAVHQAKFSAWKW--------------NDTEINDGQGGRIIGFA 130

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
             R    E    + G      + II DEA    D I +       +R      +  S+  
Sbjct: 131 TDRGGRFEGFHAYPG----RPLLIILDEAKSIADDIFVAA-----DRCQPTMLLYISSWG 181

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
            L G+F++ F+   D + +FQ        I P F E + A+YG DSD+ R  + GQ P+ 
Sbjct: 182 GLFGRFHDAFS--QDRFAQFQAGIADCPHITPEFIEAMRAQYGEDSDIYRSMILGQRPKG 239

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW-SK 350
           +   F+   +  E     P         + CD AE   D  V+  R G  +  +  W   
Sbjct: 240 NETGFVVPFVDYERCESNPPVWQEGTKQVFCDFAETS-DECVIAKRDGNRLSIVDAWIPD 298

Query: 351 TDLRTTNNKISGLVEKYRPDAIII--DANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEF 408
            +     ++  G + + + +  +I  DA+ TG      L + G  +  V      +D  +
Sbjct: 299 GNTAGITDRFEGHLRRLQNEGFVIRGDADGTGHGYITALSLRGIKISGVKNNDAPMDNHY 358

Query: 409 CRNRRTELHVKMADWLEF--ASLINHSGLIQNLKSL---------KSFIVPNTGELAIES 457
             N   E     A  ++     L +   L + L S          K       G L +  
Sbjct: 359 F-NLAAEHWWTFAKKVKSNFWILPHDEVLKRQLCSREEVYRKVGDKKVYGREDGRLQLMP 417

Query: 458 KRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEGVDLLIE 503
           K     KS D +D L+    +    +          +   +D+L E
Sbjct: 418 KSRLSTKSPDRADALVGAAFDYASFAAFTLMGGNDMR-SHLDMLNE 462


>gi|145638997|ref|ZP_01794605.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
 gi|145271969|gb|EDK11878.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
          Length = 379

 Score =  182 bits (462), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 58/378 (15%), Positives = 121/378 (32%), Gaps = 45/378 (11%)

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV 206
            L    ++       +G +   ++      +     +  G        +  +E       
Sbjct: 8   MLGLQDFFDVQKTQIIGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENVSKE 62

Query: 207 INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGIDPSF 265
               ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +         
Sbjct: 63  SWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFPKEL 120

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMGCD 323
            E +      D ++ R    G+       + I    IE A++              +G D
Sbjct: 121 MEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKLGFTTKGMKKVGFD 180

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
           +A+EG D        G V+  +  W   D+  + N+ +    K++ D II D+   GA  
Sbjct: 181 VADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVGAGV 240

Query: 384 CDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL------ 424
             + + L     V                     + +   N + +    + D        
Sbjct: 241 KAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKNQDMFSNIKAQSWWALRDRFYKTYRA 300

Query: 425 -EFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESK---RVKGAKSTDY 468
            ++  +     LI            +   S       N G + +ESK   + +G  S + 
Sbjct: 301 VKYGDVYPDDELISLSSKIKELEYLKAELSRPRVDYDNNGRVKVESKKDMKKRGIPSPNM 360

Query: 469 SDGLMYTFAENPPRSDMD 486
           +D L+  +A   P+S +D
Sbjct: 361 ADALVMCYAPTKPKSLLD 378


>gi|226940459|ref|YP_002795533.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
 gi|226715386|gb|ACO74524.1| Terminase large subunit [Laribacter hongkongensis HLHK9]
          Length = 272

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 71/276 (25%), Positives = 108/276 (39%), Gaps = 16/276 (5%)

Query: 239 EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
           +   +    W   QID+RTVEG +          YG +SD  +V V G FP      FI 
Sbjct: 5   KCGRRFRHRWVARQIDSRTVEGTNKEQIAKWAEDYGEESDFFKVRVRGMFPSMSARQFIS 64

Query: 299 LNIIEEALNREPCPDPY--APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTT 356
              +  A  R   P+ Y  AP I+  D A EG D  V+ LR+G     L   +K D    
Sbjct: 65  ETDVSAAYGRALRPEQYQYAPKILTVDPAWEGDDEFVIGLRQGLSFRVLHTMAKNDNDLV 124

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
             ++    E       +      G       + +G     V     ++D   C N+R E+
Sbjct: 125 AAQVIARYEDEEGADAVFVDAGFGTGIVSAGKSMGRDWTLVWFAGNSMDAG-CLNKRAEM 183

Query: 417 HVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGELAIESKRV---KGAKSTDYSDGLM 473
                DWL+    I    ++++       +    G++ IESK+    +G  S + +D L+
Sbjct: 184 WRDARDWLKSGGAIPDDPVLRDELQAPEIVPRLDGKIQIESKKEMKARGVPSPNRADALI 243

Query: 474 YTFAENPPRSDMDFGRCPSYQYEGVDLLIERRFEYD 509
            +FA    R D           + +    ERR EYD
Sbjct: 244 LSFAYPVTRRDP---------LDALRNHSERR-EYD 269


>gi|307251380|ref|ZP_07533296.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306856621|gb|EFM88761.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 384

 Score =  180 bits (457), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 118/370 (31%), Gaps = 46/370 (12%)

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
           L+  P++       +G +   ++      +     +  G        +  +E        
Sbjct: 9   LNLKPFFEVQKTQIIGRNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENVSKES 63

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGIDPSFH 266
              ++  + E  +    I++ NP+ L    Y+ F   P +      ++ +          
Sbjct: 64  WDVLIPTIREDGSQ--IIVSFNPKNLLDDTYQRFVINPPERCCSVLVNWQDNPYFPKELM 121

Query: 267 EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMGCDI 324
           E +      D ++ R    GQ       + I    IE+A++             ++G D+
Sbjct: 122 EDMKQMKERDFELYRHVYEGQPVADSDLAIIKPLWIEKAVDAHKKLGFTASGRKVVGFDV 181

Query: 325 AEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           A+EG D        G V+  + +W   D+  + ++       +  D I+ D+   GA   
Sbjct: 182 ADEGIDANANCFAHGSVVLQVDEWRGDDVIQSAHRTHTNAVMWGVDEIVFDSIGVGAGVK 241

Query: 385 DYLEMLG-YHVYRVLGQKRA-------------VDLEFCRNRRTELHVKMAD-------W 423
                +    +        A              + E   N + +    + D        
Sbjct: 242 AEYRRMDTKRILCSGFNAGASVFEPDEYYTQDKTNGEMFANIKAQAWWLLRDRFYKTYRA 301

Query: 424 LEFASLINHSGLI------------QNLKSLKSFIVPNTGELAIESKR---VKGAKSTDY 468
           +EF  +     +I            +   S       N G++ +ESK+    +G  S + 
Sbjct: 302 IEFGDVYPVDEMISLSSDIKDLEYLKAELSRPRVDHDNNGKVRVESKKDMRKRGIPSPNK 361

Query: 469 SDGLMYTFAE 478
           +D L+  FA 
Sbjct: 362 ADSLVMCFAP 371


>gi|13559866|ref|NP_112076.1| terminase large subunit [Enterobacteria phage HK620]
 gi|13517602|gb|AAK28891.1|AF335538_43 terminase large subunit [Salmonella phage HK620]
          Length = 470

 Score =  180 bits (456), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 57/460 (12%), Positives = 122/460 (26%), Gaps = 76/460 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGENILEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
           G+L     +E K+  G  S + +D LM          +  
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALAREET 460


>gi|300897414|ref|ZP_07115839.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
 gi|300358826|gb|EFJ74696.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
          Length = 470

 Score =  180 bits (455), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 57/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGSDHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|260856407|ref|YP_003230298.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
 gi|257755056|dbj|BAI26558.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
          Length = 470

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 57/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHTKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDL-----------------------EFCRNRR 413
           A     T +             G +   D                        +  RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDGPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|41057280|ref|NP_958178.1| gene 2 protein [Enterobacteria phage Sf6]
 gi|191165541|ref|ZP_03027382.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218695968|ref|YP_002403635.1| Terminase large subunit [Escherichia coli 55989]
 gi|331678314|ref|ZP_08378989.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
 gi|33334159|gb|AAQ12192.1| gene 2 protein [Shigella phage Sf6]
 gi|190904464|gb|EDV64172.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218352700|emb|CAU98482.1| Terminase large subunit [Escherichia coli 55989]
 gi|324114096|gb|EGC08069.1| phage terminase large subunit [Escherichia fergusonii B253]
 gi|331074774|gb|EGI46094.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
          Length = 470

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 57/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|323936486|gb|EGB32774.1| phage terminase large [Escherichia coli E1520]
          Length = 470

 Score =  179 bits (453), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDL-----------------------EFCRNRR 413
           A     T +             G +   D                        +  RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDGPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIDEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|325497784|gb|EGC95643.1| gene 2 protein [Escherichia fergusonii ECD227]
          Length = 470

 Score =  179 bits (453), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWL-----------------------EFASLINHSGLIQNLKSLKSFIVPNT 450
            + +  +AD L                       E         L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVYGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|222032743|emb|CAP75482.1| Terminase large subunit [Escherichia coli LF82]
          Length = 470

 Score =  179 bits (453), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMAD-------WLEFASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD        +        +                 L   L  ++     N 
Sbjct: 362 AQFYYALADSLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|168239626|ref|ZP_02664684.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197287704|gb|EDY27095.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 470

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 57/453 (12%), Positives = 121/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYAAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILVPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEVIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|298381518|ref|ZP_06991117.1| phage terminase large subunit [Escherichia coli FVEC1302]
 gi|298278960|gb|EFI20474.1| phage terminase large subunit [Escherichia coli FVEC1302]
          Length = 470

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/453 (12%), Positives = 120/453 (26%), Gaps = 76/453 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 + A +            +  +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGI-----DICWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + +  +   W+  +    L   +      P DD     ++        
Sbjct: 123 VTKESWDILIPTIRKPFSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       +      +E A +            ++ 
Sbjct: 182 EVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIFKREWLEAATDAHKKLGWKAKGAVVS 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ G D      R G V++ + +    D+    +  + L  +   D  + D +  G
Sbjct: 242 AHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGSDHYLWDGDGVG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A     T +             G +   D +                         RN+R
Sbjct: 302 AGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNKR 361

Query: 414 TELHVKMADWLE-------FASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L               +                 L   L  ++     N 
Sbjct: 362 AQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQR-KFNNN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAEN 479
           G+L     +E K+  G  S + +D LM      
Sbjct: 421 GKLELMTKVEMKQKLGIPSPNLADALMMCMHCP 453


>gi|227113418|ref|ZP_03827074.1| Terminase large subunit [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 472

 Score =  176 bits (446), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 58/479 (12%), Positives = 125/479 (26%), Gaps = 78/479 (16%)

Query: 68  NSVNNPNPEVFKGAIS-AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
           N    P  +  +  ++  GRG  K+   A L+               A     ++     
Sbjct: 5   NPNFRPFIKAHRYKVAKGGRGSSKSWSIARLI-------------VEAARRQSIRILCAR 51

Query: 127 EVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
           E+   +S    +   +      + A +            +  +       +  +  +  G
Sbjct: 52  ELQNSISDSVIRLLEDTIEREGYTAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEG 111

Query: 187 HHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
                      +EA          ++  + +  +   W+  +    L   +      P D
Sbjct: 112 V-----DICWVEEAEAVTKESWDILIPTIRKPGSE-IWVSFNPKNILDDTYQRFVVTPPD 165

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
           D     ++              +      +  + R    G+       + I    +E A 
Sbjct: 166 DICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASEMAIIKREWLEAAT 225

Query: 307 NREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-TDLRTTNNKISGL 363
           +            ++   D ++ G D+    +R G V++ +       D+    +  + L
Sbjct: 226 DAHIKLGWKAKGAIVAAHDPSDTGPDDKGYAMRHGSVVKRIASPPAPLDVNDGADWATDL 285

Query: 364 VEKYRPDAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF----------- 408
                 D  + D +  GA       D        V    G +   D +            
Sbjct: 286 AIADGADHFLFDGDGLGAGLRRQVTDSFTGKKVTVTMFKGSESPFDEDSPYQAGAWFDEV 345

Query: 409 ------------CRNRRTELHVKMAD-------WLEFASL--INH--------------S 433
                        RN+R + +  +AD        +        +                
Sbjct: 346 VDGDNIRTIGDVFRNKRAQFYYTLADRLYLTYRAIVHGEYANPDDMLSFDKEAIGDQMLE 405

Query: 434 GLIQNLKSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
            L   L  ++       G+L     +E K   G  S + +D LM          + D+ 
Sbjct: 406 KLFAELTQIQR-KFNGNGKLELMTKVEMKSKLGIPSPNLADSLMMCMHCPSVAIEPDYS 463


>gi|168704975|ref|ZP_02737252.1| hypothetical protein GobsU_35915 [Gemmata obscuriglobus UQM 2246]
          Length = 519

 Score =  176 bits (446), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 83/505 (16%), Positives = 149/505 (29%), Gaps = 92/505 (18%)

Query: 46  EGFSAPRSWQLEFME-VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMST 104
           +  + P  +  + ++    A  +          ++  + A   +GK+ L   LV W   T
Sbjct: 29  KYRTDPAGYARDILKVKWWAKQVEIAEALCKPPYRVLVKASHSVGKSHLAGGLVNWWYDT 88

Query: 105 RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           R     +  A ++ Q+K  LW EV +     P                 +       L  
Sbjct: 89  RFPGVCLTTAPTDRQVKDVLWKEVRRQRRKRP----------------GFVGPKMPRLES 132

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
           D  H+      ++     +F G H    + +I DEA G               + A   W
Sbjct: 133 DPTHF---AHGFTARDATSFQGQH-EASILLIFDEAVGIDGDFWEAAESMC--QGAEYGW 186

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID-------------------PSF 265
           +   NP   + + Y +  +    W    I       I                       
Sbjct: 187 LAIFNPTDTTSRAY-LEEQAGSRWTVIDIPATEHPNIAAELVARPPEYPSAVRLNWLRDR 245

Query: 266 HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA----------------LNRE 309
            E    R     D T  ++    P      + P  + +                  + R 
Sbjct: 246 LEQWAERI-EPGDATPTDIQFPNPDGSPQWWRPGPLADARLLARWPASGCGVWSDPVWRS 304

Query: 310 PCPDPYAPL------IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL 363
                  P+       +GCD+A  G D T + +R G V  H    +  D + T  ++  +
Sbjct: 305 VERAAPDPVPERWLPQIGCDVARFGEDWTELHVRCGNVSLHHEAHNGWDTKRTTERLKQM 364

Query: 364 VEKYRPDAIIIDANNT---------------GARTCDYLEMLGYHVYRVLGQKRAVDLEF 408
             ++   A  +                    G       +  G++   V     A D E 
Sbjct: 365 CGEWAQWATQLRDRGADPIDPRRIPVKVDDDGVGGGVTDQRGGFNFQAVSSASNANDKEA 424

Query: 409 CRNRRTELHVKMADWLEFASLINH-------SGLIQNLKSLKSFIVPNTGELAIESK--- 458
             NRR+EL   +AD  +   L            L +   +  ++ +   G   +E K   
Sbjct: 425 YPNRRSELWFTVADRAKRGELFLSNLPAHVRQELKRQAMA-PTYKLDAAGRRVVEPKEDT 483

Query: 459 RVKGAKSTDYSDGLMYTFAENPPRS 483
           + +  +S D  D +   + E   R 
Sbjct: 484 KERIGRSPDGMDAVNLAYYEPSGRG 508


>gi|186682890|ref|YP_001866086.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
 gi|186465342|gb|ACC81143.1| hypothetical protein Npun_R2589 [Nostoc punctiforme PCC 73102]
          Length = 543

 Score =  176 bits (446), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 83/470 (17%), Positives = 147/470 (31%), Gaps = 92/470 (19%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           + A  G GK+ + + LV++ +    G   I  A SE Q+K  LWAE+ K   L   K   
Sbjct: 64  VKAAHGTGKSFIASLLVIYFLFC-VGGVAITTAPSEDQVKWILWAELRKIHGLHKTKLGG 122

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
               + L               + S+       T  +   ++F G H    +  I DEA 
Sbjct: 123 RCDIMQL---------------LFSETVYAFGITSRDYSENSFQGQHRQKQLL-IEDEAD 166

Query: 202 GTPDVINLGILGFLTERNANRFWIMTS-----------------------NPRRLSGKFY 238
           G    I+ G +  LT  +     I                          +   +S  + 
Sbjct: 167 GITPQIDNGFIACLTGSDNRGLRIGNPVDPQSQFAKTCKLDKRCLTVSAFSHPNVSWAYE 226

Query: 239 EIFN--------------------KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSD 278
              +                    KP  +W       R    I   + E +       S 
Sbjct: 227 LCADGVYRLKPEVAEHIINEDGEIKPQQEWPPEFPRDRIPGAISIDWIERVRREKFETSA 286

Query: 279 VTRVEVCGQFPQQDIDSFIPLNIIEEALNR-------EPCPDPYAPLIMGCDIAEEGGDN 331
             +  V G++ +   D  I L ++++A +                P  +G D+ + GGD 
Sbjct: 287 YWKGRVMGEYAEDAADGIILLTLLKQARSLYDQNPQYWDAIAKRYPWRLGLDVGD-GGDP 345

Query: 332 TVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY-----RPDAIIIDANNTGARTCDY 386
             + L RGPV+  +             + + +            +I +D    GA T   
Sbjct: 346 HALALLRGPVLYEVQIHPTKGDLLDTERAADIAASQIKLLGTGYSIAVDNTGVGAGTLAK 405

Query: 387 LEMLGYHVYRVLGQKRAVDLEF---------CRNRRTELHVKMADWLEFAS-----LINH 432
           L+  GY              +            N + EL+ +  + L         L N 
Sbjct: 406 LKKTGYQALPCRFGDVPSYKKKKQKEEPKQKFTNLKAELYWQFRELLMGGRIAIAPLENE 465

Query: 433 SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
             + Q+L + + +      E+  E K   + +  +S D S+ ++      
Sbjct: 466 EYVFQDLTATR-YSTNTKDEIFCEPKDKTKSRLGRSPD-SEAVIIALTNP 513


>gi|300907068|ref|ZP_07124735.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|301304068|ref|ZP_07210185.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|300401186|gb|EFJ84724.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           84-1]
 gi|300840675|gb|EFK68435.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           124-1]
 gi|315257729|gb|EFU37697.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           85-1]
          Length = 440

 Score =  173 bits (439), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 61/448 (13%), Positives = 122/448 (27%), Gaps = 66/448 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 4   GGRSSSKSWDAAGIAIF--LSNKYSLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 58

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 59  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----SVLWLEEAHAL 105

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +D    +I+      +  
Sbjct: 106 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSD 164

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 165 TMLKVIEAAKRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLNFEPSGRKRIG 224

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 225 FDVADSGADKCANVYRHGSVVYWADEWKAKEDELLKSCQRTYQAALERDADIVYDSIGVG 284

Query: 381 ARTCDYLEMLG------------YHVYRVLGQK----------RAVDLEFCRNRRTELHV 418
           A        +              +  R                  + +F  N + +   
Sbjct: 285 ASAGAKFAEINEDRKRENMNASRINYQRFNAGAGVNEPDYEYIGIPNKDFFANLKAQAWW 344

Query: 419 KMADWLE-------FASLINHSGLIQNLKS------------LKSFIVPNTGELAIESKR 459
            +AD                   LI    S                     G + +ESK+
Sbjct: 345 LVADRFRNTFNAVKNGEQYPVDELISIDSSCPLLEKLKLELTTPHRDFDKNGRVMVESKK 404

Query: 460 ---VKGAKSTDYSDGLMYTFAENPPRSD 484
               +   S + +D  +  FA      D
Sbjct: 405 DLAKRDVPSPNVADAFIMAFAPTDTAMD 432


>gi|268589862|ref|ZP_06124083.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
 gi|291314845|gb|EFE55298.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
          Length = 470

 Score =  173 bits (439), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 58/454 (12%), Positives = 120/454 (26%), Gaps = 76/454 (16%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GRG GK+   A L++     +P             ++     E+   +S    +   +
Sbjct: 21  KGGRGSGKSWAIARLLVEAARRQP-------------VRILCARELQNSISDSVIRLLED 67

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
                 +   +               +       +  +  +  G           +EA  
Sbjct: 68  TIEREGYNNEFEIQRTMIKHLGTGAEFMFYGIKNNPTKIKSLEGV-----DVCWVEEAEA 122

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID 262
                   ++  + + N+   W+  +    L   +      P DD      +        
Sbjct: 123 VTKESWDILIPTIRKPNSE-IWVSFNPKNILDDTYQRFVVNPPDDICLLTANYTDNPHFP 181

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIM 320
                 +      +  + R    G+       + I    +E A +            +I 
Sbjct: 182 DVLRLEMEECKRKNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAIIA 241

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             D ++ GGD     +R G V++ + +    D+    +  +    +   D  + D +  G
Sbjct: 242 THDPSDVGGDAKGYAMRHGSVVKRISEGLLMDVNDGADWATEKAIQDGADHFLWDGDGLG 301

Query: 381 AR----TCDYLEMLGYHVYRVLGQKRAVDLEF-----------------------CRNRR 413
           A       D        V    G +   D +                         RN+R
Sbjct: 302 AALRRQVTDAFTGKQTTVTMFKGSESPFDEDALYQSGAWADEVVSGDNSRTIGDVFRNKR 361

Query: 414 TELHVKMADWL-------EFASL--INH--------------SGLIQNLKSLKSFIVPNT 450
            + +  +AD L       E       +                 L   L  ++       
Sbjct: 362 AQFYYALADRLYLTYRAVEHGEYANPDDMISFDKEAIGEQMLEKLFAELTQIQR-KFNGN 420

Query: 451 GEL----AIESKRVKGAKSTDYSDGLMYTFAENP 480
           G+L     ++ K   G  S + +D LM +     
Sbjct: 421 GKLELMTKVDMKVKLGIPSPNLADSLMMSMYCPV 454


>gi|261402679|ref|YP_003246903.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
 gi|261369672|gb|ACX72421.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
          Length = 437

 Score =  173 bits (438), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/415 (15%), Positives = 131/415 (31%), Gaps = 53/415 (12%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E ++   +                 ++AGR  GK+ L  +L+++L  T+       +A
Sbjct: 33  QKEIVKAFFSGKYK----------TIIVAAGRRFGKSKLMCFLLIFLSCTQKDKKFAVIA 82

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
                 +  ++ E+  ++                      ++  +  +            
Sbjct: 83  PYYANAR-IIFKELRTYIEK---------NKTLQKLVKRITESPYMVIE------FKTGC 126

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGT-PDVINLGILGFLTERNANRFWIMTSNPRRL 233
                  D            +I DEA+    DV+   I   L + +A    I T N    
Sbjct: 127 IIDFRSADNPTSIRGESYHLVILDEAAFIKDDVVKYVIKPLLIDYDAPLIEISTPNGHNH 186

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
             + + +     +    F+  T +   +  S  E I   +G DS V + E C +F     
Sbjct: 187 FYESFLMGENRQNRHISFRFPTWSNPFLPKSVIEEIKREFGEDSLVWKQEFCAEFIDDQD 246

Query: 294 DSFIPLNIIEEALNREPCP----DPYAPLIMGCDIAEEGGDNTVVVLR---RGPVIEHLF 346
             F     I++ ++         +     +MG D+A+      +++L        + +  
Sbjct: 247 AVF-KWEYIQQCIDSNIELLTVGEKGHRYVMGVDLAKYQDYTVIIILDVSENPYKLVYFE 305

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
            +          +I  L  K++P    +D+   G    + LE        +         
Sbjct: 306 RFKDKPYSYVVERIKELYIKFKPVVC-VDSTGVGDPVVEQLEDCN----PIPF------- 353

Query: 407 EFCRNR-RTELHVKMADWLE--FASLINHSGLIQNLKSLKSFIVPNTGELAIESK 458
               N+ + +L  K+   LE           LI  LK  +      T  ++ E+K
Sbjct: 354 -KFTNQSKMQLITKLQTALERKEVIFPYIDTLITELKYFRYVKKKTT--ISFEAK 405


>gi|262316909|emb|CBA18135.1| putative terminase B [Paenibacillus phage phiBP]
          Length = 248

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 105/241 (43%), Gaps = 18/241 (7%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
            +P+++  E +         SV++   +    ++ +G+G+GKT L A + LW +   P  
Sbjct: 25  KSPKTFFKEILNFSPDKWQESVSDDIAKYRFVSVRSGQGVGKTALEAAISLWFLCCFPFP 84

Query: 109 SVICLANSETQLKTTLWAEVSKWLSLLPN-KHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
            V+C A +  QL   LWAE+SKW S  P  K   +     ++   +             +
Sbjct: 85  RVVCTAPTRQQLNDVLWAEISKWQSQSPILKRILKWTKTKIYMKNYE------------E 132

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            +    RT +  +P+   G H  Y M  I DEASG  D I   I G L+         M 
Sbjct: 133 RWFATARTAT--KPENMQGFHEDY-MLFIVDEASGVDDRIMAAIFGTLS--GDYNKLFMC 187

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
            NP + SG F++  N+    ++  ++             E + A+YG  SDV RV V G+
Sbjct: 188 GNPTKTSGFFFDSHNRDRAIYRTHRVSCLDSPRTSKENIEMLKAKYGEGSDVWRVRVLGE 247

Query: 288 F 288
           F
Sbjct: 248 F 248


>gi|74311301|ref|YP_309720.1| putative bacteriophage protein [Shigella sonnei Ss046]
 gi|73854778|gb|AAZ87485.1| putative bacteriophage protein [Shigella sonnei Ss046]
          Length = 473

 Score =  170 bits (430), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/442 (13%), Positives = 121/442 (27%), Gaps = 66/442 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 36  GGRSSSKSWDAAGIAIF--LSNKYTLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 90

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 91  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 137

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +     +I+      +  
Sbjct: 138 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLSD 196

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 197 TMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRIG 256

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 257 FDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREADIVYDSIGVG 316

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 317 ASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 376

Query: 419 KMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESKR 459
            +AD        +          LI                +         G + +ESK+
Sbjct: 377 LVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 436

Query: 460 ---VKGAKSTDYSDGLMYTFAE 478
               +   S + +D  +  FA 
Sbjct: 437 DLAKREIPSPNVADAFIMAFAP 458


>gi|16760783|ref|NP_456400.1| bacteriophage protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|25512494|pir||AE0735 probable bacteriophage protein STY2040 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503080|emb|CAD05583.1| putative bacteriophage protein [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 467

 Score =  170 bits (430), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/442 (13%), Positives = 121/442 (27%), Gaps = 66/442 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 30  GGRSSSKSWDAAGIAIF--LSNKYTLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 84

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 85  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 131

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +     +I+      +  
Sbjct: 132 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLSD 190

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 191 TMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRIG 250

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 251 FDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREADIVYDSIGVG 310

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 311 ASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 370

Query: 419 KMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESKR 459
            +AD        +          LI                +         G + +ESK+
Sbjct: 371 LVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 430

Query: 460 ---VKGAKSTDYSDGLMYTFAE 478
               +   S + +D  +  FA 
Sbjct: 431 DLAKREIPSPNVADAFIMAFAP 452


>gi|188492395|ref|ZP_02999665.1| phage terminase large subunit [Escherichia coli 53638]
 gi|188487594|gb|EDU62697.1| phage terminase large subunit [Escherichia coli 53638]
          Length = 467

 Score =  170 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/442 (13%), Positives = 121/442 (27%), Gaps = 66/442 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 30  GGRSSSKSWDAAGIAIF--LSNKYTLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 84

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 85  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 131

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +     +I+      +  
Sbjct: 132 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLSD 190

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 191 TMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRIG 250

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 251 FDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREADIVYDSIGVG 310

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 311 ASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 370

Query: 419 KMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESKR 459
            +AD        +          LI                +         G + +ESK+
Sbjct: 371 LVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 430

Query: 460 ---VKGAKSTDYSDGLMYTFAE 478
               +   S + +D  +  FA 
Sbjct: 431 DLAKREIPSPNVADAFIMAFAP 452


>gi|324012808|gb|EGB82027.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           60-1]
          Length = 441

 Score =  170 bits (429), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/442 (13%), Positives = 121/442 (27%), Gaps = 66/442 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 4   GGRSSSKSWDAAGIAIF--LSNKYTLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 58

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 59  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 105

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +     +I+      +  
Sbjct: 106 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLSD 164

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 165 TMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRIG 224

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 225 FDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREADIVYDSIGVG 284

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 285 ASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 344

Query: 419 KMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESKR 459
            +AD        +          LI                +         G + +ESK+
Sbjct: 345 LVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 404

Query: 460 ---VKGAKSTDYSDGLMYTFAE 478
               +   S + +D  +  FA 
Sbjct: 405 DLAKREIPSPNVADAFIMAFAP 426


>gi|194434997|ref|ZP_03067239.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|194416779|gb|EDX32906.1| phage terminase, large subunit, pbsx family [Shigella dysenteriae
           1012]
 gi|323166781|gb|EFZ52535.1| phage terminase, large subunit, PBSX family [Shigella sonnei 53G]
          Length = 447

 Score =  169 bits (428), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 59/442 (13%), Positives = 121/442 (27%), Gaps = 66/442 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A + ++   +       C A    Q++  +   V   L +  ++     
Sbjct: 10  GGRSSSKSWDAAGIAIF--LSNKYTLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 64

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 65  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 111

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +     +I+      +  
Sbjct: 112 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKINYDENPFLSD 170

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMG 321
           +  + I A    D D  +    G     D  + I L+ IE A++       +P     +G
Sbjct: 171 TMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLNFEPSGRKRIG 230

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G V+    +W   +     +          R   I+ D+   G
Sbjct: 231 FDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREADIVYDSIGVG 290

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 291 ASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 350

Query: 419 KMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNTGELAIESKR 459
            +AD        +          LI                +         G + +ESK+
Sbjct: 351 LVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 410

Query: 460 ---VKGAKSTDYSDGLMYTFAE 478
               +   S + +D  +  FA 
Sbjct: 411 DLAKREIPSPNVADAFIMAFAP 432


>gi|282598783|ref|YP_003359102.1| putative large subunit terminase [Clavibacter phage CMP1]
 gi|262212571|gb|ACY35907.1| putative large subunit terminase [Clavibacter phage CMP1]
          Length = 872

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 94/459 (20%), Positives = 157/459 (34%), Gaps = 57/459 (12%)

Query: 91  TTLNAWLVLWLMSTRPG--ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL 148
           T L   LV W +S  P    SV+  A    Q+   ++  +    +L   +    +  ++ 
Sbjct: 424 TRLAGDLVTWFVSVFPPEETSVMVSAPIREQIDVMMFRYLRDNYNLAIEREQPLIGEITK 483

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN 208
            P  W             K      R        +F G H    +A++ DEA G P+ + 
Sbjct: 484 WP-YWQVGAPL------DKKLVMPKRPADGNLISSFQGIH-DGHVAVVLDEAGGLPEDLY 535

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD--WKRFQIDTRTVEGIDPSFH 266
           +G     T  +A    +   NP + +  F+E F        W RF I             
Sbjct: 536 IGANAVTTNFHAR--ILAIGNPDKRNTPFHERFTDTEKFSSWNRFTIGAEDTPNFTG--- 590

Query: 267 EGIIARYGLDSDVTRV---------------------EVCGQFPQQDIDSFIPLNIIEEA 305
           E I      D DV +                      +V G FP+ D  +F   ++I   
Sbjct: 591 EKIYEDPAKDEDVKKHLVQVSWAVEMRKSARPSVVAAKVDGNFPESDDTTFFDQSVINRG 650

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD---LRTTNNKISG 362
            + E  P+      MG DI+ +G D +V  +  G  I    +W++ D      +  +I  
Sbjct: 651 YSTEIEPESTDFKYMGVDISYQGEDQSVAYINHGGQIRIADEWNRFDGAEHIESAIRIHN 710

Query: 363 LVEKYRPDAIIIDANNTGARTC------DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
              +     + ID   TGA         D  +   Y +  V G  R  +     N R   
Sbjct: 711 KACQEGVQEVRIDMAGTGAGVYSNLKMLDQFKDKPYVLIGVNGANRTPNSNRWLNARAWH 770

Query: 417 HVKMADWLEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSD 470
           + +    L    +   I    L + ++   S    N G+L I  K   R  G  S D+ D
Sbjct: 771 YDQFRTGLITGKIDITITDVDLKKEMELQPS-TFTNRGQLQITRKDDMRKMGISSPDHLD 829

Query: 471 GLMYTFAENPPRSDMDFGRCPSYQ---YEGVDLLIERRF 506
             +Y+  +  P ++         +    +  +LL+  R+
Sbjct: 830 AAIYSAIDTTPWTEGATAGMTPGETVVLDPFELLMMDRY 868


>gi|16759908|ref|NP_455525.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142320|ref|NP_805662.1| prophage terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213583175|ref|ZP_03365001.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213647535|ref|ZP_03377588.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213855100|ref|ZP_03383340.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|25512685|pir||AF0621 probable prophage terminase large chain STY1047 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16502201|emb|CAD05440.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137950|gb|AAO69511.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 467

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/448 (14%), Positives = 126/448 (28%), Gaps = 66/448 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A   ++L          C A    Q++  +   V   L +  ++     
Sbjct: 30  GGRSSSKSWDAAGFAIFLA--NKYSLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 84

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 85  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 131

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +D    +I+      +  
Sbjct: 132 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSD 190

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIMG 321
           +  + I A    D +       G     D  + I L+ IE A++     D  P     +G
Sbjct: 191 TMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIG 250

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G VI    +W   +     +          R   I+ D+   G
Sbjct: 251 FDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAMERDADIVYDSIGVG 310

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 311 ASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 370

Query: 419 KMADWLEFA-SLINH--SGLIQNLKSL----------------KSFIVPNTGELAIESKR 459
            +AD      + IN+    L+  L S+                        G + +ESK+
Sbjct: 371 LVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 430

Query: 460 ---VKGAKSTDYSDGLMYTFAENPPRSD 484
               +   S + +D  +  FA      D
Sbjct: 431 DLAKRDIPSPNVADAFIMAFAPTDTSLD 458


>gi|322656964|gb|EFY53248.1| DNA packaging protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
          Length = 411

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/348 (19%), Positives = 122/348 (35%), Gaps = 28/348 (8%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
                +  +++G G GK++L A L+L  M   P   VI +AN   Q+KT ++  V ++ +
Sbjct: 51  QETGSRTTVTSGHGTGKSSLTAMLLLIFMILFPDARVIIVANKIGQVKTGVFKYVKQYWA 110

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +H +      L    +Y              +  +C+ Y     +   G H  + +
Sbjct: 111 NAVKRHGWLQTYFVLSDTMFYE-------RSRKGIWEVLCKGYRLGNEEALAGEHAAH-L 162

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-------KPLD 246
            +I DEASG  D     + G LTE +     +M S P R SG FY+  +        P  
Sbjct: 163 LLILDEASGISDKAIGVMTGALTEEDNR--MLMLSQPTRPSGYFYDSHHSQAKTPDNPKG 220

Query: 247 DWKRFQIDTRTVEGIDPSFH-EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W    +++     + P F  + ++   G DS    V+V GQFP++     +  +  + A
Sbjct: 221 IWTAIVLNSEESPFVTPQFIKQKLLEYGGRDSIEYMVKVLGQFPREINGYLLGRDECDRA 280

Query: 306 LNREPCPDPYAPLIMGCDIAEEGGDNT-----VVVLRRGPVIEHLFDWSKTDLRT---TN 357
             R+   +     +   D+      +      V   R    + +                
Sbjct: 281 ARRKVLLEKNWGWVATADVGNGRDKSVLNICKVSGHRDKRRVVNFKVMEMPGTMDPLAFA 340

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY-RVLGQKRAV 404
           + I       +   I I  +  G      +      V  R +      
Sbjct: 341 DFIYNECTPEKYPNITIAVDADGLVLI-RVRSWCVVVRTRYVFGGENP 387


>gi|224583103|ref|YP_002636901.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467630|gb|ACN45460.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 492

 Score =  167 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 66/474 (13%), Positives = 137/474 (28%), Gaps = 63/474 (13%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
            P  FK A   GRG  KT     ++L  +    G  +IC       +K + +AE+ + ++
Sbjct: 16  QPARFKVA-YGGRGSAKTRTFITILLNNVI-YHGWKLICFREYMKSIKESCYAEIVEEIN 73

Query: 134 LLPNKHWFEMQSLSLHPA-PWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYG 192
                    +    +              L +++            E  +          
Sbjct: 74  RRNLHSLVTINKTEIFANSGGRISFDFLRLNVENIKGYANFDAALVEEAENVSKDSWETL 133

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK-RF 251
           +  +  E           +   +      +  +  ++ R ++ + Y  +++  + +    
Sbjct: 134 IPTVRKEF--YSAEYGRVVESEIWVAYNPKNRLSDTHQRFVTNRIYPDYDENGNRYCIVK 191

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           QI+         +    +      + ++ R    G+       + I    +E A +    
Sbjct: 192 QINYTANPWFPETLRRDMEIMKKANHELYRHVYLGEPVGASEMAIIKFAWLEAATDAHIK 251

Query: 312 --PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
                   +I   D ++ G D     +R G V++ + +    D+    +  S L      
Sbjct: 252 LGWKAKGAVIAAHDPSDTGPDAKGYAVRHGSVVKRVCEGLLMDINEGADWASSLAVIDDV 311

Query: 370 DAIIIDANNTGAR----TCDYLEMLGYHVYRVLGQKRAVDLEF----------------- 408
           D  + D +  GA       DY       V    G +   D +                  
Sbjct: 312 DHFLFDGDGLGAGLRRQITDYFSGKKVTVTMFKGSESPFDEDAPYQAGAWTDEVVQGDNV 371

Query: 409 ------CRNRRTELHVKMADWL-------EFASLINHSG----------------LIQNL 439
                  RN+R + +  +AD L       E     +                   L   L
Sbjct: 372 RTIGDVFRNKRAQFYYTLADRLYRTYRAVEHGEYADPDEMLSFDKEAIGENILNKLFAEL 431

Query: 440 KSLKSFIVPNTGEL----AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
             ++       G+L     +E K+  G  S + +D LM         +  D+  
Sbjct: 432 TQIQR-KFNGNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESVAQPDYSS 484


>gi|303243859|ref|ZP_07330199.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
 gi|302485795|gb|EFL48719.1| protein of unknown function DUF264 [Methanothermococcus okinawensis
           IH1]
          Length = 445

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 64/377 (16%), Positives = 121/377 (32%), Gaps = 38/377 (10%)

Query: 80  GAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKH 139
             ++AGR  GK+ L A+L+++L ST+       +A      +  ++ E+ K++       
Sbjct: 54  IIVAAGRRFGKSKLMAFLLIFLCSTQKNKKYAVIAPFYANAR-IIFRELKKYIEKS--NV 110

Query: 140 WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDE 199
              +    +       +                  T      D            +I DE
Sbjct: 111 LSRLVKRMVESPYMAIE-------------FKTGCTIDFRSADNPTSIRGESYHLVILDE 157

Query: 200 ASGT-PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
           A+    DV+   I   L + +A    I T N      + + +     +    F+  T T 
Sbjct: 158 AAFIKDDVVKYVIKPLLLDYDAPLIEISTPNGHNHFYESFLMGKNKQNRHISFRFPTWTN 217

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP----DP 314
             +  +  E I    G DS V + E C +F   +   F     I++ ++         + 
Sbjct: 218 PFLPKNAIEEIKQEVGEDSPVWKQEYCAEFIDNNEAVF-NWEYIQQCIDGTIKLLKSGES 276

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLR---TTNNKISGLVEKYRPDA 371
               +MG D+A+      + VL        L  + + +L       +K+  L + +    
Sbjct: 277 GHQYVMGVDLAKFEDYTVITVLDVSVKPYKLVYFERFNLMPYSFVADKVKELYQLFNKPQ 336

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL--EFASL 429
           + +DA   GA   + +E L           +             L  K+   +       
Sbjct: 337 VCMDATGPGAAVVEQVESLNP--IGFTFTSKNKLP---------LITKLQTSIVKNEVLF 385

Query: 430 INHSGLIQNLKSLKSFI 446
                LI  LK  +   
Sbjct: 386 PYLDQLITELKYFRYVK 402


>gi|161614489|ref|YP_001588454.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363853|gb|ABX67621.1| hypothetical protein SPAB_02238 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 441

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 65/448 (14%), Positives = 125/448 (27%), Gaps = 66/448 (14%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GR   K+   A   ++L          C A    Q++  +   V   L +  ++     
Sbjct: 4   GGRSSSKSWDAAGFAIFLA--NKYSLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH 58

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                    +          +    +       + E   +  G        +  +EA   
Sbjct: 59  --------RFRILNNKIINRVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHAL 105

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDP 263
            +     +   + +  +   W + +        +      P +D    +I+      +  
Sbjct: 106 TEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSD 164

Query: 264 SFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIMG 321
           +  + I A      +       G     D  + I L+ IE A++     D  P     +G
Sbjct: 165 TMLKVIDAARRRYPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIG 224

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTG 380
            D+A+ G D    V R G VI    +W   +     +          R   I+ D+   G
Sbjct: 225 FDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAMERDADIVYDSIGVG 284

Query: 381 ARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFCRNRRTELHV 418
           A        +             V        A             + +F  N + +   
Sbjct: 285 ASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWW 344

Query: 419 KMADWLEFA-SLINH--SGLIQNLKSL----------------KSFIVPNTGELAIESKR 459
            +AD      + IN+    L+  L S+                        G + +ESK+
Sbjct: 345 LVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKK 404

Query: 460 ---VKGAKSTDYSDGLMYTFAENPPRSD 484
               +   S + +D  +  FA      D
Sbjct: 405 DLAKRDIPSPNVADAFIMAFAPTDTSLD 432


>gi|320103661|ref|YP_004179252.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
 gi|319750943|gb|ADV62703.1| hypothetical protein Isop_2123 [Isosphaera pallida ATCC 43644]
          Length = 553

 Score =  163 bits (412), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/570 (16%), Positives = 158/570 (27%), Gaps = 116/570 (20%)

Query: 5   LPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDA 64
           +    E  + L   +  +E         L        G        P  W          
Sbjct: 1   MRKEKEEIRTLATPLMVEESTAGMVARALRCLADDPVGFNRLALGRPDYW---------- 50

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
                            ++ G  +GK+ L A L LW + T PG  V+  A S+  L T L
Sbjct: 51  EGQRRAALALTRARSVVVATGNAVGKSYLAAGLTLWWLYTHPGSLVVATAPSQGLLGTVL 110

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
           + E+ K L+    +    +  + +         L    G         C   +    +  
Sbjct: 111 FRELQKALAASR-RRGLGLPGMVVGSDRGTPFSLRVGPGRRLAAEGWGCLGIATRGVERL 169

Query: 185 VGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP 244
            G H+   M ++ DEASG        +          R   +  NP      F+++  + 
Sbjct: 170 AGRHHADLM-VVVDEASGVQPEAWEALTSL-----NPRKLFVCGNPLTPGTVFHKLHQRG 223

Query: 245 LDDWK-----------RFQIDTRTVEGI----------DPSFHEGIIARYGLDSDVTRVE 283
           L +                I +     I          D  F      ++G  S +    
Sbjct: 224 LTEASDPSIPDHARGVALTIPSTASPDINLERSPRGLADRGFIREAERQWGRGSPLWLSH 283

Query: 284 VCGQFPQQDIDSFIPLNIIEEA----LNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG 339
           V G FP   + + I    +++A     ++     P  P++     A  G D T +V+R  
Sbjct: 284 VEGVFPTVAVHALIEPGWLDQAASLERSQTYENPPGQPVLGCDLAAGVGADRTAIVVRDE 343

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPD--AIIIDANNTGARTCDYLEMLGYHVYRV 397
             I  L    +         I+ L  K+      I+ D    GA     L   G      
Sbjct: 344 GGIRELIASDRLAPDEAATLIASLARKHLIAPERILYDGAGLGAELTTRLARQGPGFVHA 403

Query: 398 LG-QKRAVDLEFCRNRRTELHVKMADWL-------------------------------- 424
                 A       N R     ++   L                                
Sbjct: 404 RAIFGAASGGAGFLNHRAWCGWRLRQRLDPSYSGLDPIAMTGGEPATRVVWDGDRFDPAT 463

Query: 425 EFASLINHSG----------------------------------LIQNLKSLKSFIVPNT 450
           +   L                                       L + L++L+  +V   
Sbjct: 464 QTWRLPPDDDPTDFAALGPALRPARSNQASRLPFVIPPEPWWPNLREELEALRYRLVGT- 522

Query: 451 GELAIESK---RVKGAKSTDYSDGLMYTFA 477
            +LA+E K   R +  +S D +D L+ TF+
Sbjct: 523 -KLALEDKRETRRRLGRSPDLADALLITFS 551


>gi|294663744|gb|ADF29298.1| terminase [Pseudomonas phage JG024]
          Length = 460

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/453 (13%), Positives = 128/453 (28%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + +  ++    +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                      +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKSTGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDSCVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D +       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G VI  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGDDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLAKLKGASVTYDSI 300

Query: 378 NTGARTCDYLEMLG-----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
             GA        L      + +                           + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMA-------DWLEFASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A       + +E   +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|330958838|gb|EGH59098.1| hypothetical protein PMA4326_09820 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 512

 Score =  161 bits (406), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 86/485 (17%), Positives = 145/485 (29%), Gaps = 66/485 (13%)

Query: 46  EGFSAPRSW---QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLM 102
           EG   P  W   Q E  + ++               +  +  GR  G +T  A       
Sbjct: 28  EGQILPFVWNDAQRELHKRLEEQL------SLTGWVRAIVLKGRQQGISTYVAARFYKRT 81

Query: 103 STRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
           S   G   + L         TL+     +  L                    S       
Sbjct: 82  SMNFGKRTMIL-THLDAATQTLFGMAKTFFELS--------DDTLRPTTKANSGTELSFA 132

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            + S +      +    R DT    H +      N +      ++           ++  
Sbjct: 133 KLRSGYKVATAGSPGAGRSDTIQFLHASEMAFWANAQ-----KIMAGLGQTVPLIDDSEA 187

Query: 223 FWIMTSNPRRL-SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPS----------------- 264
               T+N       +F+++      D+    I      G   +                 
Sbjct: 188 IIESTANGMGNLFHQFWQLAVAGKSDYMAVFIPWFVESGYRRAVPKDFELSEEDYEYMEA 247

Query: 265 ---FHEGIIARYGLDSDVTRVEVCG---QFPQQDIDSF--------IPLNIIEEALNREP 310
                E +  R G  S     +V     ++P     +F        I    +  A  +E 
Sbjct: 248 YGLDEEQMAWRAGKISSDFANDVDFFNQEYPATPDLAFQKVGHKPLIKTVKVSLARKKEI 307

Query: 311 CPDPY-APLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISG-LVEKYR 368
             +      ++G D A  GGD +  + R+G V   +   +  D      + +  L++   
Sbjct: 308 KHERRIGAHVVGLDPAR-GGDTSTFIHRQGRVAWGIERNNIPDTMAVVGQAARMLMDDKT 366

Query: 369 PDAIIIDANNTGARTCDYLEMLGY--HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF 426
              + ID    GA   D L  LG+   V  V     A D     N+R E+  +MA+W+  
Sbjct: 367 IRMMFIDIGGLGAGIYDRLVELGFGDRVTAVNFGSSASDSRKYANKRCEMWGEMAEWIHD 426

Query: 427 A---SLINHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAENP 480
               S+ +   L  +L S       + G+L +  K   + K  +S D  D L  TFAE  
Sbjct: 427 DITPSIPDDDQLHSDLTSAAKDKYTSNGQLKLLPKEDAKKKIGRSPDDGDALALTFAEPV 486

Query: 481 PRSDM 485
              D 
Sbjct: 487 SADDE 491


>gi|126011061|ref|YP_001039811.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
 gi|119712637|gb|ABL96858.1| TerL-like protein [Burkholderia ambifaria phage BcepF1]
          Length = 459

 Score =  160 bits (405), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/450 (12%), Positives = 121/450 (26%), Gaps = 71/450 (15%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW 140
           A+  GR   K+   A   ++L      +  +C    + ++  +++  +            
Sbjct: 20  ALYGGRASSKSHDAAGFAVYLA-RNYTVKFLCARQFQNKISESVYTLIK----------- 67

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
                 +     +   +           +       +     +  G        +  +EA
Sbjct: 68  -GKIDAAGWTKEFDVTISSIRHKKTGAEFLFYGIARNLNEIKSTEGV-----DILWLEEA 121

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKR-FQIDTRTVE 259
               +     I   +    +  + I   NP + +   Y+ F           QI+     
Sbjct: 122 QYLTEEQWNVINPTIRREGSQIWLI--WNPDQYTDFIYQNFVVNPPADCLSKQINWTENP 179

Query: 260 GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAP 317
            +  +  + I   Y  D  +      G        + I L  +  A++            
Sbjct: 180 FLSDTMLKVIYDEYQRDPKLAEHVYGGAPKMGGDKAIIQLQYVLAAIDAHKKLGWKIEGS 239

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDA 376
              G DIA++G D   +V   G V+    +W   +     +          +  +II D+
Sbjct: 240 KRTGFDIADDGDDANAIVDAIGNVVVWAEEWDGLEDELLKSSTKVFNHALEKGSSIIFDS 299

Query: 377 NNTGARTCDYLEMLG----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
              GA        L       +                           + E   N + +
Sbjct: 300 IGVGAHAGSKFSELNEARSLEIIYEPFNAGGAVYDPDGTYMKLPHVVITNREHFSNVKAQ 359

Query: 416 LHVKMADWLEF-------ASLINHSGLI---------------QNLKSLKSFIVPNTGEL 453
           +  ++A             +   H  LI               +   +     V   G+ 
Sbjct: 360 MWDRVATRFRKTYEVVTYGANHPHDELISISSEHVPAKILDKLKIELASPHKDVDGMGKF 419

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAEN 479
            +ESK+     +G KS + +D  +    + 
Sbjct: 420 KVESKKDMREKRGIKSPNIADAFIMAMIQP 449


>gi|213423381|ref|ZP_03356369.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 414

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/422 (14%), Positives = 119/422 (28%), Gaps = 64/422 (15%)

Query: 110 VICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           V C A    Q++  +   V   L +  ++              +          +    +
Sbjct: 1   VFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH--------RFRILNNKIINRVTGSEF 49

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
                  + E   +  G        +  +EA    +     +   + +  +   W + + 
Sbjct: 50  VFYGLWRNIEEIKSLEGI-----DVLWLEEAHALTEYQWKILEPTIRKEGSE-CWFIFNP 103

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
                  +      P +D    +I+      +  +  + I A    D +       G   
Sbjct: 104 GLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPE 163

Query: 290 QQDIDSFIPLNIIEEALNREPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
             D  + I L+ IE A++     D  P     +G D+A+ G D    V R G VI    +
Sbjct: 164 SDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADE 223

Query: 348 WSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYR 396
           W   +     +          R   I+ D+   GA        +             V  
Sbjct: 224 WKAKEDELLKSCQRTYQAAMERDADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNY 283

Query: 397 VLGQKRA------------VDLEFCRNRRTELHVKMADWLEFA-SLINH--SGLIQNLKS 441
                 A             + +F  N + +    +AD      + IN+    L+  L S
Sbjct: 284 QRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELIS 343

Query: 442 L----------------KSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPR 482
           +                        G + +ESK+    +   S + +D  +  FA     
Sbjct: 344 IDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTS 403

Query: 483 SD 484
            D
Sbjct: 404 LD 405


>gi|218148543|ref|YP_002364311.1| terminase, large subunit [Pseudomonas phage 14-1]
 gi|218059739|emb|CAU13815.1| terminase, large subunit [Pseudomonas phage 14-1]
          Length = 460

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 60/453 (13%), Positives = 129/453 (28%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + +  ++    +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                 I    +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKITGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDSCVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D +       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G VI  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLAKMKGASVTYDSI 300

Query: 378 NTGARTCDYLEMLG-----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
             GA        L      + +                           + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDIYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMA-------DWLEFASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A       + +E   +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|85059798|ref|YP_455500.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84780318|dbj|BAE75095.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 483

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 60/428 (14%), Positives = 123/428 (28%), Gaps = 61/428 (14%)

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
            P  +K A   GRG GK+   A L++     R G      A            E    ++
Sbjct: 13  QPHRYKIA-KGGRGSGKSWAIARLLVE--IARRGTYRFLCA-----------REFQASMA 58

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               +   +      +   +     +         +       +  +  +  G       
Sbjct: 59  DSVIQLIADTIQREGYLKEFEIQKAYIRHLATDSLFMFYGIKNNVTKIKSLEGI-----D 113

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
               +EA          ++  + +  +   W+  +    L   +      PLDD     +
Sbjct: 114 IAWVEEAEAVTKESWDILIPTIRKPGSE-IWVSFNPKNILDDTYQRFVVNPLDDICLLTV 172

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP- 312
                          +      D D+      G+       + I    I  A++      
Sbjct: 173 HYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAAVDAHMTLG 232

Query: 313 -DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
            D      +G D+A+EG D   +   +G V+  L +W + D+  ++N+++    +     
Sbjct: 233 FDAVGEKRLGFDVADEGEDCNALCFVQGSVVLDLDEWHRGDVIASSNRVNRYAIERGITC 292

Query: 372 IIIDANNTGARTCDYLEML-GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVK 419
           II D+   GA    +L+ +   +V      +              + +   N + +    
Sbjct: 293 IIYDSIGVGAGVKAHLKRIAAINVKGFNAGEAVKDPDALYMPGKTNKDMFANIKAQAWWA 352

Query: 420 MADWL--------------EFASLINHSGLI-------------QNLKSLKSFIVPNTGE 452
           + +                + A L     LI             +   S       N G 
Sbjct: 353 VRERFYKTWRCIEAKKQDPKAALLYPTDELISLSTTNIKRLEYLKAELSRPRVDYDNNGH 412

Query: 453 LAIESKRV 460
           + +ESK+ 
Sbjct: 413 VKVESKKD 420


>gi|213161040|ref|ZP_03346750.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
          Length = 421

 Score =  160 bits (403), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 61/429 (14%), Positives = 118/429 (27%), Gaps = 64/429 (14%)

Query: 103 STRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
                    C A    Q++  +   V   L +  ++              +         
Sbjct: 1   MANKYSLRFCCA---RQIQNKIEESVYTLLKIQIDRFGLRH--------RFRILNNKIIN 49

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +    +       + E   +  G        +  +EA    +     +   + +  +  
Sbjct: 50  RVTGSEFVFYGLWRNIEEIKSLEGI-----DVLWLEEAHALTEYQWKILEPTIRKEGSE- 103

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
            W + +        +      P +D    +I+      +  +  + I A    D +    
Sbjct: 104 CWFIFNPGLVTDFVWRNFVVDPPEDTLIRKINYDENPFLSDTMLKVIDAARRRDPEGFVH 163

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGP 340
              G     D  + I L+ IE A++     D  P     +G D+A+ G D    V R G 
Sbjct: 164 VYEGVPESDDDAAIIKLSWIEAAVDAHKVLDFGPEGRKRIGFDVADSGADKCANVYRYGS 223

Query: 341 VIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTGARTCDYLEMLG-------- 391
           VI    +W   +     +          R   I+ D+   GA        +         
Sbjct: 224 VIYWADEWKAKEDELLKSCQRTYQAAMERDADIVYDSIGVGASAGAKFSEINDDRKRENA 283

Query: 392 --YHVYRVLGQKRA------------VDLEFCRNRRTELHVKMADWLEFA-SLINH--SG 434
               V        A             + +F  N + +    +AD      + IN+    
Sbjct: 284 YARRVNYQRFNAGAGVHEPDDEYNGIPNKDFFANLKAQAWWLVADRFRNTFNAINNGEQY 343

Query: 435 LIQNLKSL----------------KSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYT 475
           L+  L S+                        G + +ESK+    +   S + +D  +  
Sbjct: 344 LVDELISIDSRCPLLEKLKLELTTPHRDFDRNGRVMVESKKDLAKRDIPSPNVADAFIMA 403

Query: 476 FAENPPRSD 484
           FA      D
Sbjct: 404 FAPTDTSLD 412


>gi|218457805|ref|YP_002418810.1| terminase, large subunit [Pseudomonas phage SN]
 gi|218379073|emb|CAT99652.1| terminase, large subunit [Pseudomonas phage SN]
          Length = 460

 Score =  160 bits (403), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 59/453 (13%), Positives = 128/453 (28%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + +  ++    +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                      +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKSTGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDSCVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D +       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G VI  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLAKVKGASVTYDSI 300

Query: 378 NTGARTCDYLEMLG-----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
             GA        L      + +                           + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMA-------DWLEFASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A       + +E   +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|197261331|ref|YP_002154147.1| putative terminase, large subunit [Pseudomonas phage LBL3]
 gi|197244421|emb|CAR31156.1| putative terminase, large subunit [Pseudomonas phage LBL3]
          Length = 460

 Score =  159 bits (401), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 60/453 (13%), Positives = 128/453 (28%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + ++L      +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAVYLA-ANYRLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                      +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKRTGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDSCVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D +       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G VI  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLAKMKGASVTYDSI 300

Query: 378 NTGARTCDYLEMLG-----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
             GA        L      + +                           + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDIYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMA-------DWLEFASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A       + +E   +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|293396491|ref|ZP_06640767.1| phage terminase large subunit [Serratia odorifera DSM 4582]
 gi|291420755|gb|EFE94008.1| phage terminase large subunit [Serratia odorifera DSM 4582]
          Length = 430

 Score =  159 bits (401), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/434 (12%), Positives = 119/434 (27%), Gaps = 70/434 (16%)

Query: 101 LMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHC 160
            +S +  +  +C    + +++ +++A +   +     +H F +    +            
Sbjct: 4   FLSDKYRLRFLCTRQIQNKIEESVYALLKIQIERFGLRHRFRILDNKI------------ 51

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
            +   +         +                  + N+EA    +     +   + +  +
Sbjct: 52  -INRFTGSEFMFYGLWRHVDEIKS----LESIDVLWNEEAHAMTEAQWEVLEPTIRKEGS 106

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
             +++           +      P  D    +I+      +  +    I A    D+++ 
Sbjct: 107 ECWFLFNPRLTTDF-VWRNFVVAPPPDTLVRKINYDENPFLSRTIMNVIEAAKARDAEMF 165

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRR 338
                G     D ++ I L+ IE A++       +P     +G D+A+ G D    V   
Sbjct: 166 EHVYLGMPRTDDDEAIIKLSWIEAAVDAHKALNIEPAGHRRVGFDVADSGADKCANVYAH 225

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDANNTGARTCDYLEMLG------ 391
           G V     +W   +     +      V   R  AII D+   GA +      +       
Sbjct: 226 GSVALWADEWKAREDELMKSCKRTYNVALEREAAIIYDSIGVGASSGSKFAEINEERESA 285

Query: 392 -----YHVYRVLGQKRA-------------VDLEFCRNRRTELHVKMADWLEF------- 426
                  V                       + +F  N + +    +AD           
Sbjct: 286 SDWNVRTVDYFKFNAGGAVFEPERDYQPGITNKDFFANIKAQAWWLVADRFRNTYNVING 345

Query: 427 ---ASLINHSGLIQN------------LKSLKSFIVPNTGELAIESK---RVKGAKSTDY 468
                      LI                S         G + +E+K   + +   S + 
Sbjct: 346 KEKRESFADDQLISIDSACPLLDKLKFELSTPKRDFDKNGRVKVETKDDLKKRDIPSPNV 405

Query: 469 SDGLMYTFAENPPR 482
           +D  +  FA     
Sbjct: 406 ADAFIMAFAPIETP 419


>gi|197261421|ref|YP_002154236.1| putative terminase, large subunit [Pseudomonas phage LMA2]
 gi|197244511|emb|CAR31245.1| putative terminase, large subunit [Pseudomonas phage LMA2]
          Length = 460

 Score =  159 bits (401), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/453 (13%), Positives = 129/453 (28%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + +  ++    +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAV-FLAANYKLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                 I    +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKITGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDSCVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D +       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDREQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G +I  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGEDANATTLMHGNIIMEVDEWDGLEDELLKSSSRVYNLAKMKGTSVTYDSI 300

Query: 378 NTGARTCDYLEMLG-----YHVYRVLGQKRA-----------------VDLEFCRNRRTE 415
             GA        L      + +                           + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDASPDFKLIYDPFNAGGAVDKPDDVYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMA-------DWLEFASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A       + +E   +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVEHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|323175059|gb|EFZ60673.1| phage terminase large subunit [Escherichia coli LT-68]
          Length = 399

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/336 (14%), Positives = 94/336 (27%), Gaps = 48/336 (14%)

Query: 190 TYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
                +  +EA    +     +   + +  +   W + +        +      P +   
Sbjct: 50  EGIDVLWLEEAHALTEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTL 108

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +I+      +  +  + I A    D D  +    G     D  + I L+ IE A++  
Sbjct: 109 IRKINYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAH 168

Query: 310 PCP--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEK 366
                +P     +G D+A+ G D    V R G V+    +W   +     +         
Sbjct: 169 KTLNFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAAL 228

Query: 367 YRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRA------------V 404
            R   I+ D+   GA        +             V        A             
Sbjct: 229 EREADIVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIP 288

Query: 405 DLEFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSF 445
           + +F  N + +    +AD        +          LI                +    
Sbjct: 289 NKDFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHR 348

Query: 446 IVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAE 478
                G + +ESK+    +   S + +D  +  FA 
Sbjct: 349 DFDRNGRVMVESKKDLAKREIPSPNVADAFIMAFAP 384


>gi|289581321|ref|YP_003479787.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
 gi|289530874|gb|ADD05225.1| hypothetical protein Nmag_1649 [Natrialba magadii ATCC 43099]
          Length = 602

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/503 (13%), Positives = 144/503 (28%), Gaps = 93/503 (18%)

Query: 50  APRSWQLEFMEVVDAHCLNSVN----NPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTR 105
              +W  + +E      +               +  +    G+GK+ + A + +  ++ R
Sbjct: 23  GDETWLEDAIEDYLGITVTGAQAQICRGIAANERLLVVTANGLGKSYILAAITIVWLTVR 82

Query: 106 PGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
                   + +E ++K T                     +    P  + S      +  +
Sbjct: 83  YPACSFATSGTERKMKRTY----------CKPVENLHGDARVPLPGEYKSRPERIEIDGE 132

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS-GTPDVINLGILGFLTERNANRFW 224
            +H+       S +      G H  Y +AII +         +   +   +T+       
Sbjct: 133 PEHFFEAA---SPQDAGELEGVHAAYTLAIIEEADKKDVDAEVLDAMKSLVTDEQDRIIA 189

Query: 225 IMTSN--PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID-------------------- 262
           I               +  + P   W+  +  +     +                     
Sbjct: 190 IANPPKDETNSIYPILDEQDDPTSKWEVLEFSSFDSHNVQVELGNVDDEKVDGLASLHKI 249

Query: 263 -PSFHEGIIARYG---------------------------LDSDVTRVEVCGQFPQQDID 294
              + +     +                             D+   R ++  ++ ++   
Sbjct: 250 QDDWEDYNKEPWPGAETARTLSAPKLDADGNPVFSHSDALEDNPEFRTDLDQRWYRRRAG 309

Query: 295 SFIP----------LNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEH 344
              P          ++ +  A  R+  P    P   G D+A +GGD T V+   G V+E 
Sbjct: 310 IIPPGGASKNRPFTIDDVNAAWGRDWQPV-GRPQATGIDVARDGGDRTPVISVDGDVLEV 368

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV 404
            ++    D     + ++ ++E    + + IDA   G+   D +        R      A 
Sbjct: 369 RYEEPCHDYTAHADDVTDVLEDDPDNPMPIDAVGEGSGFADIMHQRFPETIRFKSLGVAE 428

Query: 405 DLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSL------KSFIVPNTGE-----L 453
           D    ++   E    +  WL+    IN   L + L         +   + + G      L
Sbjct: 429 DSANYKDCWAEGVALLGKWLQNGGSINDRTLREELLVAARTLEYEETHIGSRGTNGEDVL 488

Query: 454 AIESK---RVKGAKSTDYSDGLM 473
            +  K   + +  +S DY D  M
Sbjct: 489 KLTPKEKVKERLGRSPDYLDASM 511


>gi|149408318|ref|YP_001294421.1| conserved hypothetical protein ORF004 [Pseudomonas phage F8]
 gi|219523873|ref|YP_002455934.1| terminase large subunit [Pseudomonas phage PB1]
 gi|190333469|gb|ACE73724.1| terminase large subunit [Pseudomonas phage PB1]
          Length = 460

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/453 (13%), Positives = 123/453 (27%), Gaps = 72/453 (15%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I  GR   K+     + ++L      +  +C    + ++  +++  +   +        F
Sbjct: 21  IYGGRASSKSHDAGGIAVYLA-ANYRLKFLCARQFQNRISESVYTLIKDKIENSEYNGEF 79

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                                      +       +     +  G        +  +EA 
Sbjct: 80  IFTK------------NSIKHKRTGSEFLFYGIARNLSEIKSTEGI-----DILWLEEAH 122

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEG 260
                    I   + + N+  + I   NP  ++   Y+ F  KP  D     I+      
Sbjct: 123 YLTQEQWEVIEPTIRKENSEIWIIF--NPNEVTDFVYQNFVVKPPKDAFVKMINWNENPF 180

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPL 318
           +  +  + I   Y  D D       G        S I L  I  A++       +P    
Sbjct: 181 LSETMLKVIHEAYERDKDQAEHIYGGIPKTGGDKSVINLKFILAAIDAHKKLGWEPAGSK 240

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDAIIIDAN 377
            +G D+A++G D     L  G VI  + +W   +     +      + K +  ++  D+ 
Sbjct: 241 RIGFDVADDGEDANATTLMHGNVIMEVDEWDGLEDELLKSSSRVYNLAKMKGASVTYDSI 300

Query: 378 NTGARTCDYLEMLG-------YHVYRVLGQKR---------------AVDLEFCRNRRTE 415
             GA        L                                    + +   N + +
Sbjct: 301 GVGAHVGSKFAELNDSSPDFKLTYDPFNAGGAVDKPDDIYMKLPHTTIKNKDHFSNIKAQ 360

Query: 416 LHVKMADWLE-------FASLINHSGLIQ------------NL---KSLKSFIVPNTGEL 453
              ++A              +     LI              L    S     +   G  
Sbjct: 361 KWEEVATRFRKTYEAVVHGKVYPFDELISINSETIHPDKLNQLCIELSSPRKDLDMNGRF 420

Query: 454 AIESKR----VKGAKSTDYSDGLMYTFAENPPR 482
            +ESK+     +  KS + +D ++ +      +
Sbjct: 421 KVESKKDMREKRKIKSPNIADSVIMSAILPIRK 453


>gi|332091158|gb|EGI96248.1| phage terminase large subunit [Shigella dysenteriae 155-74]
          Length = 346

 Score =  156 bits (393), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 48/332 (14%), Positives = 94/332 (28%), Gaps = 48/332 (14%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
            +  +EA    +     +   + +  +   W + +        +      P +     +I
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEGTLIRKI 59

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP- 312
           +      +  +  + I A    D D  +    G     D  + I L+ IE A++      
Sbjct: 60  NYDENPFLSDTMLKVIDAARRRDPDGFKHVYEGVPESDDDAAIIKLSWIEAAVDAHKTLN 119

Query: 313 -DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPD 370
            +P     +G D+A+ G D    V R G V+    +W   +     +          R  
Sbjct: 120 FEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREA 179

Query: 371 AIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEF 408
            I+ D+   GA        +             V        A             + +F
Sbjct: 180 DIVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDF 239

Query: 409 CRNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPN 449
             N + +    +AD        +          LI                +        
Sbjct: 240 FANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDR 299

Query: 450 TGELAIESKR---VKGAKSTDYSDGLMYTFAE 478
            G + +ESK+    +   S + +D  +  FA 
Sbjct: 300 NGRVMVESKKDLAKREIPSPNVADAFIMAFAP 331


>gi|213426918|ref|ZP_03359668.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 374

 Score =  154 bits (389), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 54/342 (15%), Positives = 100/342 (29%), Gaps = 48/342 (14%)

Query: 190 TYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWK 249
                +  +EA    +     +   + +  +   W + +        +      P +D  
Sbjct: 25  EGIDVLWLEEAHALTEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEDTL 83

Query: 250 RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE 309
             +I+      +  +  + I A    D +       G     D  + I L+ IE A++  
Sbjct: 84  IRKINYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAH 143

Query: 310 PCPD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEK 366
              D  P     +G D+A+ G D    V R G VI    +W   +     +         
Sbjct: 144 KVLDFGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAM 203

Query: 367 YRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRA------------V 404
            R   I+ D+   GA        +             V        A             
Sbjct: 204 ERDADIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIP 263

Query: 405 DLEFCRNRRTELHVKMADWLEFA-SLINH--SGLIQNLKSL----------------KSF 445
           + +F  N + +    +AD      + IN+    L+  L S+                   
Sbjct: 264 NKDFFANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHR 323

Query: 446 IVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
                G + +ESK+    +   S + +D  +  FA      D
Sbjct: 324 DFDRNGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 365


>gi|157265379|ref|YP_001467938.1| terminase large subunit [Thermus phage P23-45]
 gi|156905274|gb|ABU96918.1| terminase large subunit [Thermus phage P23-45]
          Length = 485

 Score =  153 bits (387), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/457 (15%), Positives = 144/457 (31%), Gaps = 45/457 (9%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E +     H   +++    +  + A   GR  GK+   +   ++ +  RPG     +A +
Sbjct: 12  ELLGYKPHHVQLAIHRSTAK-RRVACL-GRQSGKSEAASVEAVFELFARPGSQGWIIAPT 69

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
             Q +      V K   L       E+Q                     +K  +T    +
Sbjct: 70  YDQAEIIFGRVVEKVERLAEVFPATEVQLQRRRLRLLVHHYDRPVNAPGAKRVAT--SEF 127

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSG 235
             +  D            +I DEA+  P  V +  I   L+ R+     I T        
Sbjct: 128 RGKSADRPDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDGWALIISTPKGLNWFY 187

Query: 236 KFYEIF--------------NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
           +F+ +               N+   D++ F   +  V      ++  +  R  +     R
Sbjct: 188 EFFLMGWRGGLKEGIPNSGVNQTHPDFESFHAASWDVWPERREWY--MERRLYIPDLEFR 245

Query: 282 VEVCGQFPQQDIDSFIPLNII----EEALNREPCPDPYAP---LIMGCDIAEEGGDN--T 332
            E   +F       F  L+++     E        + Y P     +G D  +    +  +
Sbjct: 246 QEYGAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFS 305

Query: 333 VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY 392
           V+ L  G ++  L   +         ++  L E Y    ++ D    G    + L+  G 
Sbjct: 306 VLDLDTGAIV-CLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGI 364

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS--LINHSGLIQNLKSLKSFIVPNT 450
           +   +  +  +V  +   N        +A  +E     + N   ++  L++ + +   + 
Sbjct: 365 NYTPLPVKSSSVKEQLISN--------LALLMEKGQVAVPNDKTILDELRNFRYYRTASG 416

Query: 451 GELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            ++     R  G    D    L   +++   +    F
Sbjct: 417 NQVM----RAYGRGHDDIVMSLALAYSQYEGKDGYKF 449


>gi|157265496|ref|YP_001468054.1| phage terminase large subunit [Thermus phage P74-26]
 gi|156905391|gb|ABU97034.1| phage terminase large subunit [Thermus phage P74-26]
          Length = 485

 Score =  153 bits (387), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/457 (15%), Positives = 144/457 (31%), Gaps = 45/457 (9%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E +     H   +++    +  + A   GR  GK+   +   ++ +  RPG     +A +
Sbjct: 12  ELLGYKPHHVQLAIHRSTAK-RRVACL-GRQSGKSEAASVEAVFELFARPGSQGWIIAPT 69

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
             Q +      V K   L       E+Q                     +K  +T    +
Sbjct: 70  YDQAEIIFGRVVEKVERLAEVFPATEVQLQRRRLRLLVHHYDRPVNAPGAKRVAT--SEF 127

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGTP-DVINLGILGFLTERNANRFWIMTSNPRRLSG 235
             +  D            +I DEA+  P  V +  I   L+ R+     I T        
Sbjct: 128 RGKSADRPDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDGWALIISTPKGLNWFY 187

Query: 236 KFYEIF--------------NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
           +F+ +               N+   D++ F   +  V      ++  +  R  +     R
Sbjct: 188 EFFLMGWRGGLKEGIPNSGINQTHPDFESFHAASWDVWPERREWY--MERRLYIPDLEFR 245

Query: 282 VEVCGQFPQQDIDSFIPLNII----EEALNREPCPDPYAP---LIMGCDIAEEGGDN--T 332
            E   +F       F  L+++     E        + Y P     +G D  +    +  +
Sbjct: 246 QEYGAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFS 305

Query: 333 VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY 392
           V+ L  G ++  L   +         ++  L E Y    ++ D    G    + L+  G 
Sbjct: 306 VLDLDTGAIV-CLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGI 364

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS--LINHSGLIQNLKSLKSFIVPNT 450
           +   +  +  +V  +   N        +A  +E     + N   ++  L++ + +   + 
Sbjct: 365 NYTPLPVKSSSVKEQLISN--------LALLMEKGQVAVPNDKTILDELRNFRYYRTASG 416

Query: 451 GELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            ++     R  G    D    L   +++   +    F
Sbjct: 417 NQVM----RAYGRGHDDIVMSLALAYSQYEGKDGYKF 449


>gi|289829424|ref|ZP_06547036.1| putative prophage terminase large subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 346

 Score =  153 bits (386), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 54/338 (15%), Positives = 100/338 (29%), Gaps = 48/338 (14%)

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
            +  +EA    +     +   + +  +   W + +        +      P +D    +I
Sbjct: 1   MLWLEEAHALTEYQWKILEPTIRKEGSE-CWFIFNPGLVTDFVWRNFVVDPPEDTLIRKI 59

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
           +      +  +  + I A    D +       G     D  + I L+ IE A++     D
Sbjct: 60  NYDENPFLSDTMLKVIDAARRRDPEGFVHVYEGVPESDDDAAIIKLSWIEAAVDAHKVLD 119

Query: 314 --PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPD 370
             P     +G D+A+ G D    V R G VI    +W   +     +          R  
Sbjct: 120 FGPEGRKRIGFDVADSGADKCANVYRYGSVIYWADEWKAKEDELLKSCQRTYQAAMERDA 179

Query: 371 AIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEF 408
            I+ D+   GA        +             V        A             + +F
Sbjct: 180 DIVYDSIGVGASAGAKFSEINDDRKRENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDF 239

Query: 409 CRNRRTELHVKMADWLEFA-SLINH--SGLIQNLKSL----------------KSFIVPN 449
             N + +    +AD      + IN+    L+  L S+                       
Sbjct: 240 FANLKAQAWWLVADRFRNTFNAINNGEQYLVDELISIDSRCPLLEKLKLELTTPHRDFDR 299

Query: 450 TGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSD 484
            G + +ESK+    +   S + +D  +  FA      D
Sbjct: 300 NGRVMVESKKDLAKRDIPSPNVADAFIMAFAPTDTSLD 337


>gi|148826888|ref|YP_001291641.1| phage terminase large subunit [Haemophilus influenzae PittGG]
 gi|148718130|gb|ABQ99257.1| predicted phage terminase large subunit [Haemophilus influenzae
           PittGG]
          Length = 366

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/357 (14%), Positives = 119/357 (33%), Gaps = 37/357 (10%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG GK+   A  ++      P + V+C    +  +  ++   ++  + +L  + +F++
Sbjct: 27  GGRGSGKSFSIARALVLRAYQSP-VRVLCCREIQKSISDSVIQMLADQIEMLGLRAFFDV 85

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
           Q   +             +G +   ++      +     +  G        +  +E    
Sbjct: 86  QKTQI-------------IGQNGSRFTFAGLKTNITSIKSMTGI-----DVVWVEEGENV 127

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN-KPLDDWKRFQIDTRTVEGID 262
                  ++  + E  +    I++ NP+ +    Y+ F   P +  K   ++ +      
Sbjct: 128 SKESWDILIPTIREDGSQ--IIVSFNPKNILDDTYQRFVIHPPERCKSVLVNWQDNPYFP 185

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIM 320
               E +      D ++ R    G+       + I    IE A++              +
Sbjct: 186 KELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKLGFTAKGMKKV 245

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           G D+A+EG D+       G V+  +  W   D+  + N+ +    K++ D II D+   G
Sbjct: 246 GFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKADLIIFDSIGVG 305

Query: 381 ARTCDYLEML--GYHVYRVLGQKRA-----------VDLEFCRNRRTELHVKMADWL 424
           A    + + L     V                     + +   N + +    + D  
Sbjct: 306 AGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKKNQDMFSNIKAQSWWALRDRF 362


>gi|161525001|ref|YP_001580013.1| hypothetical protein Bmul_1828 [Burkholderia multivorans ATCC
           17616]
 gi|189350256|ref|YP_001945884.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
 gi|160342430|gb|ABX15516.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334278|dbj|BAG43348.1| bacteriophage TerL protein [Burkholderia multivorans ATCC 17616]
          Length = 531

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 75/519 (14%), Positives = 139/519 (26%), Gaps = 73/519 (14%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVV 62
             +  NP     L      +               WG    P        +     +   
Sbjct: 26  NRIRANPSVLPALRTFYRENP--------AQFIIDWGMTFDPRNVERGLPATIPFLLFPK 77

Query: 63  DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT 122
                            G     R +G + L   L   +     G++    +  E  +  
Sbjct: 78  QEEWCQWFMERWKAQEPGITEKTRDMGMSWLTVGLADTICLFHEGVAAGFGSRKEEYVDK 137

Query: 123 TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
               +   W +          + L L PA +       +     +       T S    +
Sbjct: 138 IGSPKSLFWKAR---------EFLRLLPAEFRGSWDIGTHAPHMRIIF--PDTGSVITGE 186

Query: 183 TFVGH-HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
           +  G          I DE++         +   L+     R  I T N    S       
Sbjct: 187 SGDGIGRGDRASFYIVDESAFL--ERPQLVDASLSATTNCRQDISTPNGMGNS----FAQ 240

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI 301
            +     K F    R     D +++    A   LD  V   E+   +        IP   
Sbjct: 241 RRHSGKVKVFTFHWRDDPRKDDAWYAKQCAE--LDPVVVAQEIDINYAASVEGVVIPSAW 298

Query: 302 IEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTN 357
           ++ A+        +P      G D+A+EG D      R G ++  L  WS    D+  T 
Sbjct: 299 VQAAIGAHLKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLNFLRSWSGKGGDIYETV 358

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--------YHVYRVLGQKRAV----- 404
            K  G+ ++   ++   DA+  GA       ++           +     +         
Sbjct: 359 EKTFGICDELGYESFDYDADGLGAGVRGDARVINEQRIAIGKRPINDEPFRGSGPVHDPE 418

Query: 405 --------DLEFCRNRRTELHVKMADWLE-------FASLINHSGLIQ------------ 437
                   + ++  N + +    +    +            N   +I             
Sbjct: 419 GEMVPERKNKDYFANLKAQSWWALRLRFQATYRAVVEGKPYNPDDIISIDPELKELAALT 478

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
              S  ++ V   G++ I  K   G KS + +D +M  +
Sbjct: 479 MELSQPTYTVNGVGKIVI-DKAPDGTKSPNLADAVMIAY 516


>gi|307544683|ref|YP_003897162.1| hypothetical protein HELO_2093 [Halomonas elongata DSM 2581]
 gi|307216707|emb|CBV41977.1| K06909 [Halomonas elongata DSM 2581]
          Length = 531

 Score =  150 bits (377), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 66/446 (14%), Positives = 130/446 (29%), Gaps = 67/446 (15%)

Query: 86  RGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQS 145
           R +G + L   L   +    PG++V   +  E  +                 K  FE   
Sbjct: 101 RDMGMSWLTIGLGCTVCLHHPGMAVGFGSRKEEYVDKIGSP-----------KSLFEKAR 149

Query: 146 LSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH-HNTYGMAIINDEASGTP 204
             +   P                      T S    ++  G          I DE++   
Sbjct: 150 SFMSMLPREFRGGWERKRHAPHMRIMFPETESVMTGESGDGIGRGDRTGFYIVDESAFLE 209

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPS 264
               +      T           S P  +   F +  +        F    R     D +
Sbjct: 210 RPHLVDASLSATTNCRQDV----STPNGMGNPFAQRRH--SGKISVFTFHWRDDPRKDDA 263

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGC 322
           ++   +    LD      E+   +        IP   ++ A++       +     +   
Sbjct: 264 WYAKQVDE--LDPVTVAQEIDINYSASVEGVLIPSAWVQAAVDAHKKLGIEITGERLGAL 321

Query: 323 DIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           D+A+EG D      R G +++ + +W+    D+  T  K     +++       DA+  G
Sbjct: 322 DVADEGKDQNAYAGRHGILLDLVDEWTGKGSDIFGTVQKAFDHTDEHGGSRFDYDADGLG 381

Query: 381 ARTCDYLEMLG----------YHVYRVLGQK-----------RAVDLEFCRNRRTELHVK 419
           +       ++             V    G             +  + +F  N + +    
Sbjct: 382 SGVRGDARVINEQRAEQKRPKLKVNPFRGSGGVIEPDKEMVPKRKNKDFFANLKAQAWWA 441

Query: 420 MADWLE--------------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESKR 459
           +    +                     + L   S L+  L S  ++ V  TG++ +  K 
Sbjct: 442 LRLRFQRTYRAVVEGMEFDPDDIISIDSRLPILSKLMLEL-SQPTYHVNGTGKVVV-DKA 499

Query: 460 VKGAKSTDYSDGLMYTFAENPPRSDM 485
            +G KS + +D +M  +A N   +D 
Sbjct: 500 PEGTKSPNLADAVMILYAPNKSVTDR 525


>gi|315649222|ref|ZP_07902312.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
 gi|315275441|gb|EFU38799.1| hypothetical protein PVOR_28644 [Paenibacillus vortex V453]
          Length = 189

 Score =  149 bits (375), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/224 (29%), Positives = 93/224 (41%), Gaps = 45/224 (20%)

Query: 14  KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNP 73
            L DL W D +   F+  ++ F               P  WQ + M  V           
Sbjct: 10  DLLDLYWDDPVA--FAEDMMGFD--------------PDDWQCDVMMDV----------- 42

Query: 74  NPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLS 133
             +  + ++ +G+G+GKT L A LV+W +  RP   V+C A ++ QL   LW EVSKWL 
Sbjct: 43  -TQFPRTSVRSGQGVGKTGLEAALVIWFLCCRPNPKVVCTAPTKQQLHDVLWTEVSKWLE 101

Query: 134 LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
               K+  +     ++                 + +    RT +  +P+   G H  Y M
Sbjct: 102 NSMVKNLLKWTKTKVYMIG------------HEQRWFATARTAN--KPENMQGFHEDY-M 146

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
             I DEASG  D I   ILG L+   A    +M  NP R SG F
Sbjct: 147 LFIVDEASGVSDPIMEAILGTLS--GAENKLLMCGNPTRTSGVF 188


>gi|218290759|ref|ZP_03494841.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239297|gb|EED06496.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 422

 Score =  148 bits (372), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/402 (15%), Positives = 129/402 (32%), Gaps = 43/402 (10%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           + +   H      + +   F+ A + GR  GKT   A  +       PG     +A +  
Sbjct: 16  LRLYTPHSGQVALHRSTARFRVA-TCGRRWGKTYACANEIAKWAWEHPGAMTWWVAPTYR 74

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSE 178
           Q                       + +  +    +    +  +     +           
Sbjct: 75  Q----------------------TLTAYRIITRNF-HGAIEKATTTHMRIEWKSGSITEF 111

Query: 179 ERPDTFVGHHNTYGMAIINDEASGTPDVINLG-ILGFLTERNANRFWIMTSNPRRLSGKF 237
              + F          ++ DEA+  P       +   L+++      + T   R      
Sbjct: 112 RSTENFDALRGEGLDFLVVDEAAMVPKEAWEAALRPTLSDKAGRAIIVSTPKGRNWFYHV 171

Query: 238 YEIFNKPL-DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
           +     P   +W+ F+  T     I P   E   AR  L SDV R E   +F +     F
Sbjct: 172 WARGQDPAFPEWESFRFPTLANPYIPPEEVEE--ARTTLPSDVFRQEYEAEFLEDSAGVF 229

Query: 297 IPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLR-RGPVIEHLFDWSKTDLRT 355
               I +    +E  P P    ++G D+A+    + +VV+      +  +  +++ D   
Sbjct: 230 --RGIRDCISGQEEEPQPGRRYVVGWDVAKHQDFSVLVVMDLERAHVVKMDRFNQVDYAL 287

Query: 356 TNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTE 415
              ++  + ++Y    +++DA   G    + +  +G           A         + +
Sbjct: 288 QLERVKHICQRYNNARLLMDATGVGDPLLEQVRRMGIQAEGYSLSNTA---------KQQ 338

Query: 416 LHVKMADWLEFASL--INHSGLIQNLKSLKSFIVPNTGELAI 455
           L   +A  +E   +   +   LI  L++ + + +   G +  
Sbjct: 339 LIEHLAMKIERREITFPDLPVLINELQTYQ-YEITRAGNVRY 379


>gi|293604595|ref|ZP_06686998.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
 gi|292817011|gb|EFF76089.1| phage terminase large subunit [Achromobacter piechaudii ATCC 43553]
          Length = 463

 Score =  145 bits (366), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/430 (14%), Positives = 117/430 (27%), Gaps = 59/430 (13%)

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
             GR   KT     +    ++    +  +CL   + ++  +++  V             E
Sbjct: 40  KGGRFSSKTQDAGGMAA-FLARNYSVRFLCLRQLQNRIADSVYTVVK------------E 86

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
               +     +   V      +    +       + E      G           +E  G
Sbjct: 87  KIEAAGWRDEFDIGVSTIRHKLTGSEFLFYGLARNIEEIKGTEGV-----DVCWIEEGEG 141

Query: 203 TPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-QIDTRTVEGI 261
             +     I   + +  A  + +   NP  ++          L        I+      +
Sbjct: 142 LTEEQWSIIDPTIRKEGAEVWVL--WNPHLITDFVQAKLPALLGADCIIRHINYPDNPFL 199

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLI 319
             +           D D  R    GQ    D  S I  + IE A++       +      
Sbjct: 200 SATAKRKAERLKEADPDAYRHIYLGQPLSSDDASVIKFHWIEAAVDAHLKLGIELGGART 259

Query: 320 MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
           +G D+A+ G D     +  G + + L +W+  +    N          R   ++ D+   
Sbjct: 260 VGYDVADSGADKNACSVFDGAICDELDEWAAPED-ELNQSTKRAWAHVRNGILVYDSIGV 318

Query: 380 GARTCDYLEMLGYHVYRVLGQ-------------KRAVDLEFCRNRRTELHVKMADWLEF 426
           GA     L   G                       +  + E   N + +    +AD L  
Sbjct: 319 GAHVGSTLADAGIRTGYHKFNAGGAVISPDKEYAPKIKNKEKFENLKAQAWQDVADRLRN 378

Query: 427 -------ASLINHSGLI---------QNL---KSLKSFIVPNTGELAIESKR---VKGAK 464
                    +   S LI         + L    S         G   +E+K     +G  
Sbjct: 379 TYNAVTKGMVFPASELISISSGISKLEQLKIELSAPRKRYSKRGLDMVETKEDMARRGIP 438

Query: 465 STDYSDGLMY 474
           S + +D  + 
Sbjct: 439 SPNLADSFIM 448


>gi|163716617|gb|ABY40529.1| putative TerL [Burkholderia phage Bups phi1]
          Length = 531

 Score =  145 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 77/523 (14%), Positives = 144/523 (27%), Gaps = 73/523 (13%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVV 62
           + +  NP     L      +               WG    P        +     +   
Sbjct: 26  QRIRANPGVLPALRAFYRDNP--------AQFIIDWGMTFDPRNVERGLPATIPFLLFPK 77

Query: 63  DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT 122
               +            G     R +G + L   L   +     G++    +  E  +  
Sbjct: 78  QEDWIAWFMERWRAREPGITEKTRDMGMSWLTVGLADTVCLFHEGVAAGFGSRKEEYVDK 137

Query: 123 TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
               +   W +          + L L PA +       +     +       T S    +
Sbjct: 138 IGSPKSLFWKAR---------EFLRLLPAEFRGSWDIGTHAPHMRIIF--PDTGSVITGE 186

Query: 183 TFVGH-HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
           +  G          + DE++         +   L+     R  I T N    S       
Sbjct: 187 SGDGIGRGDRASFYVVDESAFL--ERPQLVDASLSATTNCRQDISTPNGMGNS----FAQ 240

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI 301
            +     K F    R     D +++   +A   LD  V   E+   +        IP   
Sbjct: 241 RRHSGKIKVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAW 298

Query: 302 IEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTN 357
           ++ AL        +P      G D+A+EG D      R G ++EHL  WS    D+  T 
Sbjct: 299 VQAALGAHVKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTV 358

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--------YHVYRVLGQKRAV----- 404
           +++ G+ +    +    DA+  GA       +L           +     +         
Sbjct: 359 DRVLGICDVRDYEVFDYDADGLGAGVRGDARVLNEQRVAAGKRSIRNEPFRGSGPVYDPE 418

Query: 405 --------DLEFCRNRRTELHVKMADWLE-------FASLINHSGLIQ------------ 437
                   + ++  N + +    +    +            +   +I             
Sbjct: 419 GEMVKERKNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALS 478

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              S  +F V   G++ I  K   G KS + +D +M  +    
Sbjct: 479 MELSQPTFTVNGVGKIVI-DKAPDGTKSPNLADAVMIAYQPAV 520


>gi|284008456|emb|CBA74928.1| phage terminase large subunit [Arsenophonus nasoniae]
          Length = 477

 Score =  144 bits (362), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 67/459 (14%), Positives = 123/459 (26%), Gaps = 82/459 (17%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ ++ A +   +  L  ++ F +
Sbjct: 21  GGRGGMKTVSFAKIALITASINK-RRFLCLREFMNSIEDSVHAVLQAEIETLRLQNRFRI 79

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
                             +   +       +        +    H         +EA   
Sbjct: 80  LD--------------NCIKGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 121

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLS----------GKFYEIFNKPLDDWKRFQI 253
            +     ++  + +  +  ++         +              +      DD    ++
Sbjct: 122 SEKSLDILIPTIRKPGSELWFSFNPAEEDGAVYKRFVKPYKDIIDDKGYYEDDDLYVGKV 181

Query: 254 DTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP- 312
                  +              +         G+      D+ I    ++ A++      
Sbjct: 182 SYLDNPWLPEELKNDAEKMKRDNYKKWLHVYGGECDANYDDAIIQPEWVDAAIDAHIKLG 241

Query: 313 -DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
             P    ++  D A+ G D   +  R G ++E    WS+ D+     K       YR D 
Sbjct: 242 FKPKGIRVITFDPADSGQDEKALSKRYGVLVEDCVSWSEGDVADATIKAFDEAFDYRADD 301

Query: 372 IIIDANNTGARTCDYLEML----------------------------GYHVYRVLGQKRA 403
            I D    GA T                                          L     
Sbjct: 302 FIYDNIGLGAGTVKTYLRSSNDGNKMVVTGFGAGDSPDYPDEIYVPGNGEYIPSLNNDDR 361

Query: 404 VDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKSLK 443
            + +  RN+R +  V +AD         E    I+   LI               L   +
Sbjct: 362 TNRDTFRNKRAQYWVYLADRFYKTWCAVEKKEYIDPEELISLSSKIDKLSQLKSELVKQQ 421

Query: 444 SFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
               P    + + SK   R KG KS + +D LM +FA  
Sbjct: 422 RKRTPGNRLIQLISKEEMRSKGIKSPNMADTLMMSFANP 460


>gi|167725769|ref|ZP_02409005.1| hypothetical protein BpseD_42528 [Burkholderia pseudomallei DM98]
          Length = 517

 Score =  143 bits (361), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 77/523 (14%), Positives = 143/523 (27%), Gaps = 73/523 (13%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVV 62
           + +  NP     L      +               WG    P        +     +   
Sbjct: 12  QRIRANPGVLPALRAFYRDNP--------AQFIIDWGMTFDPRNVERGLPATIPFLLFPK 63

Query: 63  DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT 122
               +            G     R +G + L   L   +     G++    +  E  +  
Sbjct: 64  QEDWIAWFMERWRAREPGITEKTRDMGMSWLTVGLADTVCLFHEGVAAGFGSRKEEYVDK 123

Query: 123 TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
               +   W +          + L L PA +       +     +       T S    +
Sbjct: 124 IGSPKSLFWKAR---------EFLRLLPAEFRGSWDIGTHAPHMRIIF--PDTGSVITGE 172

Query: 183 TFVGH-HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
           +  G          + DE++         +   L+     R  I T N    S       
Sbjct: 173 SGDGIGRGDRASFYVVDESAFL--ERPQLVDASLSATTNCRQDISTPNGMGNS----FAQ 226

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI 301
            +     K F    R     D +++   +A   LD  V   E+   +        IP   
Sbjct: 227 RRHSGKIKVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAW 284

Query: 302 IEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTN 357
           ++ AL        +P      G D+A+EG D      R G ++EHL  WS    D+  T 
Sbjct: 285 VQAALGAHVKLGIEPSGTRRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTV 344

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--------YHVYRVLGQKRAV----- 404
           ++  G+ +    +    DA+  GA       +L           +     +         
Sbjct: 345 DRALGICDVRDYEVFDYDADGLGAGVRGDARVLNEQRVAAGKRSIRNEPFRGSGPVYDPE 404

Query: 405 --------DLEFCRNRRTELHVKMADWLE-------FASLINHSGLIQ------------ 437
                   + ++  N + +    +    +            +   +I             
Sbjct: 405 GEMVKERKNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALS 464

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              S  +F V   G++ I  K   G KS + +D +M  +    
Sbjct: 465 MELSQPTFTVNGVGKIVI-DKAPDGTKSPNLADAVMIAYQPAV 506


>gi|211731737|gb|ACJ10086.1| terminase [Bacteriophage APSE-5]
          Length = 469

 Score =  143 bits (361), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 76/461 (16%), Positives = 133/461 (28%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ ++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +                +   +       +        +    H         +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDTLIPTIRKPGSELWFSF--NPAEEDGAVYKRFVKPYKELIDTQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           ++       +              +    R    G+      D+ I    +E A++    
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAFDEAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY + +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGNKIVVTGFGAGDSPDYPDEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|212499721|ref|YP_002308529.1| terminase [Bacteriophage APSE-2]
 gi|238898754|ref|YP_002924436.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
 gi|211731690|gb|ACJ10178.1| terminase [Bacteriophage APSE-2]
 gi|229466514|gb|ACQ68288.1| APSE-2 prophage; terminase [Bacteriophage APSE-2]
          Length = 469

 Score =  143 bits (360), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 76/461 (16%), Positives = 133/461 (28%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ ++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +                +   +       +        +    H         +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDTLIPTIRKPGSELWFSF--NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           ++       +              +    R    G+      D+ I    +E A++    
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAFDEAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY + +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGNKIVVTGFGAGDSPDYPDEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|211731806|gb|ACJ10127.1| terminase [Bacteriophage APSE-3]
          Length = 469

 Score =  143 bits (360), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 76/461 (16%), Positives = 133/461 (28%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ ++ A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +                +   +       +        +    H         +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDTLIPTIRKPGSELWFSF--NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           ++       +              +    R    G+      D+ I    +E A++    
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAFDEAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY + +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHGNDGNKMVVTGFGAGDSPDYPDEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPEALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|238027169|ref|YP_002911400.1| hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
 gi|237876363|gb|ACR28696.1| Hypothetical protein bglu_1g15550 [Burkholderia glumae BGR1]
          Length = 531

 Score =  143 bits (360), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 77/519 (14%), Positives = 142/519 (27%), Gaps = 73/519 (14%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVV 62
           + +  NP     L      +               WG    P        +     +   
Sbjct: 26  QRIRANPGVLPALRAFYRDNP--------AQFIIDWGMTFDPRNVERGLPATIPFLLFPK 77

Query: 63  DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT 122
               +            G     R +G + L   L   +     G++    +  E  +  
Sbjct: 78  QEDWIAWFMERWRAREPGITEKTRDMGMSWLTVGLADTICLFHEGVAAGFGSRKEEYVDK 137

Query: 123 TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
               +   W +          + L L PA +       +     +       T S    +
Sbjct: 138 IGSPKSLFWKAR---------EFLRLLPAEFRGSWDIGTHAPHMRIIF--PDTGSVITGE 186

Query: 183 TFVGH-HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
           +  G          + DE++         +   L+     R  I T N    S       
Sbjct: 187 SGDGIGRGDRASFYVVDESAFL--ERPQLVDASLSATTNCRQDISTPNGMGNS----FAQ 240

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI 301
            +     K F    R     D +++   +A   LD  V   E+   +        IP   
Sbjct: 241 RRHSGKIKVFTFHWRDDPRKDDAWYAKQVAE--LDPVVVAQEIDINYAASVEGVVIPSAW 298

Query: 302 IEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTN 357
           ++ AL         P      G D+A+EG D      R G ++EHL  WS    D+  T 
Sbjct: 299 VQAALGAHVKLGISPSGARRGGLDVADEGKDKNAFAGRYGFLLEHLESWSGVGGDIFGTV 358

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG--------YHVYRVLGQKRAV----- 404
           ++  G+ +    +    DA+  GA       +L           +     +         
Sbjct: 359 DRALGICDVRGYEVFDYDADGLGAGVRGDARVLNEQRAAAGKRSIRSEPFRGSGPVYDPD 418

Query: 405 --------DLEFCRNRRTELHVKMADWLE-------FASLINHSGLIQ------------ 437
                   + ++  N + +    +    +            +   +I             
Sbjct: 419 GEMVKERKNKDYFANLKAQSWWALRLRFQATYRAVVEGKPFDPDEIISIDPDLPERAALS 478

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
              S  +F V   G++ I  K   G KS + +D +M  +
Sbjct: 479 MELSQPTFTVNGVGKIVI-DKAPDGTKSPNLADAVMIAY 516


>gi|330910791|gb|EGH39301.1| phage terminase, large subunit [Escherichia coli AA86]
          Length = 540

 Score =  143 bits (359), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 154/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTYRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ +  K+  G KS + +D +M ++A 
Sbjct: 473 SISSAMASKDKLIIELSQPTYSINGVGKIVV-DKQPDGTKSPNLADSVMISYAP 525


>gi|326783331|ref|YP_004323723.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
 gi|310005278|gb|ADO99667.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn33]
          Length = 549

 Score =  142 bits (358), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/457 (14%), Positives = 142/457 (31%), Gaps = 68/457 (14%)

Query: 8   NPETEQKLFDLMWSDEIKLSFSNFVL-HFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHC 66
           +PE  Q+        +      +F+L +          +        +Q++ ++    + 
Sbjct: 23  SPEEVQEYL------KCADDPVHFILNYIKIVSLDEGVIPFTMY--DFQVDMVKSFHDNR 74

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
            N    P            R  GK+T+    +LW +   P ++V  LAN     +  L  
Sbjct: 75  FNIAKLP------------RQSGKSTIVTAYLLWYVLFNPNVNVAILANKAATAREML-- 120

Query: 127 EVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
                      +     ++L              SL +++        T       +   
Sbjct: 121 ----------GRLQLSYENLPKWLQQGILQWNRGSLELENGSKILAAST-------SASA 163

Query: 187 HHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFYEIF 241
                   I  DE +  P    D     +   ++   +     I T +   +  K +   
Sbjct: 164 VRGMSFNVIFLDEFAFVPNHIADQFFSSVYPTVSSGKSTKVIIISTPHGMNMFYKLWHDA 223

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI 301
            +  +++   ++    V G D ++ E  I          +VE   +F     D+ I  + 
Sbjct: 224 EQGKNEYLPTEVHWSQVPGRDAAWKEQTIKNTSE--QQFKVEFECEFLGSV-DTLISPSK 280

Query: 302 IEEALNREP-----------CPDPYAPLIMGCDIAEE-GGDNTVVVLRRG----PVIEHL 345
           +      +P             +     I+  D++   G D +  V+         +   
Sbjct: 281 LRTMPYVDPVAQNKGLAIYERVEAEHNYIITVDVSRGIGNDYSAFVVVDTTTMPYKVVAR 340

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQK 401
           +  ++       N I  + + Y    I+ + N+ G +  D     LE     +  + G+ 
Sbjct: 341 YRNNEIKPIIFPNIIIDVAKNYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRA 400

Query: 402 RAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
                +    ++T+L VKM+  ++     N   LI+ 
Sbjct: 401 GQQLGQGFSGKKTQLGVKMSSAVKQVGCSNLKALIEE 437


>gi|323173153|gb|EFZ58784.1| gp33 TerL protein [Escherichia coli LT-68]
          Length = 539

 Score =  142 bits (358), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 154/534 (28%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKID-NPVIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFHPENEAVPGDNGKPARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++    TG++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNATGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|300824951|ref|ZP_07105051.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300522580|gb|EFK43649.1| conserved hypothetical protein [Escherichia coli MS 119-7]
          Length = 540

 Score =  142 bits (358), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  KI G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKIFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|332088044|gb|EGI93169.1| gp33 TerL [Shigella boydii 5216-82]
          Length = 539

 Score =  142 bits (358), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 154/534 (28%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITDK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKID-NPVIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFHPENEAVPGDNGKPARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++    TG++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNATGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|254160843|ref|YP_003043951.1| hypothetical protein ECB_00733 [Escherichia coli B str. REL606]
 gi|253972744|gb|ACT38415.1| conserved hypothetical protein [Escherichia coli B str. REL606]
          Length = 540

 Score =  142 bits (357), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNVARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|149174861|ref|ZP_01853485.1| hypothetical protein PM8797T_10814 [Planctomyces maris DSM 8797]
 gi|148846198|gb|EDL60537.1| hypothetical protein PM8797T_10814 [Planctomyces maris DSM 8797]
          Length = 568

 Score =  141 bits (356), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 79/532 (14%), Positives = 149/532 (28%), Gaps = 141/532 (26%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             WQ + +E +              + +  +    G GK                   +I
Sbjct: 57  DDWQWDILESLFD----------LTIRRVFVKGNTGCGKGAAAGIACCTYFHIWNDAKII 106

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
              +S    +   + EV KW   +  K   ++ +  +     +S  L             
Sbjct: 107 ITRDSVRTAQKIAFGEVDKWWRKMRFKPPGKLLTSGVFDNNQHSISL------------- 153

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN-RFWIMTSNP 230
                + +  + F G H+ +             +     +       N   + ++  SNP
Sbjct: 154 ----ANPQHIEGFRGAHSPHVFFWF-------DEATAPNLEDKYKLANTQAKKFLALSNP 202

Query: 231 RRLSGKFYEIFNKPLDD-----------WKRFQIDTRTVEGIDPSFHEGIIARYG----- 274
             LSG F + F     D            +   +       +     E  +A  G     
Sbjct: 203 STLSGTFRDSFPVVNPDKTQTIIDQYGNTRCITVSGWECTNVKEKCLEQPVAPIGGIKIS 262

Query: 275 -------------------------------------LDSDVTRVEVCGQFPQQDID-SF 296
                                                 D  +  V   G+FP QD D   
Sbjct: 263 DNYYPHGSPIAADDFEKVQPRIPGQTCYDEFMALLNDADPLIRNVYALGKFPDQDPDKQV 322

Query: 297 IPLNIIEEALNREPCP-------------------DPYAPLI-MGCDIAEEG-GDNTVVV 335
           I  + + E +                         +   P+   G D+A    GD +V+ 
Sbjct: 323 ILPDWLIEPVKFWTRWNRLCLRAREQFHILALKLLEQILPVEGFGLDVAASRFGDASVLA 382

Query: 336 LRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD------AIIID-ANNTGARTCDYLE 388
           +     I  + +   +D + T + +      +  D       I ID     G    D L+
Sbjct: 383 VGGRYGIRAIHECQFSDTQQTMSWVLETANSHGVDLEQGIVPIAIDWGGGYGNAVGDPLK 442

Query: 389 MLGYHVYRVLGQKRA-VDLEFCRNRRTELHVKMADWLEFAS--------LINHSGLIQNL 439
               +V  + G   + +D +   N+R EL+ + A  L+ A         L ++  L   L
Sbjct: 443 KRNVNVIEIHGNASSNLDSKKYANKRAELYGEAARRLDPAGDFRMMPFALPDNQRLKAEL 502

Query: 440 KSLKSFIVPNTG-ELAIESKRVKG--------------AKSTDYSDGLMYTF 476
            + +     + G +  I  K  +G               +S D +D ++Y  
Sbjct: 503 VAPEKIYAGHDGEKYYITPKGRRGSDANYNGKTLHEILGRSPDRADAVVYCL 554


>gi|238790716|ref|ZP_04634478.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
 gi|238721211|gb|EEQ12889.1| Gp33 TerL [Yersinia frederiksenii ATCC 33641]
          Length = 538

 Score =  141 bits (356), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 78/514 (15%), Positives = 141/514 (27%), Gaps = 92/514 (17%)

Query: 25  KLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPE 76
           K + + F++    WG        E+G P          Q E++E       N+      +
Sbjct: 43  KDNPAQFII---DWGMTVDPRNVERGLPARIPFLLFPKQEEWIEWFVDRWRNAEPGITEK 99

Query: 77  VFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLP 136
                    R +G + L   +   L     G+     +  E  +                
Sbjct: 100 T--------RDMGMSWLTVGMASSLCLFNRGVFAGFGSRKEEYVDKIGSP---------- 141

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH-HNTYGMAI 195
            K  F+     +   P                      T S    +   G          
Sbjct: 142 -KSLFDKARNFISLLPTEFRGGWSLKQHAPHMRILFPETESAMTGEAGDGIGRGDRTSFY 200

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
           I DE++       +      T           S P  ++  F E  +      K F    
Sbjct: 201 IVDESAFLERPYLVDASLSATTNCRQDV----STPNGMANSFAERRH--SGKIKVFTFHW 254

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP--CPD 313
           R     D ++++  +    LD      E+   +        IP   ++ A+N        
Sbjct: 255 RDDPRKDDAWYQKQVEN--LDPVTVAQEIDINYSASVEGVLIPSAWVQAAINAHEVLGIV 312

Query: 314 PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDA 371
           P    +   DIA+EG D      R G ++E + +WS    D+  T  K   + +    + 
Sbjct: 313 PTGQRLGALDIADEGKDTNSFAGRHGFLLESIEEWSGKGDDIFGTVQKAFDICDAQNLET 372

Query: 372 IIIDANNTGARTCDYLEMLGYH---------------------------VYRVLGQKRAV 404
              D +  GA       ++                              V    GQ+  +
Sbjct: 373 FRFDTDGLGAGARGDARVINEQREEQRRRHIVATPFRGSGGVTDPDDEAVPGDNGQQGRL 432

Query: 405 DLEFCRNRRTELHVKMADWL--------EFASLINHS------------GLIQNLKSLKS 444
           + +F  N + +    +            E                     L   L S  +
Sbjct: 433 NKDFFANAKAQGWWSLRTRFQKTYRAVKENMEFDPDEIISIPKDLKNLTKLTSEL-SQPT 491

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
           + V   G++ +  K+  G KS + +D  M  +A 
Sbjct: 492 YSVNGVGKIVV-DKKPDGTKSPNLADSAMILYAP 524


>gi|167553969|ref|ZP_02347711.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205321713|gb|EDZ09552.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 539

 Score =  141 bits (356), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 156/534 (29%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +   PET   L     ++               WG        + G P+         
Sbjct: 26  QRIRKAPETLPALRQFYRTNP--------AQFIIDWGMTTDPRNLDYGLPVTIPFLLFPR 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E+++ +     N  N    +         R +G +  +  L   L      + +   +
Sbjct: 78  QEEWIDWIMERSRNHENGLTEK--------SREMGLSWTSVGLASALCLFNREMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T+  +   W         F     +     W        + ++      + +
Sbjct: 130 RKEEYVDSTVDPKALFW-----KVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKID-NPIIVAQELDLNYQASTEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFYPENEAVPGDNGKPSRLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++     G++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNAVGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|191172603|ref|ZP_03034142.1| gp33 TerL [Escherichia coli F11]
 gi|190907076|gb|EDV66676.1| gp33 TerL [Escherichia coli F11]
 gi|324014340|gb|EGB83559.1| hypothetical protein HMPREF9533_01599 [Escherichia coli MS 60-1]
          Length = 540

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 72/534 (13%), Positives = 152/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIYWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +   + G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVENVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|218555117|ref|YP_002388030.1| hypothetical protein ECIAI1_2647 [Escherichia coli IAI1]
 gi|218361885|emb|CAQ99485.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 540

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPVLKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLMENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|188494674|ref|ZP_03001944.1| gp33 TerL [Escherichia coli 53638]
 gi|188489873|gb|EDU64976.1| gp33 TerL [Escherichia coli 53638]
          Length = 539

 Score =  141 bits (355), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 155/534 (29%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITDK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKID-NPVIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFHPENEAVPGDNGKPARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++    TG++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNATGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|194430118|ref|ZP_03062621.1| gp33 TerL [Escherichia coli B171]
 gi|215487586|ref|YP_002330017.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|260845222|ref|YP_003223000.1| putative terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|194411828|gb|EDX28147.1| gp33 TerL [Escherichia coli B171]
 gi|215265658|emb|CAS10061.1| predicted terminase, large subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|257760369|dbj|BAI31866.1| predicted terminase large subunit [Escherichia coli O103:H2 str.
           12009]
 gi|309702924|emb|CBJ02255.1| putative phage gp33 TerL [Escherichia coli ETEC H10407]
 gi|323159191|gb|EFZ45181.1| gp33 TerL [Escherichia coli E128010]
          Length = 540

 Score =  141 bits (355), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPVLKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|324114526|gb|EGC08494.1| hypothetical protein ERIG_00518 [Escherichia fergusonii B253]
          Length = 540

 Score =  141 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 155/534 (29%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L   +  + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFKKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ + + G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINSVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|291283815|ref|YP_003500633.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763688|gb|ADD57649.1| hypothetical protein G2583_3121 [Escherichia coli O55:H7 str.
           CB9615]
          Length = 540

 Score =  141 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 154/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNPDEII 472

Query: 437 -----QNL-------KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                  L        S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 473 SISSSMALKDKLIIALSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 525


>gi|9633565|ref|NP_050979.1| P18 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118013|gb|AAF03961.1|AF157835_18 P18 [Endosymbiont phage APSE-1]
          Length = 469

 Score =  141 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 76/461 (16%), Positives = 132/461 (28%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ +  A +   +  L  ++ F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSGHAVLQAEVETLGLQNRFRI 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +                +   +       +        +    H         +EA   
Sbjct: 71  LNT--------------YIEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDSLIPTIRKPGSELWFSF--NPAEEDGAVYKRFVKPYKELIDTQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           ++       +              +    R    G+      D+ I    +E A++    
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVEAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATMTAFDDAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY + +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGNKMVVTGFGAGDSPDYPDEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPDALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|255321082|ref|ZP_05362250.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262379515|ref|ZP_06072671.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
 gi|255301852|gb|EET81101.1| gp33 TerL [Acinetobacter radioresistens SK82]
 gi|262298972|gb|EEY86885.1| bacteriophage TerL protein [Acinetobacter radioresistens SH164]
          Length = 558

 Score =  141 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 69/473 (14%), Positives = 131/473 (27%), Gaps = 82/473 (17%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT-----LWAEVSKWLSLLP 136
           I   R  G + +     L       G +    +  E  +        L  +     S LP
Sbjct: 107 IEKSRDEGMSYVVLGFYLHRWLFVEGFAGGVGSRKEDLVDKKGDPKTLLHKFRDMYSKLP 166

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
                      + P  +   V    + I +          + +                 
Sbjct: 167 AW---------MKPKGFIEKVHDNYMRIINPDNGATVTGEAGDNIG-----RGGRTTMYF 212

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
            DE +         +   ++        I  S P  +  KF++   +    +  F +  R
Sbjct: 213 LDEWAFV--ERQEAVDAAIS--QNTNVHIKGSTPNGIGDKFHQD--RFSGRYAVFTMAWR 266

Query: 257 TVEG------IDPSFHEGIIARY--GLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNR 308
                     +D         +    LD  V   EV   +        IP   ++ A++ 
Sbjct: 267 DNPDKNWQVELDGKLIYPWYEKQLATLDDIVLAQEVDIDYAASVEGVLIPSAWVQAAVDA 326

Query: 309 EPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLV 364
                 +P        D+A+EG D      R G V+++L  WS    D+  T  K     
Sbjct: 327 HIKLGIEPSGERNGALDVADEGKDKNSFAARHGIVLQYLDTWSGIGDDIFGTTQKAIDAC 386

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRAVDLE------- 407
              + +    DA+  GA       ++                  G     + E       
Sbjct: 387 LDLKLNIFFYDADGLGAGVRGDARVINELNKAKGIPEIEANPFRGSGAVHNPEQEMVEAR 446

Query: 408 ----FCRNRRTELHVKMADWLEF------ASLINHSGLI---------------QNLKSL 442
               F  N + ++   +    +           +   LI               +   S 
Sbjct: 447 KNVDFFANLKAQMWWSLRLRFQNTYRALQGMQYDPDSLISLSTKDINKQELEQLKRELSQ 506

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE--NPPRSDMDFGRCPSY 493
            ++     G++ + +K+  GA S + +DG+M  F++   P R     G    +
Sbjct: 507 PTYSKNGAGKILV-NKQPDGALSPNRADGVMICFSDIRPPARLIPGGGGTRRF 558


>gi|168820654|ref|ZP_02832654.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205342611|gb|EDZ29375.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
          Length = 539

 Score =  140 bits (353), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 156/534 (29%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +   PET   L     ++               WG        + G P+         
Sbjct: 26  QRIRKAPETLPALRQFYRTNP--------AQFIIDWGMTTDPRNLDYGLPVTIPFLLFPR 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E+++ +     N  N    +         R +G +  +  L   L      + +   +
Sbjct: 78  QEEWIDWIMERSRNHENGLTEK--------SREMGLSWTSVGLASALCLFNREMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T+  +   W         F     +     W        + ++      + +
Sbjct: 130 RKEEYVDSTVDPKALFW-----KVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKISVFTFHWRSDPRKDDEWYRKECEKID-NPIIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFYPENEAVPGDNGKPARLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++     G++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNAVGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|332759085|gb|EGJ89395.1| gp33 TerL [Shigella flexneri 4343-70]
          Length = 519

 Score =  140 bits (353), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 72/534 (13%), Positives = 154/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 5   QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 56

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 57  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 108

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 109 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWDEKKHAPYMRVEFPETGAVIK 163

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DE++       L I   L+     R  I  S+   ++
Sbjct: 164 GEAGDNIG-----RGDRTTLYLVDESAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 214

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 215 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 271

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 272 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNSFSTRHGFLLENVREWSGVG 331

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 332 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 391

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 392 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMDYNPDEII 451

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M ++A 
Sbjct: 452 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMISYAP 504


>gi|320179507|gb|EFW54461.1| Phage terminase, large subunit [Shigella boydii ATCC 9905]
          Length = 539

 Score =  140 bits (353), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 74/534 (13%), Positives = 154/534 (28%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPVLKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECDKID-NPVIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GSVFHPENEAVPGDNGKPARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++    TG++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNATGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|238765385|ref|ZP_04626308.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
 gi|238696377|gb|EEP89171.1| Gp33 TerL [Yersinia kristensenii ATCC 33638]
          Length = 501

 Score =  140 bits (352), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 62/444 (13%), Positives = 134/444 (30%), Gaps = 69/444 (15%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ 144
            R +G +  +  L   L      + +   +  E  + +T   +   W +       F   
Sbjct: 63  SREMGLSWTSIGLACSLCLFNKEMVIGFGSRKEEYVDSTGDPKALFWKAR-----KFVET 117

Query: 145 SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP 204
             S     W        + ++      + +  + +                  DE++   
Sbjct: 118 LPSEFRGSWSEKKHAPYMRVEFPDTGAVIKGEAGDNIG-----RGDRTTLYFVDESAFL- 171

Query: 205 DVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPS 264
               L I   L+     R  I  S+   ++  F +  +        F    R+    D  
Sbjct: 172 -QRPLLIDAALS--QTTRCRIDLSSVNGMNNPFAQKRH--GGKIPVFTFHWRSDPRKDDE 226

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--PYAPLIMGC 322
           ++     +   +  V   E+   +        IP   ++ A++     D  P    +   
Sbjct: 227 WYRKECEKID-NPVVVAQELDLNYQASAEGILIPSEWVQAAIDAHIHLDIQPSGARLGAM 285

Query: 323 DIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKIS--GLVEKYRPDAIIIDANNTG 380
           D+A+EG D     +R G +++ + +WS        + +   G  ++Y  D    D +  G
Sbjct: 286 DVADEGRDKNGFAIRYGFLLQDVKEWSGEGSDIYASVVKVFGYCDEYGLDEFRFDEDGLG 345

Query: 381 ARTCDYLEMLGY---------------------------HVYRVLGQKRAVDLEFCRNRR 413
           A       ++                              V    G+   ++ +F  N +
Sbjct: 346 AGVRGDARVINELRQSERLGPITATPFRGSGAVFDPDDEAVIGDNGKPARLNKDFFANAK 405

Query: 414 TELHVKMADWLE-------------------FASLINHSGLIQNLKSLKSFIVPNTGELA 454
            +    +                         +++ N   LI  L S  ++     G++ 
Sbjct: 406 AQGWWHLRKLFRNTFRAMKGMDYNPDEIISINSTMENKDRLIMEL-SQPTWSKNAVGKIV 464

Query: 455 IESKRVKGAKSTDYSDGLMYTFAE 478
           I  K+ +G KS + +D +M  +A 
Sbjct: 465 I-DKQPEGTKSPNLADAVMINYAP 487


>gi|193062794|ref|ZP_03043887.1| putative conserved hypothetical protein [Escherichia coli E22]
 gi|192931437|gb|EDV84038.1| putative conserved hypothetical protein [Escherichia coli E22]
          Length = 603

 Score =  140 bits (352), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/467 (11%), Positives = 117/467 (25%), Gaps = 63/467 (13%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     HC          + K      R +G T   AW             V 
Sbjct: 145 DTWAREHLFEYQLHCREHKGEDWRFILK-----SRQVGMTYYFAWEAFEDAVITGDNQVF 199

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL-----------HPAPWYSDVLHC 160
             A+          +E+ +   +   ++ F +                  +   S     
Sbjct: 200 FSASRSQ-------SEIFREYIVQIAQNHFGVTLTGKNIRLSNGAILRFLSTNASTAQGF 252

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       + +        + +  HN Y     +  ++ T     +         + 
Sbjct: 253 NGHLYGDEVFWIPKFTRLHEVASAMATHNKYRTTYFSTPSAKTHQAYPVWTGEAWRGDDP 312

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  +    P     +   +    +  +     D            E +  +Y       
Sbjct: 313 KRKGVAF--PTESEMRQGILCPDQIWRYIITMEDAIEGGLGALVDIERLRNKYS--PTAF 368

Query: 281 RVEVCGQFPQQDIDSFIPLNII----EEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +    QF       F    ++    + A   +       P     +  G D +  G ++
Sbjct: 369 AMLYMCQFVDSKDAVFKFSALVGCEVDRATWGDFDLTAARPFGNREVWAGFDPSRSGDNS 428

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T V++           +  ++ W   +     ++I  L+ ++    I ID    G    D
Sbjct: 429 TFVLIAPPIEDGERFRVLAVWQWQGFNFSWQADQIKQLMRRFNITYIGIDTTGIGKGVYD 488

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSGLIQN------ 438
            +              R           +  L +KM D +E   +      +        
Sbjct: 489 LVS---------KFAPREATPILYSVESKNRLVMKMIDVVERKRIEWAKDAVDETNKERV 539

Query: 439 -----LKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
                  +++     +   L   ++R       D    + +     P
Sbjct: 540 EIPASFMAIRRTTTNSGNALTFVAERSDATGHADVFFAISHAVINEP 586


>gi|168467237|ref|ZP_02701079.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
 gi|195630466|gb|EDX49092.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
          Length = 539

 Score =  140 bits (352), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 73/534 (13%), Positives = 156/534 (29%), Gaps = 93/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +   PET   L     ++               WG        + G P+         
Sbjct: 26  QRIRKAPETLPALRQFYRTNP--------AQFIIDWGMTTDPRNLDYGLPVTIPFLLFPR 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E+++ +     N  N    +         R +G +  +  L   L      + +   +
Sbjct: 78  QEEWIDWIIERSRNQENGLTEK--------SREMGLSWTSVGLASALCLFNREMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T+  +   W         F     +     W        + ++      + +
Sbjct: 130 RKEEYVDSTVDPKALFW-----KVRKFIATLPAEFRGGWDERKHSRFMSVEFPDTGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYRKECEKID-NPIIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIKLGIQPSGQRLGAMDVADEGRDKNACSLRYGFLLSDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGTDQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF----------------- 426
                     V    G+   ++ +F  N + +    +                       
Sbjct: 413 GRVFYPENEAVPGDNGKPSRLNKDFFANAKAQGWWHLRKLFRNTFRALKGMEYDPDEIIS 472

Query: 427 --ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +++ N   L+  L S  ++     G++ +  K+  G KS + +D +M  +A 
Sbjct: 473 ISSTMENKDRLLMEL-SQPTWSKNAVGKILV-DKQPDGTKSPNLADSVMIAYAP 524


>gi|333006277|gb|EGK25786.1| gp33 TerL [Shigella flexneri K-218]
          Length = 540

 Score =  140 bits (352), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 72/534 (13%), Positives = 154/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWGNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWDEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DE++       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDESAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R     D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP   ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNSFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNAARRPSILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +   ++    +            N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMDYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ I  K+  G +S + +D +M ++A 
Sbjct: 473 SISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMISYAP 525


>gi|326782611|ref|YP_004323017.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
 gi|310002825|gb|ADO97224.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM1]
          Length = 549

 Score =  140 bits (351), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 66/460 (14%), Positives = 140/460 (30%), Gaps = 66/460 (14%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
            L   P+  Q++       +       F+  +         L  F     +Q E ++   
Sbjct: 19  ALDFTPDEVQEVI------KCSEDPVYFIKKYIKIVSLDKGLIPFDM-YHFQEEMVQKFH 71

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            +  N    P            R  GK+T+    +LW +     ++V  LAN     +  
Sbjct: 72  DNRFNIAKLP------------RQSGKSTIVTSYLLWYVLFNDNVNVAILANKAATAREM 119

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
           L             +     ++L              SL +++        T       +
Sbjct: 120 L------------QRLQLSYENLPKWLQQGILQWNRGSLELENGSKIMAAST-------S 160

Query: 184 FVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFY 238
                      I  DE +  P    D     +   ++   +     I T +   +  K +
Sbjct: 161 ASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSGKSTKVIIISTPHGMNMFYKLW 220

Query: 239 EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
               +  +++   ++    V G D  + E  I          RVE   +F     D+ I 
Sbjct: 221 HDAERGTNEYIPTEVHWSEVPGRDDVWKEQTIKNTSE--QQFRVEFECEFLGSV-DTLIS 277

Query: 299 LNIIEEALNREPCPD-----------PYAPLIMGCDIAEE-GGDNTVVVLRRG----PVI 342
            + +      +P  +           P    ++  D++   G D +   +         +
Sbjct: 278 PSKLRIMPYHDPMKENRGLAIFEQSIPDHNYVITVDVSRGVGNDYSAFCVMDTTTIPYKM 337

Query: 343 EHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVL 398
              +  ++       N +  + + Y    I+ + N+ G +  D     LE     +  + 
Sbjct: 338 VARYRNNEIKPIILPNIVVDVAKNYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMR 397

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           G+      +    ++T+L VKM+  ++     N   LI++
Sbjct: 398 GRAGQQLGQGFSGKKTQLGVKMSTAVKQVGCSNLKALIED 437


>gi|326783550|ref|YP_004323947.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
 gi|310005053|gb|ADO99443.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           Syn19]
          Length = 549

 Score =  139 bits (350), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 67/451 (14%), Positives = 134/451 (29%), Gaps = 61/451 (13%)

Query: 23  EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           +       F+  +         L  F     +Q E +E    +  N    P         
Sbjct: 32  KCSEDPVYFIKTYIKIVSLDKGLIPFDM-YHFQEEMVEKFHDNRFNIAKLP--------- 81

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
              R  GK+T+    +LW +     ++V  LAN     +  L             +    
Sbjct: 82  ---RQSGKSTIVTSYLLWYVLFNQNVNVAILANKAATSREML------------QRLQLS 126

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
            ++L              SL +++        T S                 I  DE + 
Sbjct: 127 YENLPKWLQQGILQWNRGSLELENGSKIMAASTSS-------SAVRGMSFNVIFLDEFAF 179

Query: 203 TP----DVINLGILGFLTERN-ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
            P    D     +   ++         I T +   +  K +    +  +++   ++    
Sbjct: 180 VPNHIADQFFSSVYPTISSGQSTKVIIISTPHGMNMFYKLWHDAERSKNEYIPTEVHWSE 239

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC------ 311
           V G D  + E  IA         +VE   +F     D+ I  + +      +P       
Sbjct: 240 VPGRDAKWKEQTIANTSE--QQFKVEFECEFLGSV-DTLISPSKLRVMPYHDPIAQNKGL 296

Query: 312 -----PDPYAPLIMGCDIAE-EGGDNTVVVLRRGPVI----EHLFDWSKTDLRTTNNKIS 361
                 +P    I+  D+A     D +   +     +       +  ++       N I 
Sbjct: 297 AVYKRAEPDHNYIITVDVARGTSNDYSAFCVMDTTTVPYEMVARYRNNEIKPIVFPNIIV 356

Query: 362 GLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            + + Y    I+ + N+ G +  D     LE     +  + G+      +    ++T+L 
Sbjct: 357 DVAKNYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAAMRGRAGQQLGQGFSGKKTQLG 416

Query: 418 VKMADWLEFASLINHSGLIQNL-KSLKSFIV 447
           VKM+  ++     N   LI+     +  +  
Sbjct: 417 VKMSTAVKQVGCSNLKALIEEDKLIIPDYDT 447


>gi|150021340|ref|YP_001306694.1| hypothetical protein Tmel_1462 [Thermosipho melanesiensis BI429]
 gi|149793861|gb|ABR31309.1| protein of unknown function DUF264 [Thermosipho melanesiensis
           BI429]
          Length = 421

 Score =  138 bits (347), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/337 (16%), Positives = 96/337 (28%), Gaps = 26/337 (7%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           + +                      I AGR  GKT   A  + +  +  P   VI    S
Sbjct: 14  KLLFGYSEIAPKQRELLYLNGSTQVICAGRRFGKTNYVAGKIFYYATIHPKSRVIVGGPS 73

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
             Q K   +  +++ + L P K + +    S  P  +  +    ++              
Sbjct: 74  LDQAK-IYYDLLTEAIELSPLKGFVKKTKDSPFPTIYLKNGSSITVRS------------ 120

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGTPDVINL-GILGFLTERNANRFWIMTSNPRRLSG 235
                             ++  EA+   D +    I     +  A      T N      
Sbjct: 121 ---TAHNGKYLRGRKVNLVVLTEAAFIKDSVYEQVITPMKLDTGAPVILESTPNGMNYFY 177

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
           + Y+   K       F         +D    E   A+      V R E   +F       
Sbjct: 178 EEYQRGLKNKKHTISFHATVYDNPFLDQEEIENAKAKTPDY--VWRQEYLAEFVDD-DTV 234

Query: 296 FIPLNIIEEALN--REPCPDPYAPLIMGCDIAEEGGDNTVVVLR---RGPVIEHLFDWSK 350
           F P  I+ EA    +           +G D+A+      ++VL        I     +++
Sbjct: 235 FFPWKILVEAFEDYKPEGYKDGRKYSIGVDLAKYRDYTVIIVLDVTEEPFKIAEFHRFNQ 294

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
                    ++ L  KYR   + +DA   G    + +
Sbjct: 295 IPYEEVIRIVNDLQAKYR-AQVYLDATGVGDPISERI 330


>gi|322835667|ref|YP_004215693.1| terminase large subunit [Rahnella sp. Y9602]
 gi|321170868|gb|ADW76566.1| terminase large subunit [Rahnella sp. Y9602]
          Length = 539

 Score =  138 bits (346), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 78/532 (14%), Positives = 152/532 (28%), Gaps = 88/532 (16%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTP-----LEGFSAPRSWQLE 57
           + +   PE    L      +               WG    P         S P      
Sbjct: 26  QRIRQQPEMLPALNAFYRDNP--------AQFIIDWGMTTDPRNLDFGMPVSVPF----- 72

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
            +       +N + +   +   G     R +G +  +  L   L      + +   +  E
Sbjct: 73  LLFPKQEEWINWIMDRRSQQENGITEKSREMGLSWTSIGLACALCLFNKEMVIGFGSRKE 132

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYS 177
             + +T   +   W +       F           W +      + ++      + +  +
Sbjct: 133 EYVDSTGDPKALFWKAR-----KFVEMLPVEFRGGWSAKKHAPYMRVEFPTTGAVLKGEA 187

Query: 178 EERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKF 237
            +                  DEA+       L I   L+     R  I  S+   ++  F
Sbjct: 188 GDNIG-----RGDRTTLYFVDEAAFL--QRPLLIEASLS--QTTRCRIDLSSVNGMANPF 238

Query: 238 YEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI 297
            +  +        F    R+    D +++    A+   +  V   E+   +        I
Sbjct: 239 AQKRH--GGRIPVFTFHWRSDPRKDEAWYAKECAKID-NPVVVAQELDLNYSASAEGVLI 295

Query: 298 PLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDL 353
           P   I  A+N        P    +   D+A+EG D      R G ++  + +WS   +D+
Sbjct: 296 PNEWIRAAINAHIKLGIQPTGKRLGAMDVADEGRDKNAFSARYGFLLTEVEEWSGVGSDI 355

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY--------------------- 392
             ++ K  GL +K+  +    D +  GA        +                       
Sbjct: 356 YKSSEKAFGLCDKHGLEEFRFDEDGLGAGVRGDARAINEIRKAEGARYILATPFRGSASV 415

Query: 393 ------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF-------------------- 426
                  V    GQ   ++ +F  N + +    +                          
Sbjct: 416 FDPEAEAVPGDNGQPARINKDFFANAKAQSWWHLRKLFRNVYRAVEEKMDYNPDEIISIS 475

Query: 427 ASLINHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             + N   LI  L S  ++ +   G++ I  K+  G KS + SD +M  +A 
Sbjct: 476 GDIKNLDKLIIEL-SQPTYSINGVGKI-IVDKQPDGTKSPNLSDSVMINYAP 525


>gi|320198795|gb|EFW73395.1| Phage terminase, ATPase subunit [Escherichia coli EC4100B]
          Length = 603

 Score =  138 bits (346), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 52/467 (11%), Positives = 116/467 (24%), Gaps = 63/467 (13%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     HC          + K      R +G T   AW             V 
Sbjct: 145 DTWAQEHLFEYQLHCREHKGEDWRFILK-----SRQVGMTYYFAWEAFEDAVITGDNQVF 199

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL-----------HPAPWYSDVLHC 160
             A+          +E+ +   +   ++ F +                  +   S     
Sbjct: 200 FSASRSQ-------SEIFREYIVQIAQNHFGVTLTGKNIRLSNGAILRFLSTNASTAQGF 252

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       + +        + +  HN Y     +  ++ T     +         + 
Sbjct: 253 NGHLYGDEVFWIPKFTRLHEVASAMATHNKYRTTYFSTPSAKTHQAYPVWTGEAWRGDDP 312

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  +   N          +    +  +     D            E +  +Y       
Sbjct: 313 KRKGVKFPNE--SEMCQGILCPDQIWRYIITMEDAIEGGLGALVDIERLRNKYS--PTAF 368

Query: 281 RVEVCGQFPQQDIDSFIPLNII----EEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +    QF       F    ++    + A   +       P     +  G D +  G ++
Sbjct: 369 AMLYMCQFVDSKDAVFKFSALVGCEVDRATWGDFDLTATRPFGNREVWAGFDPSRSGDNS 428

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T V++           +  ++ W   +     ++I  L+ ++    I ID    G    D
Sbjct: 429 TFVLIAPPIEDGERFRVLAVWQWQGFNFSWQADQIKQLMRRFNITYIGIDTTGIGKGVYD 488

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSGLIQN------ 438
            +              R           +  L +KM D +E   +      +        
Sbjct: 489 LVS---------KFAPREATPILYSVESKNRLVMKMIDVVERKRIEWAKDAVDETNKERV 539

Query: 439 -----LKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
                  +++     +   L   ++R       D    + +     P
Sbjct: 540 EIPASFMAIRRTTTNSGNALTFVAERSDATGHADVFFAISHAVINEP 586


>gi|211731828|gb|ACJ10140.1| terminase [Bacteriophage APSE-6]
          Length = 469

 Score =  138 bits (346), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 74/461 (16%), Positives = 126/461 (27%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   S       +CL      ++ ++ A +   +  L  +  F +
Sbjct: 12  GGRGGMKTVSFAKIALITASMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLQVRFRV 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +  +                 +       +        +    H         +EA   
Sbjct: 71  LNSCI--------------EGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +   +    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDTLIPTIRKPGSELRFSF--NPAEEDGAVYKRFVKPYKAIIDKQGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
            +       +              +    R    G+      D+ I    +  A++    
Sbjct: 171 NVSYLDNPWLPVELKNDAQKMKRENYKKWRHVYGGECDANYEDALIQPEWVGAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A  G D   +  R G +IE    W + D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPAGSGQDEKALSKRYGVLIEDCVSWLEGDVADATMTAFDEAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY   +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGSKMVVTGFGAGDSPDYPHEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLIQ-------------NLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVEKGEYLDPDALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|62181180|ref|YP_217597.1| hypothetical protein SC2610 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62128813|gb|AAX66516.1| orf, partial conserved hypothetical protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322715669|gb|EFZ07240.1| hypothetical protein SCA50_2790 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 540

 Score =  138 bits (346), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 66/526 (12%), Positives = 149/526 (28%), Gaps = 76/526 (14%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVV 62
           + +  +PE    L     ++               WG    P              +   
Sbjct: 26  QRIRQHPEMLPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 63  DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKT 122
               ++ +     +   G     R +G +     +   L      + +   +  E  + +
Sbjct: 78  QEEWVHWIMERWGKRENGITEKSREMGLSWTAIGMACSLCLFNKEMVIGFGSRKEEYVDS 137

Query: 123 TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
           T   +   W +       F           W        + ++      + +  + +   
Sbjct: 138 TGDPKALFWKAR-----KFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIKGEAGDNIG 192

Query: 183 TFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
                        + DEA+       L I   L+     R  I  S+   ++  F +  +
Sbjct: 193 -----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMANPFAQKRH 243

Query: 243 KPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNII 302
                   F    R+    D  ++     +   +  V   E+   +        IP + +
Sbjct: 244 --GGKIPVFTFHWRSDPRKDDEWYRRECEKID-NPVVVAQELDLNYSASAEGVLIPSDWV 300

Query: 303 EEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK--TDLRTTNN 358
           + A++        P    +   D+A+EG D      R G ++E++ +WS   +D+  +  
Sbjct: 301 QAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVGSDIYQSVE 360

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY-------------------------- 392
           K+ G  E+   +    D +  GA        +                            
Sbjct: 361 KVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGSGAVFDPDD 420

Query: 393 -HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLIQ------- 437
             V    GQ   ++ +F  N + +    +                 N   +I        
Sbjct: 421 EAVRGDNGQAARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEIISISSTMES 480

Query: 438 -----NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                   S  ++ +   G++ +  K+  G +S + +D +M ++A 
Sbjct: 481 KDKLIIELSQPTYSINGVGKIVV-DKQPDGTRSPNLADSVMISYAP 525


>gi|326782863|ref|YP_004323261.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
 gi|310004122|gb|ADO98516.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-RSM4]
          Length = 547

 Score =  137 bits (345), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 68/462 (14%), Positives = 138/462 (29%), Gaps = 60/462 (12%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   + K  ++    + +     F+ ++         L  F+    +Q E +  
Sbjct: 9   PNLKKVNTSIDFKPEEVAEVLKCQDDPIYFIKNYIKIVSLDEGLVPFNM-YHFQEEMVSK 67

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              H  N    P            R  GK+T+    +LW +     ++V  LAN     +
Sbjct: 68  FHDHRFNIAKLP------------RQSGKSTIVTAYLLWYVLFNANVNVAILANKAATAR 115

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L             +     ++L              SL +++        T      
Sbjct: 116 EML------------QRLQLSYENLPNWMQQGILQWNRGSLELENGSKIMAAST------ 157

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
            +           I  DE +  P    D     +   ++   +     I T +   +  K
Sbjct: 158 -SASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSGKSTKVIIISTPHGMNMFYK 216

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    +  +++   ++    V G D  + E  I          RVE   +F     D+ 
Sbjct: 217 LWHDAERGTNEYVPTEVHWSEVPGRDDVWKEQTIKNTSE--SQFRVEFECEFLGSV-DTL 273

Query: 297 IPLNIIEEALNREP-----------CPDPYAPLIMGCDIAEE-GGDNTVVVLRRG----P 340
           I  + +      +P              P    I+  D++   G D +   +        
Sbjct: 274 IAPSKLRIMPYHDPITSNRGLAVYEQVIPEHNYIITVDVSRGVGNDYSAFCVIDTTTIPY 333

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYR 396
            +   +  ++       N I  + + Y    I+ + N+ G +  D     LE     +  
Sbjct: 334 KMVARYKNNEIKPIVLPNIIVDIAKNYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAA 393

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           + G+      +    ++T+L VKM+   +     N   LI+ 
Sbjct: 394 MRGRAGQQLGQGFSGKKTQLGVKMSTATKQVGCSNLKALIEE 435


>gi|194445851|ref|YP_002040314.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
 gi|194404514|gb|ACF64736.1| gp33 TerL [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
          Length = 540

 Score =  137 bits (345), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/534 (12%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  +PE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQHPEMLPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +        N    +         R +G +     +   L      + +   +
Sbjct: 78  QEEWIHWIMERWGKRENGITEK--------SREMGLSWTAIGMACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRSDPRKDDEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP + ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +    +                 N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ +  K+  G +S + +D +M ++A 
Sbjct: 473 SISSTMESKDKLIIELSQPTYSINGVGKIVV-DKQPDGTRSPNLADSVMISYAP 525


>gi|211731785|gb|ACJ10115.1| terminase [Bacteriophage APSE-7]
          Length = 469

 Score =  137 bits (344), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 71/461 (15%), Positives = 126/461 (27%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   +       +CL      ++ ++ A +   +  L     F +
Sbjct: 12  GGRGGMKTVSFAKIALITAAMHK-RRFLCLREFMNSIEDSVHAVLQAEVETLGLHARFRV 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +  +                 +       +        +    H         +EA   
Sbjct: 71  LNSCI--------------EGINASIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y+ F KP             DD    
Sbjct: 113 SEKSLDTLISTIRKPGSELWFSF--NPSEEDGAVYQRFVKPYKAIIDKKGYYEDDDLYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
            +       +              +    R    G+      D+ I    ++ A++    
Sbjct: 171 NVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYDDALIQPEWVDAAIDAHIK 230

Query: 312 PD--PYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFPPRGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATITAFDEAFDYRA 290

Query: 370 DAIIIDANNTGARTC----------------------------DYLEMLGYHVYRVLGQK 401
           D  I D    GA T                             +                
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGNKMVVTGFGAGDSPDYPDEVYVPSNAEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+  +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKHAQYWVYLADRFYKTWRAVEKGEYLDPDELISLSSKIEKLSQLKSELVK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
                +P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QPRKRMPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|326784324|ref|YP_004324722.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
 gi|310003555|gb|ADO97951.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM5]
          Length = 549

 Score =  137 bits (344), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 69/462 (14%), Positives = 137/462 (29%), Gaps = 60/462 (12%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   +    ++            F+ ++         L  F     +Q E +  
Sbjct: 11  PNLKKANTAIDFTPDEVAEVLRCSEDPVYFIKNYIKIVSLDKGLIPFDM-YHFQEEMVSK 69

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
             A   N    P            R  GK+T+    +LW +   P ++V  LAN     +
Sbjct: 70  FHAERFNIAKLP------------RQSGKSTIVTSYLLWYVLFNPNVNVAILANKAATAR 117

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L             +     ++L              SL +++        T      
Sbjct: 118 EML------------QRLQLSYENLPKWLQQGILQWNRGSLELENGSKIMAAST------ 159

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
            +           I  DE +  P    D     +   ++   +     I T +   +  K
Sbjct: 160 -SASAVRGMSFNVIFLDEFAFIPNHIADQFFSSVYPTISSGKSTKVIIISTPHGMNMFYK 218

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    +  +++   ++    V G D  + E  I          RVE   +F     D+ 
Sbjct: 219 LWHDAERGSNEYVPTEVHWSEVPGRDEVWKEQTIKNTSE--QQFRVEFECEFLGSV-DTL 275

Query: 297 IPLNIIEEALNREPCPD-----------PYAPLIMGCDIAEE-GGDNTVVVLRRG----P 340
           I  + +      EP              P    I+  D++   G D +   +        
Sbjct: 276 ISPSKLRIMPYHEPMNQNRGLAVFEQAIPEHNYILTVDVSRGVGNDYSAFTVMDTTTIPY 335

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYR 396
            +   +  ++       N I  + + Y    I+ + N+ G +  D     LE     +  
Sbjct: 336 KMVARYKNNEIKPIVLPNIIVDVAKAYNNAYILCEVNDIGGQVADIIQFDLEYENLLMAA 395

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           + G+      +    ++T+L VKM+  ++     N   LI++
Sbjct: 396 MRGRAGQQLGQGFSGKKTQLGVKMSTAVKQVGCSNLKALIED 437


>gi|224582844|ref|YP_002636642.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467371|gb|ACN45201.1| hypothetical protein SPC_1035 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 540

 Score =  136 bits (342), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 69/534 (12%), Positives = 153/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  +PE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQHPEMLPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +        N    +         R +G +     +   L      + +   +
Sbjct: 78  QEEWIHWIMERWGKRENGITEK--------SREMGLSWTAIGMACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRSDPRKDDEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP + ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 ILIPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  K+ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +    +                 N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ +  K+  G +S + +D +M ++A 
Sbjct: 473 SISSTMESKDKLIIELSQPTYSINGVGKIVV-DKQPDGTRSPNLADSVMISYAP 525


>gi|169633984|ref|YP_001707720.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii SDF]
 gi|169152776|emb|CAP01795.1| putative bacteriophage protein; putative prophage terminase large
           subunit [Acinetobacter baumannii]
          Length = 552

 Score =  136 bits (341), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 76/543 (13%), Positives = 152/543 (27%), Gaps = 98/543 (18%)

Query: 1   MSRELPTNPETEQ-KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAP-------R 52
           M+R        EQ +L       +      ++  + + W      +  F  P       R
Sbjct: 28  MTRRYYYKAAIEQNELSIQAEIYKCSKDPIHW-FNNWIWTYDPRGMA-FGLPANIPFVLR 85

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
             Q+E +  ++       +          I   R  G + +     L       G +   
Sbjct: 86  PKQVELVAWLEERESTQTHG--------LIEKSRDEGMSYVVLGFFLHRWLFVEGFAGGV 137

Query: 113 LANSETQLKTT-----LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
            +  E  +        L+ +     S +P           L P  +   V    + I + 
Sbjct: 138 GSRKEELVDKKGDPKTLFHKFRDMFSKMPQW---------LKPKGFVEKVHDNYMRIINP 188

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
                    + +                  DE +         +   ++        I  
Sbjct: 189 DNGATITGEAGDNIG-----RGGRTTMYFLDEWAFV--EQQEAVDAAIS--QNTNVHIKG 239

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG------IDPSFHEGIIARY--GLDSDV 279
           S P  +  +F++   +    +  F +  R           +         +    LD  V
Sbjct: 240 STPNGIGDRFHQD--RFSGRYAVFTMPWRDNPDKNWTVTYNGKVIYPWYEKQLATLDDVV 297

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLR 337
              EV   +        IP   ++ A++       +P    I G D+A+EG D      R
Sbjct: 298 LAQEVDINYAASVEGVLIPSTWVQAAIDAHKKLQIEPTGDRIGGLDVADEGKDKNSFAAR 357

Query: 338 RGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG---- 391
            G V+ +L  WS    D+  T  K   L  +   D +  DA+  GA       ++     
Sbjct: 358 HGVVMTYLATWSGKGDDIFGTTQKAMDLCFEKSIDTLFYDADGLGAGCRGDARVINEKRR 417

Query: 392 ------YHVYRVLGQK-----------RAVDLEFCRNRRTELHVKMADWLE------FAS 428
                  +V    G             + ++ +F  N + +    +    +         
Sbjct: 418 ELGLSEINVESFRGSGSVHDPEGEMVEKRLNKDFFANLKAQSWWSLRLRFQETFRALEGR 477

Query: 429 LINHS---------------GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLM 473
             +                  L+    S  ++     G++ + +K+  G  S + +D +M
Sbjct: 478 DYDPDMIISLSSEDIDAKELALLTTELSQPTYTKNGVGKILV-NKQPDGTASPNRADSVM 536

Query: 474 YTF 476
             F
Sbjct: 537 ICF 539


>gi|167993618|ref|ZP_02574712.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
 gi|205328294|gb|EDZ15058.1| gp33 TerL [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-
           str. CVM23701]
          Length = 539

 Score =  136 bits (341), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/534 (12%), Positives = 152/534 (28%), Gaps = 92/534 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  +PE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQHPEMLPALKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +        N    +         R +G +     +   L      + +   +
Sbjct: 78  QEEWIHWIMERWGKRENGITEK--------SREMGLSWTAIGMACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWNEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                + DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYLVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMA 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  V   E+   +      
Sbjct: 236 NPFAQKRH--GGKIPVFTFHWRSDPRKDDEWYRRECEKID-NPVVVAQELDLNYSASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK-- 350
             IP + ++ A++        P    +   D+A+EG D      R G ++E++ +WS   
Sbjct: 293 VLIPSDWVQAAVDAHIRLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREWSGVG 352

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
           +D+  +  ++ G  E+   +    D +  GA        +                    
Sbjct: 353 SDIYQSVERVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRKAARRPPILATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINHSGLI 436
                     V    GQ   ++ +F  N + +    +                 N   +I
Sbjct: 413 GAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWYLRKLFRNTYRAVVEGMAYNPDEII 472

Query: 437 Q------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
                           S  ++ +   G++ +  K+  G +S + +D  M ++A 
Sbjct: 473 SISSTMESKDKLIIELSQPTYSINGVGKIVV-DKQPDGTRSPNLADSAMISYAP 525


>gi|53793591|ref|YP_112491.1| terminase large subunit [Flavobacterium phage 11b]
 gi|53748181|emb|CAH56642.1| terminase large subunit [Flavobacterium phage 11b]
          Length = 432

 Score =  136 bits (341), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 65/409 (15%), Positives = 137/409 (33%), Gaps = 39/409 (9%)

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+ L    ++      PG   +   +    LK T                +FE  S+   
Sbjct: 32  KSALGILWLIEQCQAYPGTRWLMGRSKLKALKETT------------LNTFFEQASILKI 79

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINL 209
              +  +     +  ++     +   Y+      F    +        DE +        
Sbjct: 80  TEQYNYNAQSGVIYWNNGSEILLKDLYAYPSDQNFDSLGSLEISGAFIDECNQITYKAWQ 139

Query: 210 GILG----FLTERNANRFWIMTSNP-RRLSGKFYEIFNKP---LDDWKRFQIDTRTVEGI 261
            +       L +       + T NP +      + + +K     +D K  Q        +
Sbjct: 140 IVKSRIRYKLNQYGIEPKMLGTCNPAKNWVYAQFYLKDKNGTLDNDKKFIQALPTDNPHL 199

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEALNREPCPDPYAPLIM 320
             S+   ++    LD +  +    G +    D    I    I+          P+  + +
Sbjct: 200 PASYLTSLL---SLDENSKQRLYYGNWEYDNDPAKLIDYEKIQNCFTNTFI--PFGEMYI 254

Query: 321 GCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
             DIA  G D  V+ +  G  +  +F  +K+ +      + GL  K++     +  +   
Sbjct: 255 SADIARFGSDKMVICVWSGFRVVEIFSMAKSSITEIAEAVRGLSIKHKVPLSNVICDED- 313

Query: 381 ARTCDYLEMLGYHVYRVLGQKRAVDLE--FCRNRRTELHVKMADWLEFASLINH------ 432
                 +++LG   +    +   VD +    +N +T+ + K+A+ ++  +L  H      
Sbjct: 314 GVGGGVVDVLGCTGFINNSRAMEVDNQVVQYQNLKTQCYYKLAEVIQSNNLYIHSEDATV 373

Query: 433 -SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFA 477
              + + L+ +K   + + G+L + SK   +    +S DYSD LM    
Sbjct: 374 NDEITKELEQVKRDKIDSDGKLQLISKDKVKQAIGRSPDYSDALMMRMY 422


>gi|211731761|gb|ACJ10100.1| terminase [Bacteriophage APSE-4]
          Length = 469

 Score =  136 bits (341), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 73/461 (15%), Positives = 131/461 (28%), Gaps = 86/461 (18%)

Query: 84  AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEM 143
            GRG  KT   A + L   +       +CL      ++ ++ A +   +  L  +  F +
Sbjct: 12  GGRGGMKTVSFAKIALLTAAMHK-RRFLCLREFINSIEDSVHAVLQAEVETLGLQVRFRV 70

Query: 144 QSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGT 203
            +  +                 +       +        +    H         +EA   
Sbjct: 71  LNSCI--------------EGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETV 112

Query: 204 PDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKP------------LDDWKRF 251
            +     ++  + +  +  ++    NP    G  Y  F KP             D+    
Sbjct: 113 SEKSLDTLIPTIRKPGSELWFSF--NPAEEDGAVYRRFVKPYKAIIDKQGYYEDDEVYVG 170

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
           ++       +              +    R    G+      D+ I    ++ A++    
Sbjct: 171 KVSYLDNPWLPAELKNDAQKMKRENYKKWRHVYGGECDANYGDALIQPEWVDAAIDAHIK 230

Query: 312 P--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRP 369
               P    ++  D A+ G D   +  R G +IE    WS+ D+             YR 
Sbjct: 231 LGFKPSGIRVVTFDPADSGQDEKALSKRYGVLIEDCVSWSEGDVADATITAFDDAFDYRA 290

Query: 370 DAIIIDANNTGARTC------------------------DYLEML----GYHVYRVLGQK 401
           D  I D    GA T                         DY + +               
Sbjct: 291 DDFIYDNIGLGAGTVKTHLRHSNDGTKMVVTGFGAGDSPDYPDEIYVPGNGEYLPSSNND 350

Query: 402 RAVDLEFCRNRRTELHVKMADWL-------EFASLINHSGLI-------------QNLKS 441
                +  RN+R +  V +AD         E    ++   LI               L  
Sbjct: 351 DRTHRDTFRNKRAQYWVYLADRFYKTWRAVERGEYLDPDALISLSSKIAKLSQLKSELIK 410

Query: 442 LKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMYTFAEN 479
            +    P    + + SK   R+KG KS + +D LM +FA  
Sbjct: 411 QQRKRTPGNRLIQLMSKDEMRLKGIKSPNMADTLMMSFANP 451


>gi|61806303|ref|YP_214662.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
 gi|61563847|gb|AAX46902.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM4]
          Length = 550

 Score =  135 bits (338), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 61/469 (13%), Positives = 133/469 (28%), Gaps = 68/469 (14%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFV-LHFFPWGEKGTPLEGFSAPRSWQLEFME 60
                 N  T+     +    +       F+  +          +       ++Q + + 
Sbjct: 12  PNLKKANVSTQFTKKQVAEYMKCAQDPVYFIRKYIRIVSLDEGVIPFDMY--NFQEDMVT 69

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H  N    P            R  GK+T+    +LW +     ++V  LAN     
Sbjct: 70  KFHQHRFNIAKLP------------RQSGKSTIVTAYLLWYVLFNANVNVAILANKAPTA 117

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
           +  L             +     ++L              SL +++        T     
Sbjct: 118 REML------------GRLQLSYENLPKWMQQGILGWNKGSLELENGSKILASST----- 160

Query: 181 PDTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSG 235
             +           I  DE +  P    +     +   ++   +     I T +      
Sbjct: 161 --SASAVRGMSFNIIFLDEFAFVPNHIAEQFFASVYPTISSGKSTKVIIISTPHGMNQFY 218

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
           K +    +  +++   ++    V G D  + +  I          RVE   +F     D+
Sbjct: 219 KLWHDAERGANNYVATEVHWSQVPGRDDKWKQQTIENTSE--AQFRVEFECEFLGSV-DT 275

Query: 296 FIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEE-GGDNTVVVLRRG---- 339
            I  + +     ++P                   I+  D++   G D +   +       
Sbjct: 276 LITPSKLRIMPYKDPIQENRGLAVYEHVQENHNYIITVDVSRGVGNDYSAFCVIDTTTVP 335

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVY 395
             +   +  ++       N I  +   Y    ++ + N+ G +  D     LE     + 
Sbjct: 336 YKVVARYKNNQIKPLVFPNLIVDVATNYNGAYVLCEVNDIGGQVADIIQYDLEYENLLMV 395

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS------LINHSGLIQN 438
            + G+      +    ++T+L +KM+  ++         LI    LI  
Sbjct: 396 SMRGRAGQQLGQGFSGKKTQLGIKMSTAVKQVGCSNLKALIEDDKLIVE 444


>gi|294650848|ref|ZP_06728195.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292823266|gb|EFF82122.1| bacteriophage terminase large subunit TerL [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 552

 Score =  134 bits (337), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 84/545 (15%), Positives = 156/545 (28%), Gaps = 102/545 (18%)

Query: 1   MSRELPTNPETEQ-KLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAP-------R 52
           MSR       TEQ +L       + K    ++  H + W      +  F  P       R
Sbjct: 28  MSRRYYYKAVTEQSELSIQAEIYKCKNDPIHWFNH-WIWTYDPRGM-SFGLPANIPFVLR 85

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
             Q+E +E +      +            I   R  G + +     L       G +   
Sbjct: 86  PKQVELVEWLSE--RENTQTHG------LIEKSRDEGMSYVVLGYFLHRWLFVDGFAGGV 137

Query: 113 LANSETQLKTT-----LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
            +  E  +        L+ +     S +P+          + P  +   V    + I + 
Sbjct: 138 GSRKEELVDKKGDPKTLFHKFRDMFSKMPDW---------MKPTGFVEKVHDNYMRIINP 188

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
                    + +                  DE +         +   ++        I  
Sbjct: 189 DNGATITGEAGDNIG-----RGGRTTMYFLDEWAFV--ERQEAVDAAIS--QNTNVHIKG 239

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGID----------PSFHEGIIARYGLDS 277
           S P  +  +F++   +    +  F +  R     +            ++E  +A   LD 
Sbjct: 240 STPNGIGDRFHQD--RFSGRYAVFSMPWRANPDKNWTVEYNGKQIHPWYEKQLAT--LDD 295

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVV 335
            V   EV   +        IP   ++ A++       +P    I G D+A+EG D     
Sbjct: 296 VVLAQEVDINYAASVEGVLIPSTWVQLAIDAHIKLGIEPTGDRIAGLDVADEGKDKNSFA 355

Query: 336 LRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDAIIIDANNTGAR------TCDYL 387
            R G V+ +L  WS    D+  T  K   L      D +  DA+  GA         + L
Sbjct: 356 SRHGIVMTYLDTWSGKGDDIFGTTQKAMDLSIDQSIDTLFYDADGLGAGCRGDARVVNEL 415

Query: 388 EML----GYHVYRVLGQKR-----------AVDLEFCRNRRTELHVKMADWLEF-----A 427
                     V    G                + +F  N + +    +    +       
Sbjct: 416 RREQGLSEVDVQPFRGSGAVHEPDEQMVEMRFNKDFFANLKAQSWWSLRLRFQETFRALE 475

Query: 428 SLINHSGLI----------QNL------KSLKSFIVPNTGELAIESKRVKGAKSTDYSDG 471
                  +I          + L       S  ++     G++ + +K+  G  S + +D 
Sbjct: 476 GREYDRDMIISFSSEHIDPKELAMLTTELSQPTYTKNGVGKILV-NKQPDGTASPNRADS 534

Query: 472 LMYTF 476
           +M  F
Sbjct: 535 VMICF 539


>gi|170023468|ref|YP_001719973.1| hypothetical protein YPK_1222 [Yersinia pseudotuberculosis YPIII]
 gi|169750002|gb|ACA67520.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 534

 Score =  134 bits (336), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 70/520 (13%), Positives = 156/520 (30%), Gaps = 89/520 (17%)

Query: 25  KLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPE 76
           + + + F++    WG        + G P+         Q E++  +     N  N    +
Sbjct: 43  RNNPAQFII---DWGMTTDPRNLDYGLPVSIPFLLFPKQEEWVHWIMDRRRNMENGLTDK 99

Query: 77  VFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLP 136
                    R +G + ++  L   L      + +   +  E  + +T   +   W +   
Sbjct: 100 --------SREMGLSWVSVGLSSTLCLFNKEMVIGFGSRKEEYVDSTGDPKALFWKAR-- 149

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
               F     +     W +      + I+     ++ +  + +                 
Sbjct: 150 ---KFIETLPAEFRGSWDNKKHAPYMRIEFPDSGSIIKGEAGDNIG-----RGDRTTMYF 201

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
            DE++       L I   L+     R  I  S+   ++  F +  +        F    R
Sbjct: 202 VDESAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMNNPFAQKRH--GGKIPVFTFHWR 255

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC--PDP 314
           +    D ++++    +   +  +   E+   +        IP   ++ A+         P
Sbjct: 256 SDPRKDDAWYKKECEKID-NPVIVAQELDLNYNAAAEGILIPSEWVQAAIGAHTKLGITP 314

Query: 315 YAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDAI 372
               I   D+A+EG D      R G +++ L  WS    D+  T      L ++   D +
Sbjct: 315 SGARIGALDVADEGIDLNAFSSRTGVLLDRLKAWSGKGSDIYATTQDAMILSDENDCDYL 374

Query: 373 IIDANNTGARTCDYLEMLG----------YHVYRVLGQK-----------------RAVD 405
           + D++  GA       ++             +    G                      +
Sbjct: 375 LYDSDGLGAGCRGDGRVINETRQKAGQRQVEIKPFRGSGEVIYPDKPVFKADTKRDARTN 434

Query: 406 LEFCRNRRTELHVKMADWLEFAS--------------------LINHSGLIQNLKSLKSF 445
            ++  NR+ +    +    +                       L     LI  L S  ++
Sbjct: 435 KDYFANRKAQGWWALRMRFQEVYRAVVKGMPFDPDEIISIDENLPEKEKLIAEL-SQPTY 493

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDM 485
            +   G++ +  K   G +S +++D +M  +A    R   
Sbjct: 494 TINGAGKVTV-DKAPSGTRSPNHADTVMICYAPEKIRRST 532


>gi|113200627|ref|YP_717790.1| terminase large subunit [Synechococcus phage syn9]
 gi|76574526|gb|ABA47091.1| terminase large subunit [Synechococcus phage syn9]
          Length = 549

 Score =  132 bits (331), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/462 (13%), Positives = 140/462 (30%), Gaps = 60/462 (12%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   E     +    +   +   F+ ++         L  F     +Q E ++ 
Sbjct: 11  PNLKKANVSQEFTPDQVAEVIKCSENPVYFIKNYIKIVSLDKGLIPFDM-YYFQEEMVQK 69

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              +  N    P            R  GK+T+    +LW +     ++V  LAN     +
Sbjct: 70  FHDNRFNIAKLP------------RQSGKSTIVTSYLLWYVLFNANVNVAILANKAATAR 117

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L             +     ++L              SL +++        T      
Sbjct: 118 EML------------QRLQLSYENLPKWLQQGILQWNRGSLELENGSKILAAST------ 159

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
            +           I  DE +  P    D     +   ++   +     I T +   +  K
Sbjct: 160 -SASAVRGMSFNVIFLDEFAFVPNHVADQFFSSVYPTISSGKSTKVIIISTPHGMNMFYK 218

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    +  +++   ++    V G D ++ E  I          RVE   +F     D+ 
Sbjct: 219 LWHDAERKANEYIPTEVHWSEVPGRDAAWKEQTIKNTSE--QQFRVEFECEFLGSV-DTL 275

Query: 297 IPLNIIEEALNREPCPDPYA-----------PLIMGCDIAE--EGGDNTVVVLRRGPVIE 343
           I  + +   +  +P  +                ++  D++    G  +  +V+    +  
Sbjct: 276 ISPSKLRTMVYGDPIAEKNGLSMYEKTIQGHTYVITADVSRGVSGDYSAFLVIDTTTIPY 335

Query: 344 HLFDWSKTDL---RTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYR 396
            L    + +        N I  +   Y    ++++ N+ G +  D     LE     +  
Sbjct: 336 KLVAKYRNNDIKPILFPNIIVDVARNYNHAFVLVEVNDVGGQVADIIQYDLEYDNLLMCA 395

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           + G+      +    ++T++ +KM+   +     N   L+++
Sbjct: 396 MRGRAGQQLGQGFSGKKTQMGIKMSSATKQVGCSNLKALLED 437


>gi|238765012|ref|ZP_04625949.1| Terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
 gi|238696781|gb|EEP89561.1| Terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
          Length = 587

 Score =  131 bits (329), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 57/463 (12%), Positives = 115/463 (24%), Gaps = 38/463 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           +                  +     I   R IG T   A   L    T     +   A S
Sbjct: 138 DIFLETTFEYQKGWYRAGLQHRIRNILKSRQIGATFYFAREALIDALTTGRNQIFLSA-S 196

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQ-----SLSLHPAPWYSDVLHCSLGIDSKHYST 171
           + Q        +  +   +      +       +               +  +    Y  
Sbjct: 197 KAQAH-VFKNYIIDFARQVEVDLKGDPMVLANGARLFFLGTNIRTAQSYTGNLYLDEYFW 255

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S           G L  +             
Sbjct: 256 IPKFQELRKVASGMSLHKKWRTTYFSTPSSLAHSAYPFW-SGELFNKGRKNKEQHIYVDL 314

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             S   +          +   ++     G +    + +   Y       +  +  +F   
Sbjct: 315 SHSHLMHGALCGDGQWRQIVTVEDALAGGCNLFDLDQLALEYS--PAEYQNLLMCEFVDD 372

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTVVVL----- 336
               F    +    ++     D + P            +G D +  G     VVL     
Sbjct: 373 KTSVFPFEELQGCMVDSLEEWDDFNPYAYRPFGYRAVWLGYDPSHTGDSAGCVVLAPPLV 432

Query: 337 -RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 I     W   D  T    I  L EKY  + I IDA   G      +      V 
Sbjct: 433 PGGKFRILERHQWKGMDFATQAESIKTLTEKYCVEYIGIDATGIGQGVYQLVREFFPAVQ 492

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGE 452
            +               +T L +K  D +    L   S    + Q+  +++  +  + G 
Sbjct: 493 EIRYSPE---------IKTALVLKAKDLITSGRLEYDSGHTDITQSFMAIRKTMTASGGR 543

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
              ++ R + A   D +   M+     P  +   + +     +
Sbjct: 544 ATYQASRSEDASHADIAWAAMHAMINEPLTAGSGYAQSSILDF 586


>gi|320091491|gb|ADW08983.1| terminase-like protein [Clavibacter phage CN77]
          Length = 414

 Score =  130 bits (327), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 65/368 (17%), Positives = 122/368 (33%), Gaps = 55/368 (14%)

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
           G  ++  +   R   ++   TF G        +  DEA G P  +  G    +T +++  
Sbjct: 17  GSGNEAIAFGKRPTDQDIVSTFQGTRKLR-TFVALDEAGGVPPELFTGAEAVMTGQDSKI 75

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFH---------------- 266
             I   + R             +D+W  F I    +  +                     
Sbjct: 76  VAIGNPDSRGTEFHRIFTVPALMDEWNTFTISAYDLPTVTGEVVYPDHPEKQERMLKGLT 135

Query: 267 --------EGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL 318
                   E +    G        +V G+FP +  ++F P   I+   +      P   +
Sbjct: 136 SLDWIQHKERVWKVGGKPDGRFLAKVLGEFPGETDNAFFPQEAIDRGNDTTID-KPEKGI 194

Query: 319 IMGCDIAEEGGDNTVVVLRRGPVIEHLF----------------DWSKTDLRTTNNKISG 362
           IMG D+A  G D++VV   +G  +                     WSK +   +  ++  
Sbjct: 195 IMGVDLARMGDDDSVVYTNQGGRVRLFKGQVRYSDREGTKTTTGVWSKENTVASARRVHA 254

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLG------YHVYRVLGQKRAVDLEFCRNRRTEL 416
           +  +     + +D++  G    D LE L       Y +  +     + +     N R E 
Sbjct: 255 IAMQIGAKQVRLDSSGIGGAVFDELEQLEEFDGKCYTLVGINNANSSSNNMRWANIRAEN 314

Query: 417 HVKMADWLEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSD 470
           H  + D L    L      + L   L  + ++ +   G + I  K   + +   S D  D
Sbjct: 315 HDNLRDMLIKGYLDLDPEDTMLRDELLVI-TYKLNLRGAVQITPKDEMKSELNGSPDRLD 373

Query: 471 GLMYTFAE 478
            ++Y+ A+
Sbjct: 374 AVIYSLAD 381


>gi|238788385|ref|ZP_04632179.1| Terminase, ATPase subunit [Yersinia frederiksenii ATCC 33641]
 gi|238723631|gb|EEQ15277.1| Terminase, ATPase subunit [Yersinia frederiksenii ATCC 33641]
          Length = 587

 Score =  130 bits (327), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 57/463 (12%), Positives = 115/463 (24%), Gaps = 38/463 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           +                  +     I   R IG T   A   L    T     +   A S
Sbjct: 138 DIFLETTFEYQKGWYRAGLQHRIRNILKSRQIGATFYFAREALIDALTTGRNQIFLSA-S 196

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQ-----SLSLHPAPWYSDVLHCSLGIDSKHYST 171
           + Q        +  +   +      +       +               +  +    Y  
Sbjct: 197 KAQAH-VFKNYIIDFARQVEVDLKGDPMVLANGARLFFLGTNIRTAQSYTGNLYLDEYFW 255

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S           G L  +             
Sbjct: 256 IPKFQELRKVASGMSLHKKWRTTYFSTPSSLAHSAYPFW-SGELFNKGRKNKEQHIYVDL 314

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             S   +          +   ++     G +    + +   Y       +  +  +F   
Sbjct: 315 SHSHLMHGALCGDGQWRQIVTVEDALAGGCNLFDLDQLALEYS--PAEYQNLLMCEFVDD 372

Query: 292 DIDSFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTVVVL----- 336
               F    +    ++     D + P            +G D +  G     VVL     
Sbjct: 373 KTSVFPFEELQGCMVDSLEEWDDFNPYAYRPFGYRAVWLGYDPSHTGDSAGCVVLAPPLV 432

Query: 337 -RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 I     W   D  T    I  L EKY  + I IDA   G      +      V 
Sbjct: 433 LGGKFRILERHQWKGMDFATQAESIKTLTEKYCVEYIGIDATGIGQGVYQLVREFFPAVR 492

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGE 452
            +               +T L +K  D +    L   S    + Q+  +++  +  + G 
Sbjct: 493 EIRYSPE---------IKTALVLKAKDLITSGRLEYDSGHTDITQSFMAIRKTMTASGGR 543

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
              ++ R + A   D +   M+     P  +   + +     +
Sbjct: 544 ATYQASRSEDASHADIAWAAMHAMINEPLTAGNGYAQSSILDF 586


>gi|297520464|ref|ZP_06938850.1| hypothetical protein EcolOP_22727 [Escherichia coli OP50]
          Length = 313

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/298 (14%), Positives = 93/298 (31%), Gaps = 54/298 (18%)

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
             ++  F +  +        F    R     D  ++     +   +  V   E+   +  
Sbjct: 5   NGMANPFAQKRH--GGKIPVFTFHWRDDPRKDEEWYRRECEKID-NPVVVAQELDLNYSA 61

Query: 291 QDIDSFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDW 348
                 IP   ++ A++        P    +   D+A+EG D      R G ++E++ +W
Sbjct: 62  SAEGVLIPSEWVQAAVDAHIKLGIQPTGKRLGAMDVADEGRDKNAFSTRHGFLLENVREW 121

Query: 349 SK--TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY-------------- 392
           S   +D+  +  K+ G  E+   +    D +  GA        +                
Sbjct: 122 SGVGSDIYQSVEKVFGFCEQDNLEEFRFDEDGLGAGVRGDARAINELRNVARRPSILATP 181

Query: 393 -------------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE-------FASLINH 432
                         V    GQ   ++ +F  N + +   ++    +            N 
Sbjct: 182 FRGSGAVFDPDDEAVRGDNGQAARLNKDFFANAKAQSWWRLRKLFQNTWRAVVEGMAYNP 241

Query: 433 SGLIQ------------NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
             +I                S  ++ +   G++ I  K+  G +S + +D +M  +A 
Sbjct: 242 DEIISISSSMALKDKLIIELSQPTYSINGVGKIVI-DKQPDGTRSPNLADSVMINYAP 298


>gi|326784562|ref|YP_004324947.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
 gi|310004595|gb|ADO98987.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM7]
          Length = 550

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 64/441 (14%), Positives = 134/441 (30%), Gaps = 60/441 (13%)

Query: 23  EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           +       F+  +         L  F+    +Q E +E    +  N    P         
Sbjct: 33  KCSEDPVYFIQTYIKIVSLDRGLIPFAM-YDFQSEMVEKFHDNRFNIAKLP--------- 82

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
              R  GK+T+    +LW +  +  ++V  LAN     +  L             +    
Sbjct: 83  ---RQTGKSTIVTSYLLWYVLFKANVNVAILANKAATSREML------------QRLQLS 127

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
            ++L              SL +++        T S                 I  DE + 
Sbjct: 128 YENLPKWLQQGILQWNRGSLELENGSKIMAASTSS-------SAVRGMSFNVIFLDEFAF 180

Query: 203 TP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
            P    D     +   ++   +     I T +   +  K +    +  +++   ++    
Sbjct: 181 VPNHIADQFFSSVYPTISSGKSTKVIIISTPHGMNMFYKLWHDAERGKNEYIPTEVHWSA 240

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP----- 312
           V G D ++ +  IA         +VE   +F     D+ I  + +      +P       
Sbjct: 241 VPGRDAAWKDQTIANTSE--QQFKVEFECEFLGSV-DTLISPSKLRTMPYEDPIIQNRGL 297

Query: 313 ------DPYAPLIMGCDIAE--EGGDNTVVVLRRGPVIEHLFDWSKTDLRT---TNNKIS 361
                 +     I+  D+A       +   ++    V   L    + +        N I 
Sbjct: 298 AVYKQVEKDHNYIVTVDVARGVSQDYSAFCIIDTTTVPYELVAKYRNNDIKPIIFPNVIV 357

Query: 362 GLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            + + Y    ++ + N+ G +  D     LE        + G+      +    ++T+L 
Sbjct: 358 DVAKNYNNAYVLCEVNDIGGQVADIIQFDLEYENLLQVAMRGRAGQQLGQGFSGKKTQLG 417

Query: 418 VKMADWLEFASLINHSGLIQN 438
           VKM+  ++     N   L++ 
Sbjct: 418 VKMSTAVKAVGCSNLKALLEE 438


>gi|326781864|ref|YP_004322266.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM2]
 gi|310003054|gb|ADO97452.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SM2]
          Length = 549

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 70/477 (14%), Positives = 132/477 (27%), Gaps = 71/477 (14%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   E     ++   + K     F  ++         L  F  P  +Q + +  
Sbjct: 10  PNLKKANTPIEFTEEQVIEFLKCKEDPVYFANNYIKIVSLDEGLTQFH-PYHFQEKLINN 68

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              +  N    P            R  GK+T     +L        +++  LAN     +
Sbjct: 69  FHNNRFNICKMP------------RQTGKSTTVVSYLLHYAVFNDSVNIGILANKAATAR 116

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L   +      LP                        SL +++        T      
Sbjct: 117 ELL-GRLQTAYENLP-----------RWMQQGIIAWNKGSLELENGSKILAAST------ 158

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
            +           +  DE +  P    D     +   +T   N     + T +      +
Sbjct: 159 -SASAVRGMSFNILFLDEFAFVPNHVADSFFASVYPTITSGKNTKVIIVSTPHGMNHFYR 217

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    K  +++    +    V G D  + E  IA         +VE   +F        
Sbjct: 218 MWHDAEKRKNEYIPTDVHWSEVPGRDDKWKETTIANTSE--QQFKVEFECEFLGSVDTLI 275

Query: 297 IPLNI----IEEALNREPCPDPYAP------LIMGCDIAE--EGGDNTVVVLRRGPVIEH 344
            P  +     +  + R    D Y P       +M  D+A       +  V +        
Sbjct: 276 APSKLRTLIYDNPIQRNAGLDVYEPPKDKHDYVMTVDVARGVGEDYSAFVCVDITEFPHR 335

Query: 345 LFDWSKTDL---RTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRV 397
           +    + +        N I  + + Y    I+ + N+ G +        LE     +  +
Sbjct: 336 IVAKYRNNDIKPMLFPNIIYEVAKNYNSAYILCEVNDIGDQVASILQYDLEYQNLLMCSM 395

Query: 398 LGQKRAVDLEFCRNRRTELHVKM------------ADWLEFASLI-NHSGLIQNLKS 441
            G+   +  +    ++T+L VKM               +E   LI N   +I  L +
Sbjct: 396 RGRAGQIVGQGFSGKKTQLGVKMSKTVKKVGSLNLKTLIEEDKLIFNDYEIISELTT 452


>gi|120602517|ref|YP_966917.1| hypothetical protein Dvul_1472 [Desulfovibrio vulgaris DP4]
 gi|120562746|gb|ABM28490.1| protein of unknown function DUF264 [Desulfovibrio vulgaris DP4]
          Length = 599

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/468 (12%), Positives = 121/468 (25%), Gaps = 46/468 (9%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  +Q +       +                    R IG T   A              +
Sbjct: 148 PALFQEKLHARYFDYQRQLRAALTHRNRML--LKARQIGATWYFAQEAFENACLTGDNQI 205

Query: 111 ICLANS-ETQL-KTTLWAEVSKWLS-LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS- 166
              A   ++Q+ +  +     +     L         +       + S+    +      
Sbjct: 206 FLSATKAQSQVFRNYIMQIAGEAFDITLSGNPMVLHTAHGKAELHFLSNSSRSAQSYHGH 265

Query: 167 ---KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                +  + +     +  T +  H  +   + +  ++ T +   L        R +   
Sbjct: 266 VYIDEFFWITKFKELFKVATGMAAHKRWRRTLFSTPSAITHEAYPLWSGETFQRRFSKPR 325

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P   + +   +     D + R  I     E       +    +     +  R  
Sbjct: 326 ----PWPDTEAMRAGVLCP---DTYFRNIITLADAEAGGCDLFDVAQLKLEYTPEEFRQL 378

Query: 284 VCGQFPQQDIDSFI----------PLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F       F           P +  +     +P P    P+  G D A  G D + 
Sbjct: 379 FGCEFIDDTQGVFRLAQLEACMVDPADWQDVRQG-DPHPVGNLPVWGGYDPARSGDDASF 437

Query: 334 VVL----RRGP--VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            VL    R G          W          +I  L EKYR   + ID    G    + +
Sbjct: 438 AVLLPDLRDGGGIRCIERHKWKGRSYLWQAERIRELAEKYRFAHLGIDTTGPGIGVFEQV 497

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
           +        +    ++         +  L +K  + +E   L   +    +     +++ 
Sbjct: 498 QQFCPVATPINYGVQS---------KAMLVLKAREVIEEGRLQWDAAETDIAHAFMTIRQ 548

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPS 492
                 G++   + R       D +  +M+  A  P        RC  
Sbjct: 549 TTTD-RGQITYAATRNATTGHADVAWAIMHALAAEPLARRGASTRCTV 595


>gi|120603805|ref|YP_968205.1| hypothetical protein Dvul_2767 [Desulfovibrio vulgaris DP4]
 gi|120564034|gb|ABM29778.1| protein of unknown function DUF264 [Desulfovibrio vulgaris DP4]
          Length = 599

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/468 (12%), Positives = 121/468 (25%), Gaps = 46/468 (9%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  +Q +       +                    R IG T   A              +
Sbjct: 148 PALFQEKLHARYFDYQRQLRAALTHRNRML--LKARQIGATWYFAQEAFENACLTGDNQI 205

Query: 111 ICLANS-ETQL-KTTLWAEVSKWLS-LLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS- 166
              A   ++Q+ +  +     +     L         +       + S+    +      
Sbjct: 206 FLSATKAQSQVFRNYIMQIAGEAFDISLSGNPMVLHTAHGKAELHFLSNSSRSAQSYHGH 265

Query: 167 ---KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                +  + +     +  T +  H  +   + +  ++ T +   L        R +   
Sbjct: 266 VYIDEFFWITKFKELFKVATGMAAHKRWRRTLFSTPSAITHEAYPLWSGETFQRRFSKPR 325

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P   + +   +     D + R  I     E       +    +     +  R  
Sbjct: 326 ----PWPDAEAMRAGVLCP---DTYFRNIITLADAEAGGCDLFDVAQLKLEYTPEEFRQL 378

Query: 284 VCGQFPQQDIDSFI----------PLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F       F           P +  +     +P P    P+  G D A  G D + 
Sbjct: 379 FGCEFIDDTQGVFRLAQLEACMVDPADWQDVRQG-DPHPVGNLPVWGGYDPARSGDDASF 437

Query: 334 VVL----RRGP--VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
            VL    R G          W          +I  L EKYR   + ID    G    + +
Sbjct: 438 AVLLPDLRDGGGIRCIERHKWKGRSYLWQAERIRELAEKYRFAHLGIDTTGPGIGVFEQV 497

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
           +        +    ++         +  L +K  + +E   L   +    +     +++ 
Sbjct: 498 QQFCPVATPINYGVQS---------KAMLVLKAREVIEEGRLQWDAAETDIAHAFMTIRQ 548

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPS 492
                 G++   + R       D +  +M+  A  P        RC  
Sbjct: 549 TTTD-RGQITYAATRNATTGHADVAWAIMHALAAEPLARRGASTRCTV 595


>gi|323146129|gb|ADX32368.1| putative terminase ATPase subunit [Cronobacter phage ESSI-2]
          Length = 639

 Score =  128 bits (320), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/456 (12%), Positives = 131/456 (28%), Gaps = 53/456 (11%)

Query: 54  WQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICL 113
           W  E +     H   ++      + K      R IG T   A+             +   
Sbjct: 191 WADEHLFGYQKHLRANIGQQVRNILK-----SRQIGATWYFAFEAFENAVLTGDPQIFLS 245

Query: 114 ANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHCSL 162
           A+          AEV +   +   + +F +                  +   +     S 
Sbjct: 246 ASKAQ-------AEVFRSYIVNIAEQYFGITLTGNPIRLSNGAELRFLSTNKNTAQSYSG 298

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +    Y  +          + +  H+ +     +  ++ T             + +  R
Sbjct: 299 HLYCDEYFWVPNFARLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKQGSKKR 358

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
             +   +   +      +       +    ++     G + +  E +  RY  +     +
Sbjct: 359 AAVKFPSFDEMRDG-GRLCPDGQWRY-VITMEDAIAGGFNLASIEKLRNRY--NPTTFNM 414

Query: 283 EVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTV 333
                F       F   ++    +E    ++  PD   P     +  G D A  G  +  
Sbjct: 415 LYMCVFVDSKDSVFSYGDLEACAVETETWQDHKPDAPRPFGDREVWGGFDPARSGDFSCF 474

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V++           +  +F+W   + R    +I  L +KY    + +D    G    D +
Sbjct: 475 VIVAPPLFAGEKFRVLRVFNWKGMNFRWQAKQIEQLFKKYNFAYLGVDVTGIGQGVFDNI 534

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKS 444
           +     V        AV + + RN + +L +K AD +E   +     L +   +  +++ 
Sbjct: 535 QHFALRV--------AVPIRYDRNTKNQLVLKAADVVESQRIEWDKELKEIPASFMAIRR 586

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
                 G +   + R       +    + +     P
Sbjct: 587 TTTQAGGSMTFVADRSTDTGHAEAFWAIAHALHNEP 622


>gi|308187132|ref|YP_003931263.1| Terminase, ATPase subunit (GpP) [Pantoea vagans C9-1]
 gi|308057642|gb|ADO09814.1| Terminase, ATPase subunit (GpP) [Pantoea vagans C9-1]
          Length = 587

 Score =  128 bits (320), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/462 (10%), Positives = 119/462 (25%), Gaps = 39/462 (8%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           FM+    + LN          +  + + R IG T   A   L    T     +   A+  
Sbjct: 140 FMDNCFEYQLNWHKAGLTHRIRNILKS-RQIGATFYFAREALIDALTTGRNQIFLSASKA 198

Query: 118 TQLKTTLWAEVSKWLSLLPNKHW-----FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
                     +  +                  +  +            +  +    Y  +
Sbjct: 199 QA--HVFKNYIIDFARQADVDLKGDPIVLPNGARLIFLGTNVRTAQSYTGNLYLDEYFWI 256

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
            +     +  + +  H  +     +  ++ +         G L  +              
Sbjct: 257 PKFQELRKVASGMSLHKKWRTTYFSTPSALSHSAYPFW-SGELFNKGRRSKDDRIEIDLS 315

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
            S              +   ++     G +      +   Y       +  +  +F   +
Sbjct: 316 HSHLAKGALCGDGQWRQIVTVEDALTGGCNLFDINQLQLEYS--PAEYQNLLMCEFVDDE 373

Query: 293 IDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTV------VVL 336
              F    +    ++     +           Y P+ +G D +  G           +V 
Sbjct: 374 ASVFPFAELQTCMIDSLEEWEDFNPYLPRPFAYRPVWIGYDPSHTGDSAGCAVIAPPLVA 433

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D       I  L +KY  + I +DA   G      +         
Sbjct: 434 GGKFRVLERHQWRGMDFAAQAKSIEDLTKKYTVEYIGVDATGIGQGVFQLVRQ------- 486

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
                 A ++++    +T + +K  D +    L   +    + Q+  +++  +  +    
Sbjct: 487 --FYPAAREIKYSPEVKTAMVLKAKDTISSGRLEYDAGATDITQSFMAIRKTMTASGNRS 544

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
             E+ R + A   D +  +M+     P  +          ++
Sbjct: 545 TYEASRSEEASHADVAWAIMHALLNEPLTAASGGANPSILEF 586


>gi|51597451|ref|YP_071642.1| orf16-like phage protein [Yersinia pseudotuberculosis IP 32953]
 gi|51590733|emb|CAH22378.1| Possible [Haemophilus phage HP1] orf16-like phage protein [Yersinia
           pseudotuberculosis IP 32953]
          Length = 601

 Score =  128 bits (320), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/482 (12%), Positives = 131/482 (27%), Gaps = 64/482 (13%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            SW  E +     HC  +       + K      R +G T   A+             V 
Sbjct: 142 DSWASEHLFDYQMHCRANKEQNFRHILK-----SRQVGMTYYFAFEAFEDAVLTGDRQVF 196

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          +E+ K+  +   +  F +                  +         
Sbjct: 197 FSASRAQ-------SEIFKFYIVEIAQQAFGITLTGNPIKLSNGAVLRFLSTNAGTAQGF 249

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       + +        + +  HN Y     +  ++ T     +       E +A
Sbjct: 250 NGHLYGDEIFWIPKFGKFHETASAMATHNKYRTTYFSTPSAKTHPAYPIWTGDTWREDDA 309

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R   +      L  K   +       +     D            E +  +Y  ++   
Sbjct: 310 KRKKAIFPKESELR-KGGILCPDDQWRYIITMEDAIKGGLGALVDIERLRNKY--NATAF 366

Query: 281 RVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +    QF       F    +    ++  + ++  P    P     +  G D +  G ++
Sbjct: 367 AMLYMCQFVDSKDAVFKFSELEKCAVDAGMWQDHDPKAARPFGNREVWGGFDPSRSGDNS 426

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T V++           +  ++ W   +     ++I  L+ +Y    I ID    G    D
Sbjct: 427 TFVIVAPPLYDGERFRVLAVYYWQGLNFNYQADQIKQLMRRYNMTYIGIDITGIGRGVFD 486

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCR-NRRTELHVKMADWLEFASLINH-----------S 433
            +E             R           +  L +KM D +    +              +
Sbjct: 487 LVER---------FAPREATPILYTVESKNRLVLKMIDTVSRGRIEWSKDATDECSQERA 537

Query: 434 GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
            +  +  +++     +   L   ++R       D    + +     P   D ++ R  ++
Sbjct: 538 EIAASFMAIRRTTTASGNALTFVAERSDATGHADVFFAISHAVINEP--LDYEYDRPSTW 595

Query: 494 QY 495
            +
Sbjct: 596 AF 597


>gi|258545857|ref|ZP_05706091.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
 gi|258518873|gb|EEV87732.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
          Length = 595

 Score =  127 bits (319), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 60/464 (12%), Positives = 129/464 (27%), Gaps = 39/464 (8%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
             F+  +  H      +      +  + + R IG T   A   L    T  G + I ++ 
Sbjct: 143 RAFLANIYPHQRAWYEHSKRYEMRQYVKS-RQIGATYYFAQEALITALTT-GKNQIFISA 200

Query: 116 SETQL----KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP-WYSDVLHCSLGIDSKHYS 170
           S++Q        +          L  +H       +L+      +     S  +    Y 
Sbjct: 201 SKSQAHVFKSNIVAFVEKTIGKTLRGEHIKLGPETTLYFLGTNSNTAQSYSGDLYVDEYF 260

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
            + +    +   + +  H+   +   +  ++ T +   L       +       I     
Sbjct: 261 WIPQFAKIQHVASGMTVHDDRRITYFSTPSTTTHEAYPLWTGQHFNKGRPKSEHINLDVS 320

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
                +     +          I+     G D    E +  ++          +  QF  
Sbjct: 321 HAALKEGRLCEDGYFRQ--LITIEDAINSGFDRVTLEKLRIKFPPG--QFENLLMCQFVN 376

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL---- 336
                F    +    ++       Y P          + +G D +    D ++VV+    
Sbjct: 377 DGDSIFKMAELQRCMVDAWTVWQDYTPLAARPLGDVPVWIGYDPSRSQDDASLVVIAPPQ 436

Query: 337 RRGPVIEHLF--DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
             G V   +    ++  D      KI      Y    I IDA   G    D +      V
Sbjct: 437 VEGGVFRIIDKQSFNGLDFDAQARKIRDFCRMYNVVHIAIDATGIGQAVYDLVRQFFPRV 496

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
            ++L    A         + E+ +K    +  A L   +    +     ++      +  
Sbjct: 497 RKILYSVEA---------KNEMVLKAKQLIAHARLQWDNGWTDIAHAFLTIHQAQTGSGR 547

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           ++  ++ R       D +   M+    +P     + G      +
Sbjct: 548 QVTYKASRTATTGHADLAWATMHALINDPLGQIDEAGFSGRRGF 591


>gi|147671611|ref|YP_001215893.1| terminase [Vibrio cholerae O395]
 gi|262167851|ref|ZP_06035552.1| terminase [Vibrio cholerae RC27]
 gi|146313994|gb|ABQ18534.1| terminase [Vibrio cholerae O395]
 gi|227014845|gb|ACP11054.1| putative terminase, ATPase subunit [Vibrio cholerae O395]
 gi|262023759|gb|EEY42459.1| terminase [Vibrio cholerae RC27]
          Length = 605

 Score =  127 bits (318), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 58/455 (12%), Positives = 118/455 (25%), Gaps = 40/455 (8%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL---KTT 123
                  N       I   R IG T   A   L          +   A S  Q    +  
Sbjct: 167 YQHTMRNNLHQRTRNILKSRQIGATYYFAGEALEQAILTGDNQIFLSA-SRAQADVFRRY 225

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSL--HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
           + A   ++L +    +   + + +   + +            +    Y  + +     + 
Sbjct: 226 IVAIAKEFLGIEITGNPSTLSNGAELHYLSTNGKTAQSYHGHVYIDEYFWIGKFDELNKV 285

Query: 182 DTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
            + +  H  +     +  +S                    R  I          +     
Sbjct: 286 ASAMATHKKWRKTYFSTPSSKMHPAYPFWTGEKWRGDKTTRKNIEFPTFD--ELRDGGRL 343

Query: 242 NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF----I 297
                      I+     G D    E +   Y              F       F    I
Sbjct: 344 CPDRQWRYVVTIEDAAKGGCDLFDIEELREEYSETD--FNNLFMCVFVDGASSIFEFNKI 401

Query: 298 PLNIIEEALNREPCPDPYAP-----LIMGCDIAEEGGDNT------VVVLRRGPVIEHLF 346
              +++  + ++  P+   P     + +G D +    +         +V      +    
Sbjct: 402 ERCMVDSEIWQDFKPNAARPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAVEKFRVLEKH 461

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
            W     +   ++IS + E++    + ID    GA   D L         V    R    
Sbjct: 462 TWRGLSFQHQASEISKVFERFNVTYLGIDITGIGAGVHDLL---------VNKHPRETVA 512

Query: 407 EFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKG 462
               N  +  L +KM D ++   L   +          ++K     +   +  +++R + 
Sbjct: 513 IHYSNENKNRLVMKMIDIIDGNRLQFDAGMKETAMAFMAIKRVATNSGNMMTFKAERSEQ 572

Query: 463 AKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           A   D    L +     P   D    R  ++Q   
Sbjct: 573 AGHADDFWALSHALINEP--LDHSTQRKSTWQMAA 605


>gi|253689540|ref|YP_003018730.1| hypothetical protein PC1_3171 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756118|gb|ACT14194.1| protein of unknown function DUF264 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 589

 Score =  127 bits (318), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 53/449 (11%), Positives = 113/449 (25%), Gaps = 43/449 (9%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+  +  +             +  + + R IG T   A   L    T     +   A S+
Sbjct: 141 FLSEIFEYQRGWHQAGLQHRIRNILKS-RQIGATFYFAREALIDALTTGRNQIFLSA-SK 198

Query: 118 TQLKTTLWAEVSKWLSLLPNKHW-----FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
            Q        +  +  L+              +               +  +    Y  +
Sbjct: 199 AQAH-VFKNYIIDFARLVDVDLKGDPMVLPNGARLFFLGTNIRTAQSYTGNLYLDEYFWI 257

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTER--NANRFWIMTSNP 230
            +     +  + +  H  +     +  +S               +   N      +  + 
Sbjct: 258 PKFQELRKVASGMSLHKKWRSTYFSTPSSLAHSAYPFWSGELFNKGRSNKADHLHLDLSH 317

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
             LSG            W++  +          +  +             +  +  +F  
Sbjct: 318 ANLSGGVLC----GDGQWRQI-VTVEDALSGGCNLFDLDQLMLEYSPAEYQNLLMCEFVD 372

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTVVVL---- 336
                F    +    ++     + + P            +G D +  G     VVL    
Sbjct: 373 DKASVFPFEELQRCMVDALEEWEDFNPYALRPFAYKPVWIGYDPSHTGDSAGCVVLAPPQ 432

Query: 337 --RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
                  I   F W   D     + I  L EKY  + I IDA   G      +       
Sbjct: 433 APGGKFRILERFQWKGMDFAAQADAIKLLTEKYIVEYIGIDATGIGQGVYQLVRGFFPAA 492

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T + +K  D +    L   +    + Q+  +++  +  +  
Sbjct: 493 REIKYSPE---------IKTAMVLKAKDTITSGRLEYDTSHTDITQSFMAIRKTMTASGN 543

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENP 480
               E+ R +     D +   M+     P
Sbjct: 544 RTTYEASRSEEISHADVAWATMHALLNEP 572


>gi|323146172|gb|ADX32410.1| terminase ATPase subunit [Cronobacter phage ENT90]
          Length = 587

 Score =  126 bits (317), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/438 (10%), Positives = 108/438 (24%), Gaps = 38/438 (8%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHW- 140
           I   R IG T   A   L    T     +   A+            +  +   +      
Sbjct: 163 ILKSRQIGATFYFAREALIDALTTGRNQIFLSASKAQA--HVFKNYIIDFARQVDVDLKG 220

Query: 141 ----FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
                   +  +            +  +    Y  + +     +  + +  H  +     
Sbjct: 221 DPIVLPNGARLIFLGTNVRTAQSYTGNLYLDEYFWIPKFQELRKVASGMSLHKKWRTTYF 280

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S +         G L  +               +              +   ++  
Sbjct: 281 STPSSLSHSAYPFW-SGELFNKGRRSKADRIEIDLSHTHLAKGALCGDGQWRQIVTVEDA 339

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP-- 314
              G +    + +   Y       +  +  +F   +   F    +    ++         
Sbjct: 340 LTGGCNLFDLDQLQLEYS--PSEYQNLLMCEFVDDEASVFPFAELQTCMIDSLEEWSDFN 397

Query: 315 --------YAPLIMGCDIAEEGGDNTV------VVLRRGPVIEHLFDWSKTDLRTTNNKI 360
                   Y P+ +G D +  G           +V      +     W   D       I
Sbjct: 398 PYLPRPFDYRPVWIGYDPSHTGDSAGCAVIAPPLVAGGKFRVLERHQWRGMDFAAQAKSI 457

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             L +KY  + I +DA   G      +         +               +T + +K 
Sbjct: 458 EDLTKKYTVEYIGVDATGIGQGVFQLVRQFYPAAREIRYSPE---------VKTAMVLKA 508

Query: 421 ADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            D +    L   +    + Q+  +++  +  +      E+ R + A   D +  +M+   
Sbjct: 509 KDTISSGRLEYDAGQTDITQSFMAIRKTMTASGNRSTYEASRSEDASHADVAWAIMHALL 568

Query: 478 ENPPRSDMDFGRCPSYQY 495
             P  +          ++
Sbjct: 569 NEPLTAASGGANPSILEF 586


>gi|190572396|ref|YP_001970241.1| putative phage terminase, ATPase subunit (gpp) [Stenotrophomonas
           maltophilia K279a]
 gi|190010318|emb|CAQ43926.1| putative phage terminase, ATPase subunit (gpp) [Stenotrophomonas
           maltophilia K279a]
          Length = 597

 Score =  126 bits (316), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 57/477 (11%), Positives = 116/477 (24%), Gaps = 62/477 (12%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
                 +Q                          I   R IG T   A   L    T   
Sbjct: 153 VDGCFDYQR-------DWYRAGNERTRV------ILKSRQIGATFYFAREALIDALTTGR 199

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS------LHPAPWYSDVLHCS 161
             +   A S++Q        +  ++  + ++                             
Sbjct: 200 NQIFLSA-SKSQAH-IFLGYMRGFVREVLDRDLTGDPITLANGAELFFLGTNARTAQGYH 257

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN 221
                  +          +  + +  H  +     +  ++   +  +        +    
Sbjct: 258 GNFYFDEFFWTYGFNQLNKVASGMAMHKKWRKTYFSTPSTMAHEAFDFWTGDRFNKGRPV 317

Query: 222 RFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT---RTVEGIDPSFHEGIIARYGLDSD 278
              I              +  +  +D    QI T       G D    E +   Y  +  
Sbjct: 318 SQQIQL-----DVSHARLMGGRRCEDAIWRQIVTVLDAAGRGCDLFDIEELRRDYSAEE- 371

Query: 279 VTRVEVCGQFPQQDIDSFI-----------PLNIIEEALNREPCPDPYAPLIMGCDIAEE 327
                +  +F       F             +  +++       P     + +G D AE 
Sbjct: 372 -FANLLMCEFVDDSASIFPLTMLQPCQVDSWVEWVDDFKPLAIRPYGDRAVWIGYDPAET 430

Query: 328 GGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGA 381
           G    +VV+           +     +   D       I  +  +Y    I IDA   G 
Sbjct: 431 GDSAGIVVVAPPLVPGGKFRVLERHQFKGMDFAAQAAFIQQVTLRYWVTYIGIDATGMGT 490

Query: 382 RTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQN 438
                +      V                  +T L +K  D ++   L   +    L Q+
Sbjct: 491 GVAQLVRQFFPGVTIFNYSPE---------VKTRLVLKAFDVIKNERLEYDAGWTDLTQS 541

Query: 439 LKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           L +++  I P+  ++   + R +     D +  LM+     P   +       S + 
Sbjct: 542 LLAIQKTITPSGRQVTYTAGRSRTTGHADLAWALMHALQNEP--LEGGTAARGSMEI 596


>gi|187476925|ref|YP_784949.1| phage terminase large subunit [Bordetella avium 197N]
 gi|115421511|emb|CAJ48020.1| Putative phage terminase large subunit [Bordetella avium 197N]
          Length = 512

 Score =  126 bits (315), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/280 (18%), Positives = 94/280 (33%), Gaps = 23/280 (8%)

Query: 236 KFYEIFNKPLDDWKRFQID-TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
            F       +   + F          +  + +E ++        +    + G F     D
Sbjct: 230 PFAHNGETIVPRSRTFIPSRIADNPFLMGTGYESVLQSLPE--PLRSQMLYGDFNAGIED 287

Query: 295 ---SFIPLNIIEEALNREPCPDPYAPLI-MGCDIAEEGGDNTVVVLRRGPVIEHLFDWSK 350
                IP   +E A  R   PD  AP+  +G D+A  G D T++  R G   +    +  
Sbjct: 288 DPWQVIPTAWVEAAQARWKRPDRLAPMDSLGLDVARGGRDKTILARRHGWWFDEPLVYPG 347

Query: 351 TDLRTTNNKISGLVEKYRPDAII-IDANNTGARTCDYLEMLGYHVYRVLGQKRA-----V 404
            D           +   R  A+I +D    GA   D+L      V  V   + A      
Sbjct: 348 KDTPDGPTVAGLAISALRDHAVIHLDVIGVGASPYDFLVTAKQQVVGVNVAEAACGTDKS 407

Query: 405 DLEFCRNRRTELHVKMADWLE-----FASLINHSGLIQNLKSLKSFIVPNTGELAIESKR 459
                 NRR+EL  +M + L+       +L     L+ +L +       +   L + S+ 
Sbjct: 408 GRLRFFNRRSELWWRMREALDPIHNTGIALPPDPRLLADLTAP--TWSLSGATLKVASRE 465

Query: 460 ---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYE 496
               K  +S D+    +    + P R+ ++       + +
Sbjct: 466 DIIDKIGRSPDFGSAYVLALMDTPKRAAVEALGQARSRLD 505


>gi|298480040|ref|ZP_06998239.1| PBSX family phage terminase [Bacteroides sp. D22]
 gi|298273849|gb|EFI15411.1| PBSX family phage terminase [Bacteroides sp. D22]
          Length = 476

 Score =  126 bits (315), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 60/411 (14%), Positives = 125/411 (30%), Gaps = 47/411 (11%)

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   A  +L++    PG                  AE+ +         +       + 
Sbjct: 64  KSWTGAVWLLFMCLCYPGSKWFIGR-----------AELKRITQSTLITFYKVCNQYGVD 112

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINL 209
              +  +  +  +   +     +     +     +  + +        +E          
Sbjct: 113 DTLYKYNGQYNYIEFFNGSRIDLLDLQYKPGDPLYERYGSIEYTGGWIEEGGEVNFGAYD 172

Query: 210 GILGFL-----TERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDT--RTV 258
            +   +      E    R   +T NP++     Y+ F KP          + +    +  
Sbjct: 173 TLKTRIGRHLNNELGLRRKLFITCNPKK--NWMYDTFYKPDKKGELPEYMYYLACLVQEN 230

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEALNREPCPDPYAP 317
             IDP + EG+      D       + G +    + ++    + I E    +        
Sbjct: 231 PFIDPDYIEGLK--TTKDKVKRERLLKGNWEYDDNPNALCSHDAICEIFGNKISIKTGTN 288

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAIIID 375
            I G DIA  G D   + +  G  I  L  +  +        I    +KYR      I+D
Sbjct: 289 YITG-DIARFGADYARLAVWDGWHIIELQCFPVSKTTDIQTWIINKQKKYRIPNHKCIVD 347

Query: 376 ANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGL 435
            +  G    D        +   +      + E  +N +T+   K+AD +    +     L
Sbjct: 348 EDGVGGGVVD-----NCDIQGFVNNSTPFNGENYQNLQTQCGYKLADHINATEVGIDEDL 402

Query: 436 IQ---------NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
           I           L+ L+++   + G+L ++ K   ++    S D+ D  + 
Sbjct: 403 ISTADKEEIIRELEQLQTWKADSDGKLKLKPKEEIKMDIGCSPDWRDMFLM 453


>gi|153816772|ref|ZP_01969439.1| terminase [Vibrio cholerae NCTC 8457]
 gi|126512575|gb|EAZ75169.1| terminase [Vibrio cholerae NCTC 8457]
          Length = 605

 Score =  126 bits (315), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/457 (12%), Positives = 122/457 (26%), Gaps = 44/457 (9%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL---KTT 123
                  N       I   R IG T   A   L          +   A S  Q    +  
Sbjct: 167 YQHTMRNNLHQRTRNILKSRQIGATYYFAGEALEQAILTGDNQIFLSA-SRAQADVFRRY 225

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSL--HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
           + A   ++L +    +   + + +   + +            +    Y  + +     + 
Sbjct: 226 IVAIAKEFLGIEITGNPSTLSNGAELHYLSTNGKTAQSYHGHVYIDEYFWIGKFDELNKV 285

Query: 182 DTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
            + +  H  +     +  +S      +             R  I          +  +  
Sbjct: 286 ASAMATHKKWRKTYFSTPSSKMHPAYSFWTGEKWRGDKTTRKNIEFPT----FDELRDGG 341

Query: 242 NKPLDDWKRFQIDTRTVE--GIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF--- 296
               D   R+ +        G D    E +   Y              F       F   
Sbjct: 342 RLCPDRQWRYVVTIEDAAKCGCDLFDIEELREEYSETD--FNNLFMCVFVDGASSIFEFN 399

Query: 297 -IPLNIIEEALNREPCPDPYAP-----LIMGCDIAEEGGDNT------VVVLRRGPVIEH 344
            I   +++  + ++  P+   P     + +G D +    +         +V      +  
Sbjct: 400 KIERCMVDSEIWQDYKPNAARPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAVEKFRVLE 459

Query: 345 LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAV 404
              W     +   ++IS + E++    + ID    GA   D L         V    R  
Sbjct: 460 KHTWRGLSFQHQASEISKVFERFNVTYLGIDITGIGAGVHDLL---------VNKHPRET 510

Query: 405 DLEFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRV 460
                 N  +  L +KM D ++   L   +          ++K     +   +  +++R 
Sbjct: 511 VAIHYSNENKNRLVMKMIDIIDGNRLQFDAGMKETAMAFMAIKRVATNSGNMMTFKAERS 570

Query: 461 KGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           + A   D    L +     P   D    R  ++Q   
Sbjct: 571 EQAGHADDFWALSHALINEP--LDHSTKRKSTWQMAA 605


>gi|17975126|ref|NP_536648.1| putative terminase, ATPase subunit [Vibrio phage K139]
 gi|153820795|ref|ZP_01973462.1| terminase [Vibrio cholerae B33]
 gi|165970256|ref|YP_001650887.1| putative terminase ATPase subunit [Vibrio phage kappa]
 gi|229512054|ref|ZP_04401533.1| hypothetical protein VCE_003464 [Vibrio cholerae B33]
 gi|229519190|ref|ZP_04408633.1| hypothetical protein VCC_003218 [Vibrio cholerae RC9]
 gi|229607255|ref|YP_002877903.1| hypothetical protein VCD_002166 [Vibrio cholerae MJ-1236]
 gi|254849294|ref|ZP_05238644.1| terminase [Vibrio cholerae MO10]
 gi|17865408|gb|AAL47515.1|AF125163_21 orf16 [Vibrio phage K139]
 gi|126521587|gb|EAZ78810.1| terminase [Vibrio cholerae B33]
 gi|165292233|dbj|BAF98815.1| putative terminase ATPase subunit [Vibrio phage kappa]
 gi|229343879|gb|EEO08854.1| hypothetical protein VCC_003218 [Vibrio cholerae RC9]
 gi|229352019|gb|EEO16960.1| hypothetical protein VCE_003464 [Vibrio cholerae B33]
 gi|229369910|gb|ACQ60333.1| hypothetical protein VCD_002166 [Vibrio cholerae MJ-1236]
 gi|254844999|gb|EET23413.1| terminase [Vibrio cholerae MO10]
          Length = 605

 Score =  125 bits (314), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 61/456 (13%), Positives = 122/456 (26%), Gaps = 42/456 (9%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL---KTT 123
                  N       I   R IG T   A   L          +   A S  Q    +  
Sbjct: 167 YQHTMRNNLHQRTRNILKSRQIGATYYFAGEALEQAILTGDNQIFLSA-SRAQADVFRRY 225

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSL--HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
           + A   ++L +    +   + + +   + +            +    Y  + +     + 
Sbjct: 226 IVAIAKEFLGIEITGNPSTLSNGAELHYLSTNGKTAQSYHGHVYIDEYFWIGKFDELNKV 285

Query: 182 DTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIF 241
            + +  H  +     +  +S      +             R  I       L        
Sbjct: 286 ASAMATHKKWRKTYFSTPSSKMHPAYSFWTGEKWRGDKTTRKNIEFPTFDELRDGGRLC- 344

Query: 242 NKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF---- 296
             P   W+    I+     G D    E +   Y              F       F    
Sbjct: 345 --PDKQWRYVVTIEDAAKGGCDLFDIEELREEYSETD--FNNLFMCVFVDGASSIFEFNK 400

Query: 297 IPLNIIEEALNREPCPDPYAP-----LIMGCDIAEEGGDNT------VVVLRRGPVIEHL 345
           I   +++  + ++  P+   P     + +G D +    +         +V      +   
Sbjct: 401 IERCMVDSDIWQDYKPNAARPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAVEKFRVLEK 460

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
             W     +   ++IS + E++    + ID    GA   D L         V    R   
Sbjct: 461 HTWRGLSFQHQASEISKVFERFNVTYLGIDITGIGAGVHDLL---------VNKHPRETV 511

Query: 406 LEFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVK 461
                N  +  L +KM D ++   L   +          ++K     +   +  +++R +
Sbjct: 512 AIHYSNENKNRLVMKMIDIIDGNRLQFDAGMKETAMAFMAIKRVATNSGNMMTFKAERSE 571

Query: 462 GAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
            A   D    L +     P   D    R  ++Q   
Sbjct: 572 QAGHADDFWALSHALINEP--LDHSTQRKSTWQMAA 605


>gi|308097723|gb|ADO14402.1| AB1gp31 [Acinetobacter phage AB1]
          Length = 313

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 49/292 (16%), Positives = 90/292 (30%), Gaps = 50/292 (17%)

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
            +      P  +     I+      +  +  + I  +   D +       G     D  S
Sbjct: 5   VWQNFVVDPPANTLIRHINYNENPFLSQTALDVIADKKRRDPEGFAHIYDGMPRADDDMS 64

Query: 296 FIPLNIIEEALNREP--CPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDL 353
            I  + +E AL+       D      +G D+A+ G D   +V R+G V     +W   + 
Sbjct: 65  IIKASWVEAALDAHKLLNLDDTGRSYLGFDVADAGKDKCALVHRKGIVAYWSDEWKARED 124

Query: 354 RTTNNKISGLVEKYRPDAII-IDANNTGARTCDYLEML-----------------GYHVY 395
               +      E  R +A+I  D+   GA     +  L                 G H  
Sbjct: 125 ELLKSATRTYNEAIRLNALIHYDSTGVGAGVGAKVNELNKEKKTNVQHSKFVAGGGVHEP 184

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMAD----------WLEFA----------------SL 429
               Q +  + +F  N + +    +AD           ++                   +
Sbjct: 185 DKFYQPKITNKDFFANAKAQAWWLVADKFRLTYQVIQAIKNGTEIPKHKPEDLISISSDM 244

Query: 430 INHSGLIQNLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAE 478
            N   L   L S+        G + +ESK+    +  KS + +D  +  +A 
Sbjct: 245 PNLHRLKVEL-SIPHRDEDRLGRVMVESKQDLAKRDVKSPNLADAFIMAYAP 295


>gi|296103195|ref|YP_003613341.1| hypothetical protein ECL_02853 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057654|gb|ADF62392.1| hypothetical protein ECL_02853 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 591

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/460 (11%), Positives = 126/460 (27%), Gaps = 57/460 (12%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          AEV +   +   + +F +                  +   +     
Sbjct: 195 LSASKAQ-------AEVFRSYIVNIAEQYFGITLTGNPIRLSNGAELRFLSTNKNTAQSY 247

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T             + + 
Sbjct: 248 SGHLYCDEYFWVPNFAKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKQGSR 307

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  I       +      +       +    ++     G + +  E +  RY  ++   
Sbjct: 308 KRAAIKFPLFDEMRDG-GRLCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATF 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGD 330
            +     F       F   + +E     ++     DP         P+  G D A  G  
Sbjct: 364 DMLYMCVFVDSKDSVF-SFSDLEACGVEMDTWQDHDPDAKRPFGDRPVWGGFDPARSGDL 422

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           +  V++           +  +  W   + R    +I  L ++Y    + +D    G    
Sbjct: 423 SCFVIVAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEKLFDQYNFTYLGVDVTGIGQGVF 482

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLK 440
           D ++             + V       N + +L +K AD +E   +     L +   +  
Sbjct: 483 DNIQ---------HFAMKVVVPIRYDMNTKNQLVLKAADVVESQRIEWDKNLKEIPASFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           S++     +   +   + R +     +    + +     P
Sbjct: 534 SVRRTTTNSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|167763812|ref|ZP_02435939.1| hypothetical protein BACSTE_02192 [Bacteroides stercoris ATCC
           43183]
 gi|167697928|gb|EDS14507.1| hypothetical protein BACSTE_02192 [Bacteroides stercoris ATCC
           43183]
          Length = 476

 Score =  125 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/411 (14%), Positives = 125/411 (30%), Gaps = 47/411 (11%)

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLH 149
           K+   A  +L++    PG                  AE+ +         +       + 
Sbjct: 64  KSWTGAVWLLFMCLCYPGSKWFIGR-----------AELKRITQSTLITFYKVCNQYGVD 112

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINL 209
              +  +  +  +   +     +     +     +  + +        +E          
Sbjct: 113 DTLYKYNGQYNYIEFFNGSRIDLLDLQYKPGDPLYERYGSIEYTGGWIEEGGEVNFGAYD 172

Query: 210 GILGFL-----TERNANRFWIMTSNPRRLSGKFYEIFNKPLDD----WKRFQIDT--RTV 258
            +   +      E    R   +T NP++     Y+ F KP          + +    +  
Sbjct: 173 TLKTRIGRHLNNELGLRRKLFITCNPKK--NWMYDTFYKPDKKGELPEYMYYLACLVQEN 230

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEALNREPCPDPYAP 317
             IDP + EG+      D       + G +    + ++    + I E    +        
Sbjct: 231 PFIDPDYIEGLK--TTKDKVKRERLLKGNWEYDDNPNALCSHDAICEIFGNKISIKTGTN 288

Query: 318 LIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR--PDAIIID 375
            I G DIA  G D   + +  G  I  L  +  +        I    +KYR      I+D
Sbjct: 289 YITG-DIARFGADYARLAVWDGWHIIELQCFPVSKTTDIQTWIINKQKKYRIPNHKCIVD 347

Query: 376 ANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGL 435
            +  G    D        +   +      + E  +N +T+   K+AD +    +     L
Sbjct: 348 EDGVGGGVVD-----NCDIQGFVNNSTPFNGENYQNLQTQCGYKLADHINATEVGIDEDL 402

Query: 436 IQ---------NLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
           I           L+ L+++   + G+L ++ K   ++    S D+ D  + 
Sbjct: 403 ISTADKEEIIRELEQLQTWEADSDGKLKLKPKEEIKMDIGCSPDWRDMFLM 453


>gi|315180730|gb|ADT87644.1| terminase [Vibrio furnissii NCTC 11218]
          Length = 607

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 54/440 (12%), Positives = 109/440 (24%), Gaps = 40/440 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL---KTTLWAEVSKWLSLLPNK 138
           I   R IG T   A   L          +   A S  Q    +  + A   ++L L  + 
Sbjct: 177 ILKSRQIGATYYFAGEALEQAILTGDNQIFLSA-SRAQAEVFRRYIVALAKEFLDLELSG 235

Query: 139 HWFEMQSLSL--HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +   + + +     +            +    Y  + +     +  + +  H  +     
Sbjct: 236 NPMTLSNGAELHFLSTNGKTAQSYHGHVYVDEYFWIGKFDELNKVASAMATHKKWRKTYF 295

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S                    R  I          +                I+  
Sbjct: 296 STPSSKMHAAYPFWTGDKWRGDKTTRKNIEFPTFD--ELRDGGRLCPDRQWRYVVTIEDA 353

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF---------IPLNIIEEALN 307
              G D    E +   Y              F       F         +   I ++   
Sbjct: 354 AKGGCDLFDIEELREEYSEHD--FNNLFMCIFVDGASSIFEFNKVQKCMVDAGIWQDFKA 411

Query: 308 REPCPDPYAPLIMGCDIAEEGGDNT------VVVLRRGPVIEHLFDWSKTDLRTTNNKIS 361
               P     + +G D +    +         +V      +     W     +   ++I 
Sbjct: 412 SAKRPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAAEKFRVLEKHTWRGLSFQHQASEID 471

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNR-RTELHVKM 420
            + E++    + ID    GA   D L              R        N  +  L +KM
Sbjct: 472 KVFERFNVTYLGIDITGIGAGVYDLLS---------NKHPRETVAIHYSNENKNRLVMKM 522

Query: 421 ADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
            D ++   L   +       +  ++K     +   +  ++ R +     D    L +   
Sbjct: 523 IDVIDGQRLQFDAGMKETAMSFMAIKRTSTNSGNMMTFKADRSELVGHADDFWALSHALI 582

Query: 478 ENPPRSDMDFGRCPSYQYEG 497
             P   D    R   + + G
Sbjct: 583 NEP--LDHTTKRKSRWAFTG 600


>gi|169794751|ref|YP_001712544.1| phage-related terminase, ATPase subunit (GPP-like) [Acinetobacter
           baumannii AYE]
 gi|169147678|emb|CAM85541.1| phage-related terminase, ATPase subunit (GPP-like) [Acinetobacter
           baumannii AYE]
          Length = 604

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/452 (11%), Positives = 119/452 (26%), Gaps = 46/452 (10%)

Query: 75  PEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ------LKTTLWAEV 128
            E    A+   R IG T   A   L    T     +   A+          +K  +   +
Sbjct: 167 REQRNRAVLKSRQIGATFYFAREALIKAVTTGRNQIFLSASKAQAHGFKTYIKNFVMQSI 226

Query: 129 SKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
              L   P        +    +               +    +  +    + ++  + + 
Sbjct: 227 EIDLQGDPISITLPCGNTVQLIFLGTNAKTAQSYHGDLYFDEFFWVHGFATLKKVASAMA 286

Query: 187 HHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
               Y     +  +S T +           +       +             +       
Sbjct: 287 AQKQYKKTYFSTPSSKTHEAHAFWTGDAFNKGRTKENRVEIDTSHAN---LRDGALCGDK 343

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEA 305
            W+   ++ +  E         I      +S          +F       F PL++I+  
Sbjct: 344 MWR-HIVNIQDAERQGCDLF-DIEELIAENSPEEFANLYMCEFVDDGHSVF-PLSVIQPC 400

Query: 306 LNREPC------------PDPYAPLIMGCDIAEEGGDN--TVVVLRR----GPVIEHLFD 347
           +                 P    P+ +G D AE G      V+           +     
Sbjct: 401 MVDSWEVWSKDFKPLALRPFGNKPVWIGYDPAESGDSAGLVVIAPPEPDYPKFRLLEHHQ 460

Query: 348 WSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE 407
           +   D  +    I  L  KY    I +D +  G      +     ++             
Sbjct: 461 FKGMDFASQAQYIKKLTTKYNVKYIGLDKSGMGTGVAQLVLDFFPNLTTFNYS------- 513

Query: 408 FCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAK 464
              + +T+L +K  D +        +    +  ++ +++  +  +  ++  E+ R +   
Sbjct: 514 --VDVKTQLVMKAMDVINKERFEFDAGSTDVAMSIMAIRKTLTASQRQMTFEASRAENIG 571

Query: 465 STDYSDGLMYTFA-ENPPRSDMDFGRCPSYQY 495
             D +  + + FA E     D    +  S + 
Sbjct: 572 HADLAFAIFHAFANEPLTLDDQTKSKKSSMEI 603


>gi|323183894|gb|EFZ69285.1| terminase, ATPase subunit [Escherichia coli 1357]
          Length = 590

 Score =  124 bits (310), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 56/453 (12%), Positives = 115/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYCSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +  H+       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASHSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|317049635|ref|YP_004117283.1| hypothetical protein Pat9b_3434 [Pantoea sp. At-9b]
 gi|316951252|gb|ADU70727.1| protein of unknown function DUF264 [Pantoea sp. At-9b]
          Length = 588

 Score =  124 bits (310), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 56/468 (11%), Positives = 126/468 (26%), Gaps = 48/468 (10%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E ++ +    +        +         +   R IG T   A   L          +
Sbjct: 132 QIEKLQEIFHGSMFGYQRQWWDAGNKHRIRNVLKSRQIGATYYFAREALIDALITGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEM--QSLSLHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      E +K + +        +   +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIEFAKEVDVELKGDPMTLFNGAGLYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMALHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADRVDI 311

Query: 228 --SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
             ++P    G+F +      D   R  +          +  +    R        +  + 
Sbjct: 312 DLTHPNLAPGRFCD------DGQFRQIVTVEDAVRGGCNLFDLDQLRMEYSPPEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAE-EGGDNTV 333
            +F       F PL ++++ +                      + +G D A+     ++ 
Sbjct: 366 CEFVDDLASVF-PLQLLQKCMVDSWEVWTDFEALALRPFGWREVWIGYDPAKGTQNGDSA 424

Query: 334 VVLRR--------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
             +             I     W   D R     I  L ++Y    I ID+   G    +
Sbjct: 425 GCVVIAPPAVPGGKFRILERHQWRGMDFRAQAESIRKLTQQYNVTYIGIDSTGVGLGVYE 484

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSL 442
            ++M    V   +            N +  L +K  D +    L   +    + Q+  ++
Sbjct: 485 NVKMFFPAVKEFVYNP---------NVKNALVLKAFDIISGGRLEFDAGHLDIAQSFMAI 535

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
           +     +      E+ R + A   D +   M+  A  P + +    R 
Sbjct: 536 RRTTTASGNRPTYEASRSEEASHADLAWATMHALANEPLQGEAAHTRN 583


>gi|160876026|ref|YP_001555342.1| hypothetical protein Sbal195_2916 [Shewanella baltica OS195]
 gi|160861548|gb|ABX50082.1| protein of unknown function DUF264 [Shewanella baltica OS195]
          Length = 589

 Score =  123 bits (308), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 50/439 (11%), Positives = 111/439 (25%), Gaps = 40/439 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-ETQLKTTLWAEVSKWLSLLPNKHW 140
           I   R IG T   A   +          +   A+  +  +      +  K ++ +  K  
Sbjct: 164 ILKSRQIGATYFFAHEAIIDALLTGRNQIFLSASKAQAHVFKQYIIQFVKDVTGIELKGD 223

Query: 141 FEMQ---SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
             +    ++                 +    Y  + +     +  + +  H  +    I+
Sbjct: 224 PIVLFNGAILYFLGTNARTAQSYHGNLYLDEYFWIHKFQEFRKVASGMAIHAKWRQTYIS 283

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
             +S T D                   I                 +  D   R  +    
Sbjct: 284 TPSSITHDAYPFWTGTLFNRGRPKADRIEIDVSHSA----LANGRRCEDGQWRQVVTVDD 339

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
                 +  +          D     +  +F    +  F  + +    ++       Y P
Sbjct: 340 AIRKGCNLFDPDTLHLEYSPDEYSNLLMCEFIDDTMSVFPMVMMQRCMVDSWEVWTDYKP 399

Query: 318 ----------LIMGCDIAEEGGDNTVVVLRR--------GPVIEHLFDWSKTDLRTTNNK 359
                     + +G D  + G  ++   +             +     W+  D       
Sbjct: 400 FAPRPLAHREVWIGYDPNKGGKGDSAGCIVICPPAVPGGKFRVIEKHRWNGMDFEAQAKA 459

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I  +  KY    I ID    G      ++     V   L              ++++ +K
Sbjct: 460 IQDICNKYNVTFIGIDTTGLGEAVYQLVKKFFPQVTPFLYNPV---------LKSQMVIK 510

Query: 420 MADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
             D +    L   +    L Q   S++  +  +  ++  ES R +     D +   M+  
Sbjct: 511 AYDVISKGRLEYDAGWTDLAQAFMSIRKTLTASGKQVTYESARSEEISHADIAWAAMHAL 570

Query: 477 AENPPRSDMDFGRCPSYQY 495
              P   D       + + 
Sbjct: 571 YNEP--LDTSGTSTSTLEI 587


>gi|315268220|gb|ADT95073.1| terminase, ATPase subunit [Shewanella baltica OS678]
          Length = 589

 Score =  123 bits (308), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 50/439 (11%), Positives = 111/439 (25%), Gaps = 40/439 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-ETQLKTTLWAEVSKWLSLLPNKHW 140
           I   R IG T   A   +          +   A+  +  +      +  K ++ +  K  
Sbjct: 164 ILKSRQIGATYFFAHEAIIDALVTGRNQIFLSASKAQAHVFKQYIIQFVKDVTGIELKGD 223

Query: 141 FEMQ---SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
             +    ++                 +    Y  + +     +  + +  H  +    I+
Sbjct: 224 PIVLHNGAILYFLGTNARTAQSYHGNLYLDEYFWIHKFQEFRKVASGMAIHAKWRQTYIS 283

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
             +S T D                   I                 +  D   R  +    
Sbjct: 284 TPSSITHDAYPFWTGKLFNRGRPKADRIEIDVSHSA----LANGRRCEDGQWRQVVTVDD 339

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
                 +  +          D     +  +F    +  F  + +    ++       Y P
Sbjct: 340 AIRKGCNLFDPDTLHLEYSPDEYSNLLMCEFIDDTMSVFPMVMMQRCMVDSWEVWTDYKP 399

Query: 318 ----------LIMGCDIAEEGGDNTVVVLRR--------GPVIEHLFDWSKTDLRTTNNK 359
                     + +G D  + G  ++   +             +     W+  D       
Sbjct: 400 FAPRPLAHREVWIGYDPNKGGKGDSAGCIVICPPAVPGGKFRVIEKHRWNGMDFEAQAKA 459

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVK 419
           I  +  KY    I ID    G      ++     V   L              ++++ +K
Sbjct: 460 IQDICNKYNVTFIGIDTTGLGEAVYQLVKKFFPQVTPFLYNPV---------LKSQMVIK 510

Query: 420 MADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
             D +    L   +    L Q   S++  +  +  ++  ES R +     D +   M+  
Sbjct: 511 AYDVISKGRLEYDAGWTDLAQAFMSIRKTLTASGKQVTYESARSEEISHADIAWAAMHAL 570

Query: 477 AENPPRSDMDFGRCPSYQY 495
              P   D       + + 
Sbjct: 571 YNEP--LDTSGTSTSTLEI 587


>gi|200389255|ref|ZP_03215867.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199606353|gb|EDZ04898.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 591

 Score =  123 bits (308), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/455 (11%), Positives = 122/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T             + +  R  I
Sbjct: 253 CDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKQGSKKRTAI 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                  L      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 KFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDNKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  +  W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 VAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGVFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  S++  
Sbjct: 487 --------HFAMRVAVAIRYDLNTKNQLVLKAADVVESQRIEWDKNLKEIPASFMSVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|194443211|ref|YP_002041983.1| hypothetical protein SNSL254_A2937 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194401874|gb|ACF62096.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 591

 Score =  123 bits (307), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/455 (11%), Positives = 122/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T             + +  R  I
Sbjct: 253 CDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKQGSKKRTAI 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                  L      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 KFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDNKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  +  W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 VAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGVFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  S++  
Sbjct: 487 --------HFAMRVAVAIRYDLNTKNQLVLKAADVVESQRIEWDKNLKEIPASFMSVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|237745794|ref|ZP_04576274.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377145|gb|EEO27236.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 585

 Score =  123 bits (307), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/450 (11%), Positives = 119/450 (26%), Gaps = 44/450 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +        NS N+    + K      R IG T   A   L       G  +   A S  
Sbjct: 142 LFDYQKEWWNSRNSRTRAILK-----SRQIGATWYFAREALMDAVLTGGNQIFLSA-SRA 195

Query: 119 QLK-----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
           Q          +A+ +  + L  +       +                       +    
Sbjct: 196 QAYVFRQYIVQFAKEATGVELKGDPIVLSNGAHLYFLGTNARTAQGYHGNFYFDEFFWTF 255

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
           +     +  + +  H  +     +  ++ + +           +R      +      + 
Sbjct: 256 KFEELNKVASGMALHKRWRKTYFSTPSAMSHEAYPFWTGDAFNKRRRKEEQVRIDVSHK- 314

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE-GIIARYGLDSDVTRVEVCGQFPQQD 292
              +        D   R  +     E       +   +  Y    D     +   F    
Sbjct: 315 ---WLAEGRLCEDRIWRQIVTIEDAEKGGCDLFDIDELRNYEYSPDQFDNLLMCNFIDDT 371

Query: 293 IDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVLR----- 337
              F    +    ++     + Y           P+ +G D +  G     VV+      
Sbjct: 372 ASVFPLSELQRCMVDSWEAWNDYKPFTARPFGNRPVWVGYDPSRSGDSAGCVVMAPPLTF 431

Query: 338 -RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                I     +   D      +I  + +KY  + I IDA   G    + +      V +
Sbjct: 432 PGKFRIIEKHQYRGMDFAAQAEQIRQITQKYNVEYIGIDATGMGLGVYEIVRQFYPAVTK 491

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
           +L    +         +  + +K  D +    L   +    + Q+  S++  +  +  ++
Sbjct: 492 ILYNPES---------KGRMVLKAQDVIRNGRLEFDAGSTDIAQSFMSIRKTLTVSGQQV 542

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRS 483
             ++ R +     D +  +M+     P   
Sbjct: 543 TYDAGRSETTGHADLAWAVMHALDHEPLAG 572


>gi|300715671|ref|YP_003740474.1| Terminase, ATPase [Erwinia billingiae Eb661]
 gi|299061507|emb|CAX58621.1| Terminase, ATPase subunit [Erwinia billingiae Eb661]
          Length = 588

 Score =  123 bits (307), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 55/461 (11%), Positives = 120/461 (26%), Gaps = 39/461 (8%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q  F   +  +  N     N    +  +   R IG T   A   L    T     +   A
Sbjct: 137 QEVFHGSMFGYQRNWWEAGNRHRIR-NVLKSRQIGATFYFAREALIDALTTGRNQIFLSA 195

Query: 115 NS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSKHYST 171
           +  +  +      E ++ + +        + + +                  +    Y  
Sbjct: 196 SKAQAHVFKQYIIEFAREVDVDLKGDPMTLSNGACLYFLGTNARTAQSYHGNLYLDEYFW 255

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + R     +  + +  H  +     +  +S T                A    +      
Sbjct: 256 IPRFQELRKVASGMALHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKTDRVDIDLTH 315

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                         D   R  +          +  +    R        +  +  +F   
Sbjct: 316 GFLSPGKFC----DDGQYRQIVTVEDAVRGGCNLFDIDQLRLEYSPPEYQNLLMCEFIDD 371

Query: 292 DIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVVL--- 336
               F   ++    ++       +            + +G D A+  + GD+   V+   
Sbjct: 372 LASVFPLADLQACMVDSWEVWQDFEALALRPFGWREVWIGYDPAKGTQHGDSAGCVVIAP 431

Query: 337 ----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY 392
                    I     W   D R   + I  L  +Y    I ID+   G    + ++M   
Sbjct: 432 PSVPGGKFRILERHQWRGMDFRAQADAIKELTRQYNVTYIGIDSTGVGHGVYENVKMFFP 491

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPN 449
            V   +            N +  L +K  D +    L   +    + Q+  +++     +
Sbjct: 492 AVKEFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRATTAS 542

Query: 450 TGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
                 E+ R + A   D +   M+  +  P + +      
Sbjct: 543 GNRPTYEASRSEEASHADLAWATMHALSNEPLQGEAAHTSN 583


>gi|241763591|ref|ZP_04761642.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
 gi|241367184|gb|EER61538.1| phage terminase large subunit [Acidovorax delafieldii 2AN]
          Length = 521

 Score =  123 bits (307), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 92/240 (38%), Gaps = 24/240 (10%)

Query: 274 GLDSDVTRVEVCGQFPQQDID---SFIPLNIIEEALNREPCPDPYAPL-IMGCDIAEEGG 329
            L   +    + G F     D     IP   ++ A  R        P+ ++G D A  G 
Sbjct: 266 SLPEPLRSQMLRGDFSAGAADPAWQLIPTEWVKAAQARWQPRQDKGPMTVLGLDPARGGT 325

Query: 330 DNTVVVLRRGPVIEHLFDWSKT---DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
           D T V  R     + L         D  TT    + LV       I +DA   G+   D+
Sbjct: 326 DKTSVARRHDCWFDVLISEPGIVTKDGPTTAAFTAPLVR--NGAPIAVDAIGIGSSALDF 383

Query: 387 LEMLGYHVYRVLGQKRAVDLE-----FCRNRRTELHVKMADWL-----EFASLINHSGLI 436
           ++ LG  VY V+G +R+  ++       RNRR E++ ++ + L     +  +L     L+
Sbjct: 384 IQGLGLLVYAVVGSERSDHMDKAGTMRFRNRRAEMYWRLREALDPTAEQPIALPPDQELL 443

Query: 437 QNLKSLKSFIVP--NTGELAIESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
            +L +++  +V       + I  K   R    +S D  D +  TF E  P  D    +  
Sbjct: 444 GDLTAVRYKVVTMGQGAAIQIRDKDEIREALGRSPDKGDSVAMTFCEGIPLLDKGKRKTS 503


>gi|315122636|ref|YP_004063125.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496038|gb|ADR52637.1| putative phage terminase, large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 301

 Score =  122 bits (306), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 92/209 (44%), Gaps = 8/209 (3%)

Query: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60
           M+     N E +  L   + S  I  +   F  + + WGE+GTPL     PR+WQ E   
Sbjct: 1   MNATFQPNIEYDTALLQNVLSPAIAGNPLAFTKYMYRWGEEGTPLANCKGPRAWQTEVFL 60

Query: 61  VVDAHCLNSVNNPNP----EVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
            +      +          +VFK AI++ RGIGKT L AW+  W +STR G +V+  ANS
Sbjct: 61  ELAEFIEKNKEAKRLGKPLQVFKLAIASARGIGKTALVAWITYWFLSTRIGCTVVISANS 120

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA----PWYSDVLHCSLGIDSKHYSTM 172
           + Q KTT +AE+ +W SL  N H+FE        A    PW ++ +  +L   +      
Sbjct: 121 DDQCKTTSFAEIRRWHSLAKNAHFFEANIAEALLAGGCSPWQAEPVAKTLVDINTKAEEA 180

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEAS 201
               SE+                  + A+
Sbjct: 181 KNNQSEKDFSRLRAELGRNLEPTFQNIAA 209


>gi|213650797|ref|ZP_03380850.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
          Length = 518

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 62  QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 121

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 122 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 179

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 180 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 239

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 240 DIDLSHNNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 295

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 296 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 355

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 356 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 415

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 416 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 466

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 467 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 507


>gi|171316543|ref|ZP_02905759.1| protein of unknown function DUF264 [Burkholderia ambifaria MEX-5]
 gi|171098271|gb|EDT43077.1| protein of unknown function DUF264 [Burkholderia ambifaria MEX-5]
          Length = 583

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 63/460 (13%), Positives = 118/460 (25%), Gaps = 49/460 (10%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+E +  +          E  +  + + R IG T   A   L          +   A+  
Sbjct: 137 FLESIFDYQRTWYRAGFKERIRNILKS-RQIGATWYFAREALLDALNTGRNQIFLSASKA 195

Query: 118 TQ----------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
                        K  +  E+     +LPN         +   A  Y   L+        
Sbjct: 196 QAHVFRQYIVQFAKDAVGVELKGDPMVLPNGAMLYFLGTNARTAQSYHGNLYFD------ 249

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + R     +  + +  H+ +     +  +S   D                   +  
Sbjct: 250 EYFWVPRFQDLRKVASGMAIHSQWRQTYFSTPSSLAHDAYPFWSGALFNRGRPKDQRVSI 309

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                +S           D   R  +          +  +    +    +D     +  Q
Sbjct: 310 ----DISNAALAAGRACADGQYRQVVTVEDAVRGGCNLFDLERLKLEYSADEYANLLLCQ 365

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL- 336
           F    +  F    +    ++     D + P          + +G D +  G     VVL 
Sbjct: 366 FIDDSLSVFPLATLQTCMVDTWEVWDDFKPLYLRPFGDEEVWIGYDPSHTGDSAGCVVLA 425

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                     +   F W   D      +I  L  +YR   I ID    G      +    
Sbjct: 426 PPKYPGGKFRVLERFQWHGLDFEAQAAQIEALTRRYRVTYIGIDTTGIGQGVYQLVTKFF 485

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVP 448
                                +T L +K  + +    L        L     ++K  I P
Sbjct: 486 PAATPFHYSVE---------IKTALVMKAQNVIRKGRLEFDTGWKDLAAAFMAIKKTITP 536

Query: 449 NTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
           +  ++  ++ R + A   D +   M+  A  P        
Sbjct: 537 SGLQVTYKASRSEEASHGDLAWACMHALANEPLEGATSTN 576


>gi|255929035|ref|YP_003097347.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
 gi|255705321|emb|CAR63310.1| DNA terminase packaging enzyme large subunit [Synechococcus phage
           S-RSM4]
          Length = 550

 Score =  122 bits (305), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/441 (13%), Positives = 130/441 (29%), Gaps = 60/441 (13%)

Query: 23  EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           + K     F +++         L  F     +Q E +     +  N    P         
Sbjct: 33  KCKNDPIYFAMNYIQIISLDEGLVPFKM-YDFQKEILRDFHENRFNIAKLP--------- 82

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
              R  GK+T     +L+       +++  LAN  +  +  L             +    
Sbjct: 83  ---RQTGKSTTVVAYLLYYAIFYDSVNIGILANKASTARELL------------GRLQLA 127

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
            ++L              ++ +++        T       +           +  DE + 
Sbjct: 128 YENLPKWMQHGILVWNKGNVELENGSKILAAST-------SASAVRGMSFNILFLDEFAF 180

Query: 203 TP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
            P    +     +   +T   +     I T N      K +E   +  +D+   ++    
Sbjct: 181 VPNHVAEQFFASVYPTITSGKSTKVIIISTPNGMNHFYKMWEDARRGKNDYVTNEVHWSQ 240

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC------ 311
           V G D  + E  I            E    F     D+ I    ++     +P       
Sbjct: 241 VPGRDAKWKEETIKNTS--PRQFAQEFECDFLGS-ADTLISPAKLQNIPFHDPIQSNAGL 297

Query: 312 -----PDPYAPLIMGCDIAEE-GGDNTVVVLRRG----PVIEHLFDWSKTDLRTTNNKIS 361
                       I+  D+A   GGD +  ++         I   +  ++       + I 
Sbjct: 298 DVYERVQKDHEYIITVDVARGIGGDYSAFIVFDITTMPYKIVAKYRNNEIKPVLFPSVIF 357

Query: 362 GLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            + ++Y    ++++ N+ G          LE     +  + G+   +  +     +T+L 
Sbjct: 358 QVCKEYNNPYVLVEVNDIGDSIAATLNYDLEYPNVLMCAMRGRAGQIVGQGFSGNKTQLG 417

Query: 418 VKMADWLEFASLINHSGLIQN 438
           VKM+  ++     N   +I+ 
Sbjct: 418 VKMSVTVKKIGCANLKAIIEE 438


>gi|256422889|ref|YP_003123542.1| hypothetical protein Cpin_3879 [Chitinophaga pinensis DSM 2588]
 gi|256037797|gb|ACU61341.1| hypothetical protein Cpin_3879 [Chitinophaga pinensis DSM 2588]
          Length = 471

 Score =  122 bits (305), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/431 (13%), Positives = 127/431 (29%), Gaps = 60/431 (13%)

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA---EVSKWLSLLPNKHWFEMQSL 146
           K+      ++      PG           +L+ + +    +V K   +  + HW      
Sbjct: 62  KSWTGCVWLVMACLAYPGTRWFIGREELKRLRASTYQTFLKVCKAYGVNKDNHWDYNGQD 121

Query: 147 SLHPAPWYSDVLHCSLGI--------------DSKHYSTMCRTYSEERPDTFVGHHNTYG 192
                   S +    L                 +  +       +    DT       + 
Sbjct: 122 HFIQFHNGSRIDMLDLKFVPRDPYYERYGSVEYTGGWIEEGGEVNFGAYDTLKSRVGRHL 181

Query: 193 MAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
                       +     +       N  + W  T   +     F     +  D  K  Q
Sbjct: 182 ------------NDKYGLLGRIFVTLNPKKNWCHTVFWK----PF--KAGQLPDKVKFLQ 223

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
              +    IDP + + +++         R+         D ++ +  + I +    E   
Sbjct: 224 ALVQDNPFIDPGYIDNLMSITDKVKKQ-RLLYGNFDYDDDDNALMEYDSINDIFTNEFVV 282

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD-- 370
           +      +  DIA  G D +VV++  G  +  +  + K       ++I  +  KY     
Sbjct: 283 E--GKKYITADIARFGSDKSVVMVWNGLRVVEIRKFEKMRTTKVADEIEKIRNKYGIPLS 340

Query: 371 AIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLE------FCRNRRTELHVKMADWL 424
            +++D +  G    D L+      +  +     +D          +N +++ +  +A+ +
Sbjct: 341 HVVVDEDGVGGGVVDKLDG----CHGFVNNSAPIDNPQDQQQQNYKNLKSQCYYMLAERI 396

Query: 425 EFASLI---NHSG----LIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
               +    +       L + L+ +K +   N  +L +  K   +    +S DYSD LM 
Sbjct: 397 NDHKIFVRCDDYEMRELLSEELEQVKKWDADNDKKLEVMPKKVVKELLGRSPDYSDTLMM 456

Query: 475 TFAENPPRSDM 485
                      
Sbjct: 457 RMFFELKPEQR 467


>gi|153213615|ref|ZP_01948888.1| terminase [Vibrio cholerae 1587]
 gi|124115814|gb|EAY34634.1| terminase [Vibrio cholerae 1587]
          Length = 606

 Score =  122 bits (305), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 123/461 (26%), Gaps = 52/461 (11%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
                  N       I   R IG T   +              +   A S +Q       
Sbjct: 168 FQHTMRNNLHHRTRNILKSRQIGATYYFSGEAFEDAVLNGRDKIFLSA-SRSQA------ 220

Query: 127 EVSKWLSLLPNKHWFEMQ-----------SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT 175
           EV +   +   K +F+++           +     +         S  + +  Y  + + 
Sbjct: 221 EVFRTYIIRIAKEFFDIELTGNPITLSNGATLRFLSTNGRTAQSYSGDLYTDEYFWIGKF 280

Query: 176 YSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSG 235
              ++    +  H  + +   +  +S T             E    R  I       L  
Sbjct: 281 NEVKKVSRAIATHKHWRLTYFSTPSSKTHPAYKFWTGEEWKEDKETRKNIEFPTFAELKD 340

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
               +       +    ++     G D +  + +                 +F       
Sbjct: 341 G-GRVCPDKQWRY-VITMEDAVKSGFDLADIDILREENSE--RDFNNLFMCEFVDGASSI 396

Query: 296 F----IPLNIIEEALNREPCPDPYAP-----LIMGCDIAEEGGDNT------VVVLRRGP 340
           F    I   +++  + ++  P    P     + +G D +    +         +V     
Sbjct: 397 FEYNKILRCMVDIEIWQDFKPSSDRPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAAEKF 456

Query: 341 VIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQ 400
            +     W     +   ++IS + E++    + ID    GA   D L             
Sbjct: 457 RVLEKHTWRGLSFQHQASEISKVFERFNVTYLGIDITGIGAGVYDLLS---------NKH 507

Query: 401 KRAVDLEFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIE 456
            R        N  +  L +KM D ++   L   +       +  ++K     +   +  +
Sbjct: 508 PRETVAIHYSNENKNRLVMKMIDIIDGNRLQFDAGMKETAMSFMAIKRVATNSGNMMTFK 567

Query: 457 SKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           + R +     D    L +     P   D    R  ++Q E 
Sbjct: 568 ADRSELVGHADDFWALSHALINEP--LDHSTKRKSTWQMEA 606


>gi|320199051|gb|EFW73648.1| Phage terminase, ATPase subunit [Escherichia coli EC4100B]
          Length = 588

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 62/461 (13%), Positives = 121/461 (26%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P           L      +   H +L +D
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPIVLPDGATLYFLGTNARTAQSYHGNLYLD 251

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 252 --EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHNNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|290474053|ref|YP_003466928.1| hypothetical protein XBJ1_0997 [Xenorhabdus bovienii SS-2004]
 gi|289173361|emb|CBJ80138.1| putative phage gene [Xenorhabdus bovienii SS-2004]
          Length = 594

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/462 (12%), Positives = 136/462 (29%), Gaps = 47/462 (10%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           +     H  ++ +     + K      R IG T   A+             V   A+  +
Sbjct: 151 LFGYQKHLRDNKHQQVRNILK-----SRQIGATWYFAFEAFEDAVLTGKPQVFLSASKPQ 205

Query: 118 TQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            Q+  +    +AE    ++L          +     +   +     S  +    Y  +  
Sbjct: 206 AQVFRSYIVNFAEQLFGITLSGEHIRLSNGAELRFLSTNKNTAQSYSGHLYCDEYFWIPD 265

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +  H+ +     +  ++ T    +L         +  R  +       L 
Sbjct: 266 FKRFNEVASAMATHDHWRTTYFSTPSAKTHPAYSLWTGDEWRGNDPKRKNVAFPAFDELR 325

Query: 235 GKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
               +    P   W+    ++     G + +  + +  +Y  DS    +     F     
Sbjct: 326 DGGRDC---PDGQWRYVITLEDAIKGGFNLASIDRLRNKYNPDS--FNMLFMCVFVDSGA 380

Query: 294 DSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL------RR 338
             F    +    ++  L  +  P+   P     +  G D A  G  +T V++        
Sbjct: 381 SVFTYSQVDKCGVDINLWEDHAPNASRPFGEREVWGGFDPARSGDTSTFVIVAPPMMANE 440

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
              +   F W   + +     I  L ++YR   I ID    G    + ++          
Sbjct: 441 AFRVLATFYWQGMNWKHQAKLIEELFKRYRFTHIGIDTTGIGHGVYEMVQD--------- 491

Query: 399 GQKRAVDLEFCRNR-RTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELA 454
              R         + + +L +KM D +    L        L+ +  S++       G + 
Sbjct: 492 FAPRQTQAIHYSQQSKNQLVMKMIDVVSEERLEWDQEQKELLASFLSIRHTTTAKGGAMT 551

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYE 496
             + R +     D    + +     P    +++ +  + +Y+
Sbjct: 552 FVADRSQETGHADVFWAVSHALMNEP----LNYEKKRTSKYK 589


>gi|61806000|ref|YP_214360.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|61374509|gb|AAX44506.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-SSM2]
 gi|265525210|gb|ACY76007.1| terminase large subunit gp17 [Prochlorococcus phage P-SSM2]
          Length = 547

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 64/477 (13%), Positives = 129/477 (27%), Gaps = 71/477 (14%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   E    ++    + K     F  ++         L  F+    +Q + +  
Sbjct: 9   PNLKKANTPIEFSKDNIREFLKCKEDPVYFTRNYIKIVSLDEGLVPFNM-YDFQEKLITR 67

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              +  N    P            R  GK+T     +L        ++V  LAN  +  +
Sbjct: 68  FHENRFNICKMP------------RQTGKSTTCISYLLHYAVFNDNVNVAVLANKASTAR 115

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L   +      LP      + S +       +     +                    
Sbjct: 116 DLL-GRLQLAYENLPRWMQQGIISWNKGSLELENGSKISA------------------NS 156

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTERN-ANRFWIMTSNPRRLSGK 236
            +           I  DE +  P    D     +   +T         + T        +
Sbjct: 157 TSSSAVRGGSYNVIFLDEFAFIPNHIADDFFASVYPTITSGQSTKVIIVSTPRGMNHFYR 216

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    K   ++    +    V G D  + E  IA         ++E   +F        
Sbjct: 217 MWHDSEKGKSEYVATDVHWSEVPGRDEEWKEQTIANTSE--QQFKIEFECEFLGSVNTLI 274

Query: 297 IPLNI----IEEALNREPCPDPYAP------LIMGCDIAEE-GGDNTVVVLRRG----PV 341
            P  +     E    R    D Y         I+  D+A   G D +  ++         
Sbjct: 275 NPAKLRNLVYEAPKTRNAGLDIYETPVKEHNYIITVDVARGLGNDYSAFIVFDTTEFPYK 334

Query: 342 IEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRV 397
           +   +  ++       N I  + + Y    ++I+ N+ G +        LE     +  +
Sbjct: 335 VVAKYRNNEIKPMLFPNIILDVAKGYNNAYLLIEVNDIGDQVASILQYDLEYENVLMASM 394

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLIN-------------HSGLIQNLKS 441
            G+   +  +    ++T+L V+M   ++     N                +I  L +
Sbjct: 395 RGRAGQIVGQGFSGKKTQLGVRMTSAVKKLGCSNLKTMMEDDKLLTCDYEIISELTT 451


>gi|16762249|ref|NP_457866.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143738|ref|NP_807080.1| terminase ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|215485952|ref|YP_002328383.1| predicted terminase, ATPase subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312969111|ref|ZP_07783318.1| terminase, ATPase subunit [Escherichia coli 2362-75]
 gi|25315563|pir||AB0927 terminase, ATPase chain [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504553|emb|CAD09436.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139373|gb|AAO70940.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|215264024|emb|CAS08365.1| predicted terminase, ATPase subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286513|gb|EFR14426.1| terminase, ATPase subunit [Escherichia coli 2362-75]
          Length = 588

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHNNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|159904490|ref|YP_001548152.1| hypothetical protein MmarC6_0096 [Methanococcus maripaludis C6]
 gi|159885983|gb|ABX00920.1| protein of unknown function DUF264 [Methanococcus maripaludis C6]
          Length = 505

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 71/459 (15%), Positives = 131/459 (28%), Gaps = 77/459 (16%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E  E +D+   +             I+ GR  GKT +   +     S   G SV+ +A
Sbjct: 65  QEEIAEAIDSEMYDV----------ITINIGRRGGKTEVMGGVGPKFCSKYRGFSVLVVA 114

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
               Q KT ++ ++ + L                                          
Sbjct: 115 PVYNQAKT-MYKKIKRGLESNKESRQLVKPK-----------KEGFKESPFPLITFYNGS 162

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVI-NLGILGFLTERNANRFWIMTSNPRRL 233
           T   +  +T     +     II DEA+   D I +  +   L +       +  S P   
Sbjct: 163 TIEFKSAETPDNLRSEGYDLIIVDEAAFVDDEIISAVLEPMLMDSGG--ILVKISTPWGT 220

Query: 234 SGKFYEIF----------------NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDS 277
              FY+ +                 +    +K F+  +     +   F  G     G D+
Sbjct: 221 GNHFYDSYIKGELQAKMLEEGEGIPEDELRYKSFKFPSWVNPYLSKRFLMGKKKDLGEDN 280

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNI-------------IEEALNREPCPDPYAPLIMGCDI 324
            V   E C +F + D   F   ++              E  +      +     ++G D+
Sbjct: 281 PVWLQEYCAEFIEDDTTVFSTAHVQACLSDAFETHYKTENLIYLIDEGERNKEYVIGLDL 340

Query: 325 AEEGGDNTVVVLRRG----PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
           A+       +VL         + +   ++  D      K   L E +      +D    G
Sbjct: 341 AKHNDYTVFIVLDITTGPPYTLVYFERFNGIDYTDIAEKHLALSEAFNDAPACVDQTGIG 400

Query: 381 ARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNR-RTELHVKMADWLEFAS--LINHSGLIQ 437
               D  + +G            +      N  +TE+  K++         +     L+ 
Sbjct: 401 EAYMDIAKKVGLD---------NLTGFKFTNESKTEIITKLSTSFRNKEVVMPKIRVLLT 451

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTD--YSDGLMY 474
            LK+   F    T    +E+   +     D   +  L  
Sbjct: 452 ELKAFMRFRTKTT--FKLEA---RSGFHDDTVCAFALAM 485


>gi|312970940|ref|ZP_07785119.1| terminase, ATPase subunit [Escherichia coli 1827-70]
 gi|310336701|gb|EFQ01868.1| terminase, ATPase subunit [Escherichia coli 1827-70]
          Length = 588

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/461 (12%), Positives = 117/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                 R             D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHRNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RSTTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|170731562|ref|YP_001763509.1| hypothetical protein Bcenmc03_0207 [Burkholderia cenocepacia MC0-3]
 gi|169814804|gb|ACA89387.1| protein of unknown function DUF264 [Burkholderia cenocepacia MC0-3]
          Length = 583

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/454 (12%), Positives = 115/454 (25%), Gaps = 37/454 (8%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+E +  +          E  +  + + R IG T   A   L          +   A+  
Sbjct: 137 FLESIFDYQRTWYRAGFKERIRNILKS-RQIGATWYFAREALLDALNTGRNQIFLSASKA 195

Query: 118 TQ----LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
                      +A+ +  + L  +       +                  +    Y  + 
Sbjct: 196 QAHVFRQYIVQFAKDAVGVELKGDPIVLPNGATLYFLGTNARTAQSYHGNLYFDEYFWVP 255

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
           R     +  + +  H+ +     +  +S   D                   +       +
Sbjct: 256 RFQDLRKVASGMAIHSQWRQTYFSTPSSLAHDAYPFWSGALFNRGRPKDQRVTI----DI 311

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           S           D   R  +          +  +    +    +D     +  QF    +
Sbjct: 312 SNAALAAGRACADGQYRQIVTVEDAVRGGCNLFDLERLKLEYSADEYANLLLCQFIDDSL 371

Query: 294 DSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     D + P          + +G D +  G     VVL       
Sbjct: 372 SVFPLATLQTCMVDTWEVWDDFKPLYLRPFGDEEVWIGYDPSHTGDSAGCVVLAPPKYPG 431

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               +   F W   D      +I  L  +YR   I ID    G      +          
Sbjct: 432 GKFRVLERFQWHGLDFEAQAAQIEALTTRYRVTYIGIDTTGIGQGVYQLVTKFFPAATPF 491

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                          +T L +K  + +    L        L  +  ++K  I P+  ++ 
Sbjct: 492 HYSVE---------IKTALVMKAQNVIRKGRLEFDTGWKDLAASFMAIKKTITPSGLQVT 542

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
            ++ R + A   D +   M+  A  P        
Sbjct: 543 YKASRSEEASHGDLAWACMHALANEPLEGATGTN 576


>gi|293417393|ref|ZP_06660017.1| terminase [Escherichia coli B185]
 gi|291430913|gb|EFF03909.1| terminase [Escherichia coli B185]
          Length = 590

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAADRVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRELTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTASIST 580


>gi|331656886|ref|ZP_08357848.1| terminase, ATPase subunit [Escherichia coli TA206]
 gi|331055134|gb|EGI27143.1| terminase, ATPase subunit [Escherichia coli TA206]
          Length = 531

 Score =  121 bits (303), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/467 (12%), Positives = 116/467 (24%), Gaps = 46/467 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 75  QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 134

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 135 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 192

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 193 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 252

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 253 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 308

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 309 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 368

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 369 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 428

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 429 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 479

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
                +      E+ R + A   D +   M+     P + +      
Sbjct: 480 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGESANASN 526


>gi|254039145|ref|ZP_04873195.1| terminase [Escherichia sp. 1_1_43]
 gi|226838581|gb|EEH70610.1| terminase [Escherichia sp. 1_1_43]
          Length = 590

 Score =  121 bits (303), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALASGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|26246838|ref|NP_752878.1| terminase, ATPase subunit [Escherichia coli CFT073]
 gi|26107238|gb|AAN79421.1|AE016758_25 Terminase, ATPase subunit [Escherichia coli CFT073]
          Length = 588

 Score =  121 bits (303), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHNNLAPGQLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|221065290|ref|ZP_03541395.1| protein of unknown function DUF264 [Comamonas testosteroni KF-1]
 gi|220710313|gb|EED65681.1| protein of unknown function DUF264 [Comamonas testosteroni KF-1]
          Length = 632

 Score =  121 bits (303), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/464 (10%), Positives = 114/464 (24%), Gaps = 39/464 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E     +    N       E  +  + + R IG T   A   L          +   A+ 
Sbjct: 184 EIFHAGNFGYQNRWYEAQKERTRILLKS-RQIGATYYFAREALIRAVLEGRNQIFLSASK 242

Query: 117 E--TQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL-HPAPWYSDVLHCSLGIDSKHYSTMC 173
               Q K  + A  ++    L            L             S       +    
Sbjct: 243 AQAHQFKNYMVAFANEVGVDLGGDPMVLWNGAELHFLGTNAKTAQGRSGDFYFDEFFWTG 302

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI-LGFLTERNANRFWIMTSNPRR 232
                 +  + +  H  +     +  ++ + +  +          R+  +   +  + + 
Sbjct: 303 NFKELNKVASAMATHKHWRKTYFSTPSAKSHEAYSFWTGEDRNRGRDKAKHVQIDLSHKA 362

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
           L+        +         +       +  +  +          D        +F    
Sbjct: 363 LANGLRCADGRFR-----HIVTIDDALRLGCNLFDLAELLEEYPDDEFSNLFRCEFIDDS 417

Query: 293 IDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL----- 336
              F    +    ++                    P+ +G D +  G    +VV+     
Sbjct: 418 NSQFTLQMMQACMVDSWEAWADDFKPLAARPFAWQPVWVGYDPSFTGDTAALVVIAPPKV 477

Query: 337 -RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 + H   +   D       I  + E+Y    + ID    G      +        
Sbjct: 478 PGGKFRLLHRQQFRGADFEAQAEYIRSITERYNVTFMGIDTTGLGQGVYQNV-------- 529

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGE 452
            +    +A    +    +  L +K    +    L   +    +     ++K  + P+   
Sbjct: 530 -IKFYPQAQSYHYDLALKARLVLKAKQVISKGRLEMDADCTDVAAAFMAIKKVLTPSQRH 588

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYE 496
           +  +S R       D +  +M+         D+  G      YE
Sbjct: 589 VTYQSGRSDDIGHADLAWAVMHALDNESLAGDVHGGSSSVEVYE 632


>gi|253774139|ref|YP_003036970.1| hypothetical protein ECBD_2764 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160943|ref|YP_003044051.1| Terminase, ATPase subunit [Escherichia coli B str. REL606]
 gi|242376647|emb|CAQ31358.1| ybl37 [Escherichia coli BL21(DE3)]
 gi|253325183|gb|ACT29785.1| protein of unknown function DUF264 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972844|gb|ACT38515.1| Terminase, ATPase subunit [Escherichia coli B str. REL606]
 gi|253977058|gb|ACT42728.1| Terminase, ATPase subunit [Escherichia coli BL21(DE3)]
          Length = 588

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPI--VLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLC----TDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEIWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|213646682|ref|ZP_03376735.1| Phage protein P [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
          Length = 590

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAAGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|221214652|ref|ZP_03587622.1| putative ATPase subunit of terminase (gpP-like) [Burkholderia
           multivorans CGD1]
 gi|221165542|gb|EED98018.1| putative ATPase subunit of terminase (gpP-like) [Burkholderia
           multivorans CGD1]
          Length = 583

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 59/460 (12%), Positives = 117/460 (25%), Gaps = 49/460 (10%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+E +  +          E  +  + + R IG T   A   L          +   A+  
Sbjct: 137 FLESIFDYQRTWYRAGFKERIRNILKS-RQIGATWYFAREALLDALNTGRNQIFLSASKA 195

Query: 118 TQ----------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK 167
                        K T+  E+     +LPN       +                  +   
Sbjct: 196 QAHVFRQYIVQFAKDTVGVELKGDPIVLPNG------ATLYFLGTNARTAQSYHGNLYFD 249

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + R     +  + +  H+ +     +  +S   D                   +  
Sbjct: 250 EYFWVPRFQDLRKVASGMAIHSQWRQTYFSTPSSLAHDAYPFWSGALFNRGRPKDQRVSV 309

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                +S           D   R  +          +  +    +    +D     +  Q
Sbjct: 310 ----DISNASLAAGRACGDGQWRQIVTVEDAVRGGCNLFDLERLKLEYSADEYANLLLCQ 365

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL- 336
           F    +  F    +    ++     D + P          + +G D +  G     VV+ 
Sbjct: 366 FIDDSLSVFPLSALQPCMVDTWEVWDDFKPLYLRPFGDEDVWIGYDPSHTGDSAGCVVVA 425

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                     +   F W   D      +I  L  +YR   I ID    G      +    
Sbjct: 426 PPKYPGGKFRVLERFQWHGLDFEAQAGQIEALTRRYRVTYIGIDTTGIGQGVYQLVTKFF 485

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVP 448
                                +T L +K  + +        S    L  +  ++K  + P
Sbjct: 486 PAATPFHYSVE---------IKTALVMKAQNVIRKGRFEFDSGWKDLAASFMAIKKTLTP 536

Query: 449 NTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
           +  ++  ++ R + A   D +   M+  A  P        
Sbjct: 537 SGLQVTYKASRSEEASHGDLAWACMHALANEPLEGATGTN 576


>gi|218558996|ref|YP_002391909.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|218365765|emb|CAR03503.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
          Length = 600

 Score =  121 bits (302), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 157 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 211

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 212 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 269

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 270 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 329

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 330 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 386

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 387 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 446

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 447 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 497

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 498 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 557

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 558 YEASRSEEASHADLAWATMHALLNEPLTAGIST 590


>gi|320172719|gb|EFW47954.1| Phage terminase, ATPase subunit [Shigella dysenteriae CDC 74-1112]
          Length = 590

 Score =  121 bits (302), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 56/454 (12%), Positives = 117/454 (25%), Gaps = 47/454 (10%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGEL- 453
                A D+ +    +T + +K  D +    L      + +  +  +++   + ++G + 
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRK-TMTSSGRIA 546

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
             E+ R + A   D +   M+     P  + +  
Sbjct: 547 TYEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|194450112|ref|YP_002047236.1| hypothetical protein SeHA_C3493 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194408416|gb|ACF68635.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
          Length = 591

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/460 (11%), Positives = 125/460 (27%), Gaps = 57/460 (12%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          AEV +   +   + +F +                  +   +     
Sbjct: 195 LSASKAQ-------AEVFRSYIVNIAEQYFGITLTGNPIRLSNGAELRFLSTNKNTAQSY 247

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T             + + 
Sbjct: 248 SGHLYCDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKQGSK 307

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  I       L      +       +    ++     G + +  E +  RY  ++   
Sbjct: 308 KRTAIKFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATF 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGD 330
            +     F       F   + +E     ++     +P         P+  G D A  G  
Sbjct: 364 NMLYMCVFVDSKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDL 422

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           +  V++           +  +  W   + R    +I  L +KY    + +D    G    
Sbjct: 423 SCFVIVAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGVF 482

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLK 440
           D ++             R         N + +L +K AD +E   +     L +   +  
Sbjct: 483 DNIQ---------HFAMRVAVAIRYDLNTKNKLVLKAADVVESQRIEWDKNLKEIPASFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           S++     +   +   + R +     +    + +     P
Sbjct: 534 SVRRTTTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|41179386|ref|NP_958694.1| Bbp25 [Bordetella phage BPP-1]
 gi|45569518|ref|NP_996587.1| hypothetical protein BMP-1p24 [Bordetella phage BMP-1]
 gi|45580769|ref|NP_996635.1| hypothetical protein BIP-1p24 [Bordetella phage BIP-1]
 gi|40950125|gb|AAR97691.1| Bbp25 [Bordetella phage BPP-1]
          Length = 533

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 84/241 (34%), Gaps = 20/241 (8%)

Query: 274 GLDSDVTRVEVCGQFPQQDID---SFIPLNIIEEALNREPCPDPYAPLI-MGCDIAEEGG 329
            L   +    + G F     D     IP   +E A  R   PD  AP+  +G D+A  G 
Sbjct: 288 SLPEPLRSQMLYGDFNAGIEDDPWQVIPTAWVEAAQARWKRPDRLAPMDSLGVDVARGGR 347

Query: 330 DNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII-IDANNTGARTCDYLE 388
           DNT++  R     +    +   D           +   R  A+I +D    GA   D+L 
Sbjct: 348 DNTILARRHAMWFDVPLTYPGKDTPDGPTVAGLAIAALRDHAVIHLDVIGVGASPYDFLA 407

Query: 389 MLGYHVYRVLGQKRA-----VDLEFCRNRRTELHVKMADWLE-----FASLINHSGLIQN 438
                V  V   + A            N R+EL  +M + L+       +L     L+ +
Sbjct: 408 QAKQQVVGVNVAEAARGTDKSGRLRFFNLRSELWWRMREALDPTNNTGIALPPDPRLLAD 467

Query: 439 LKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           L +       +   L + S+     K  +S D+    +    + P R+ ++       + 
Sbjct: 468 LTAP--TWSLSGATLKVASREDIIEKIGRSPDFGSAYVLALMDTPKRAAVEALGQARSRL 525

Query: 496 E 496
           +
Sbjct: 526 D 526


>gi|238764966|ref|ZP_04625904.1| terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
 gi|238696825|gb|EEP89604.1| terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
          Length = 591

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/446 (10%), Positives = 121/446 (27%), Gaps = 43/446 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           +     H  N+       + K      R IG T   A+             +   A+  +
Sbjct: 149 LFSYQQHLRNNKFRRVRNLLK-----SRQIGATYYFAFEAFEDAVLSGDTQIFLSASKRQ 203

Query: 118 TQLKTTLWAEVSKWLSLLPNKH---WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            ++  T   ++++    +P K         +     A   +     S  +    Y  +  
Sbjct: 204 AEVFRTYIVKIAQTEFGIPIKGNPIKLSNLAELYFLATNSNTAQSNSGHLYIDEYLWIPN 263

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +  H  + +   +  ++ T             + +  R  ++  +   + 
Sbjct: 264 FRRLNEVASGMATHKHWRITYFSTPSAKTHQGYPFWSGDEWRKGDTKRKDVVFPSFDEMR 323

Query: 235 GKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
               E    P   W+    ++     G + +    +  RY        +     F     
Sbjct: 324 DGGREC---PDGQWRYVVTLEDAIAGGFNLADINELRERYNE--SAFNMLFMCVFVDDKE 378

Query: 294 DSFIPLNIIEEALN--REPCPDPYAPL-------IMGCDIAEEGGDNTVVVLR------R 338
             F   +++   ++        P  P+         G D A    + T VV+        
Sbjct: 379 SVFKFGDLMRCGVDIRTWEDFHPDEPMPFGNREVWGGFDPARSNDNATFVVVAPPLVAAE 438

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
              +     W     +    +I  +  +Y    I ID    G    + ++          
Sbjct: 439 RFRVLEKHHWRSMSFQFMAERIRSIKARYNMTYIGIDVTGLGYGVFELVQG--------- 489

Query: 399 GQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELA 454
              R           +  L +KM D +    +        +  +  +++     +  ++ 
Sbjct: 490 FAHRETVAIHYSVESKNRLVMKMLDVIYANRIEWDEEATDIPASFLAIRQETTNSGNKVT 549

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENP 480
             ++R +     D    + +  +  P
Sbjct: 550 FTAERSEETGHADVFFAIAHALSNEP 575


>gi|307314499|ref|ZP_07594102.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905922|gb|EFN36444.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|315060102|gb|ADT74429.1| terminase, ATPase subunit [Escherichia coli W]
 gi|323379340|gb|ADX51608.1| terminase ATPase subunit [Escherichia coli KO11]
 gi|332342200|gb|AEE55534.1| phage terminase, ATPase subunit [Escherichia coli UMNK88]
          Length = 588

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNRADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|56414723|ref|YP_151798.1| phage gene [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197363650|ref|YP_002143287.1| phage gene [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|56128980|gb|AAV78486.1| putative phage gene [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197095127|emb|CAR60674.1| putative phage gene [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 591

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/455 (11%), Positives = 121/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T             + +  R  I
Sbjct: 253 CDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKQGSKKRTAI 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                  L      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 KFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDNKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  +  W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 VAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGVFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K A  +E   +     L +   +  S++  
Sbjct: 487 --------HFAMRVAVAIRYDLNTKNQLVLKAAGVVESQRIEWDKNLKEIPASFMSVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|313760829|gb|ADR79391.1| terminase [APSE phage Eptesicus fuscus/P5/IT/USA/2009]
          Length = 394

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 65/376 (17%), Positives = 106/376 (28%), Gaps = 71/376 (18%)

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN 221
           +   +       +        +    H         +EA    +     ++  + +  + 
Sbjct: 14  IEGINDSIFKYGQLAR--NIASIKSKH--DFDVAWVEEAETVSEKSLDTLIPTIRKPGSE 69

Query: 222 RFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
            ++    NP    G  Y  F KP       Q      E         +     LD+    
Sbjct: 70  LWFSF--NPAEEDGAVYRRFVKPYKAIIDKQGYYEDDEVY-------VGKVSYLDNPWLP 120

Query: 282 VEVC-----GQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMGCDIAEEGGDNTVV 334
            E+      G+      D+ I    +E A +        P    ++  D A+ G D   +
Sbjct: 121 AELKNDAQKGECDANYEDALIQPEWVEAATDAHIKLGFKPSGIRVVTFDPADSGQDEKAL 180

Query: 335 VLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC---------- 384
             R G +IE    WS+ D+             YR D  I D    GA T           
Sbjct: 181 SKRYGVLIEDCVSWSEGDVADATMTAFDEAFDYRADDFIYDNIGLGAGTVKTHLRHSNDG 240

Query: 385 --------------DYLEML----GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWL-- 424
                         DY   +                    +  RN+R +  V +AD    
Sbjct: 241 NKMVVTGFGAGDSPDYPHEIYVPGNGEYLPSSNNDDRTHRDTFRNKRAQYWVYLADRFYK 300

Query: 425 -----EFASLINHSGLIQ-------------NLKSLKSFIVPNTGELAIESK---RVKGA 463
                E    ++   LI               L   +    P    + + SK   R+KG 
Sbjct: 301 TWRAVEKGEYLDPEALISLSSKIAKLSQLKSELIKQQRKRTPGNRLIQLMSKDEMRLKGI 360

Query: 464 KSTDYSDGLMYTFAEN 479
           KS + +D LM +FA  
Sbjct: 361 KSPNMADTLMMSFANP 376


>gi|331675382|ref|ZP_08376132.1| terminase, ATPase subunit (GpP) [Escherichia coli TA280]
 gi|331067442|gb|EGI38847.1| terminase, ATPase subunit (GpP) [Escherichia coli TA280]
          Length = 590

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSTDD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|323936689|gb|EGB32974.1| terminase [Escherichia coli E1520]
          Length = 590

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFATNPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|117623093|ref|YP_852006.1| putative phage terminase [Escherichia coli APEC O1]
 gi|117624286|ref|YP_853199.1| Phage protein P [Escherichia coli APEC O1]
 gi|115512217|gb|ABJ00292.1| putative phage terminase [Escherichia coli APEC O1]
 gi|115513410|gb|ABJ01485.1| Phage protein P [Escherichia coli APEC O1]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|30065706|ref|NP_839851.1| gpP [Yersinia phage L-413C]
 gi|300947250|ref|ZP_07161455.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|301022960|ref|ZP_07186775.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|331678021|ref|ZP_08378696.1| terminase, ATPase subunit (GpP) [Escherichia coli H591]
 gi|30025900|gb|AAP04439.1| gpP [Yersinia phage L-413C]
 gi|33413700|gb|AAN28220.1| gpP [Enterobacteria phage WPhi]
 gi|300397301|gb|EFJ80839.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300453115|gb|EFK16735.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|315061386|gb|ADT75713.1| terminase, ATPase subunit [Escherichia coli W]
 gi|315063221|gb|ADT77548.1| phage large terminase subunit [Escherichia coli W]
 gi|323380714|gb|ADX52982.1| phage large terminase subunit GpP [Escherichia coli KO11]
 gi|325499372|gb|EGC97231.1| Terminase, ATPase subunit (GpP) [Escherichia fergusonii ECD227]
 gi|331074481|gb|EGI45801.1| terminase, ATPase subunit (GpP) [Escherichia coli H591]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|319789040|ref|YP_004150673.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
 gi|317113542|gb|ADU96032.1| protein of unknown function DUF264 [Thermovibrio ammonificans HB-1]
          Length = 419

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 74/444 (16%), Positives = 144/444 (32%), Gaps = 72/444 (16%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            +Q+E ++ +D+H  +             I   R  GK+ + ++      +T+P  +++ 
Sbjct: 6   PYQIEIVKGIDSHKFSV------------IKMARQTGKSFVVSYWATRRATTKPNHAIVV 53

Query: 113 LANSETQLKTTLWAEVSKWLSL---LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
           ++ +E Q K  L+ +  K       L    +FE   L      + +     +L       
Sbjct: 54  VSPTERQSK--LFVDKVKLHIKAMRLTGVKFFEDTELKKLEVNFPNGSQIIAL------- 104

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPD--VINLGILGFLTERNANRFWIMT 227
                      P    G     G  +I DE +   +   +   +   +T R  +   +  
Sbjct: 105 -----------PANPDGIRGFSGD-VIMDEVAFFKNWQEVYRAVFPIIT-RKKDYKLVAI 151

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQID---TRTVEGIDPSFHEGIIARYGLDSDVTRVEV 284
           S P   +  FY +++   ++ K F+        V        E + A    + D  R E 
Sbjct: 152 STPFGKNDLFYYLWSISENNPKWFRYSLNIFEAVAKGLKVDVEELRAGI-KNEDAWRTEY 210

Query: 285 CGQFPQQDIDSFIPLNIIEEALNREPCP------DPYAPLIMGCDIAEEGGDNTVVV--- 335
             +F  +      P  +I++    +         +    L  G D+     D TV+    
Sbjct: 211 LVEFIDEADAVL-PYELIQKCEMPKEELLVEDIKELKGELYCGVDVGR-RKDLTVITLLE 268

Query: 336 -LRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYH 393
            L     +  + + SK   R     IS     +    + ID    G +  + L+   G  
Sbjct: 269 KLGDVLYVRRIEELSKKPFREQLELISHYA--HYARRLAIDETGLGMQLAEELKERFGSK 326

Query: 394 VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF--ASLINHSGLIQNLKSLKSFIVPNTG 451
           V  V    +          + EL  K+    +     +     L ++L S++   V N G
Sbjct: 327 VIPVYFSAKN---------KEELAEKLRAKFQDRLIRVPADPDLREDLHSVRK-TVTNAG 376

Query: 452 ELAIESKRVKGAKSTDYSDGLMYT 475
            +  E    +     D    L   
Sbjct: 377 NVRYEGSTQE--SHADRFWSLALA 398


>gi|323938219|gb|EGB34479.1| terminase [Escherichia coli E1520]
          Length = 588

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/467 (12%), Positives = 116/467 (24%), Gaps = 46/467 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
                +      E+ R + A   D +   M+     P + +      
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGESANASN 583


>gi|324113792|gb|EGC07767.1| terminase [Escherichia fergusonii B253]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFATNPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|323961666|gb|EGB57270.1| terminase [Escherichia coli H489]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|315296184|gb|EFU55492.1| conserved hypothetical protein [Escherichia coli MS 16-3]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDISHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|294494147|gb|ADE92903.1| terminase, ATPase subunit [Escherichia coli IHE3034]
 gi|323951869|gb|EGB47743.1| terminase [Escherichia coli H252]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|320196848|gb|EFW71470.1| Phage terminase, ATPase subunit [Escherichia coli WV_060327]
          Length = 590

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELYNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|82543312|ref|YP_407259.1| terminase, ATPase subunit [Shigella boydii Sb227]
 gi|81244723|gb|ABB65431.1| terminase, ATPase subunit [Shigella boydii Sb227]
 gi|320185726|gb|EFW60482.1| Phage terminase, ATPase subunit [Shigella flexneri CDC 796-83]
 gi|332097052|gb|EGJ02035.1| terminase, ATPase subunit [Shigella boydii 3594-74]
          Length = 588

 Score =  120 bits (301), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEKIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGRLCA----DGQYRQIVTVEDAVRGACNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|323378035|gb|ADX50303.1| phage large terminase subunit GpP [Escherichia coli KO11]
          Length = 589

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 146 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 200

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 201 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 258

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 259 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 318

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 319 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 375

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 376 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 435

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 436 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 486

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 487 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 546

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 547 YEASRSEEASHADLAWATMHALLNEPLTAGIST 579


>gi|9630329|ref|NP_046758.1| gpP [Enterobacteria phage P2]
 gi|168789033|ref|ZP_02814040.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC869]
 gi|188492656|ref|ZP_02999926.1| phage large terminase subunit GpP [Escherichia coli 53638]
 gi|261225041|ref|ZP_05939322.1| Terminase, ATPase subunit (GpP) [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257612|ref|ZP_05950145.1| Terminase, ATPase subunit (GpP) [Escherichia coli O157:H7 str.
           FRIK966]
 gi|301048706|ref|ZP_07195715.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|139354|sp|P25479|VPP_BPP2 RecName: Full=Terminase, ATPase subunit; AltName: Full=GpP
 gi|3139088|gb|AAD03269.1| gpP [Enterobacteria phage P2]
 gi|188487855|gb|EDU62958.1| phage large terminase subunit GpP [Escherichia coli 53638]
 gi|189371250|gb|EDU89666.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC869]
 gi|300299452|gb|EFJ55837.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|324020535|gb|EGB89754.1| hypothetical protein HMPREF9542_00768 [Escherichia coli MS 117-3]
          Length = 590

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|309795387|ref|ZP_07689805.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308121037|gb|EFO58299.1| conserved hypothetical protein [Escherichia coli MS 145-7]
          Length = 588

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|170683976|ref|YP_001746268.1| phage large terminase subunit GpP [Escherichia coli SMS-3-5]
 gi|170521694|gb|ACB19872.1| phage large terminase subunit GpP [Escherichia coli SMS-3-5]
          Length = 590

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|170020778|ref|YP_001725732.1| hypothetical protein EcolC_2777 [Escherichia coli ATCC 8739]
 gi|169755706|gb|ACA78405.1| protein of unknown function DUF264 [Escherichia coli ATCC 8739]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|198245759|ref|YP_002216726.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197940275|gb|ACH77608.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624483|gb|EGE30828.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|306812733|ref|ZP_07446926.1| Terminase, ATPase subunit (GpP) [Escherichia coli NC101]
 gi|305853496|gb|EFM53935.1| Terminase, ATPase subunit (GpP) [Escherichia coli NC101]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFNSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|300907199|ref|ZP_07124862.1| hypothetical protein HMPREF9536_05153 [Escherichia coli MS 84-1]
 gi|301303626|ref|ZP_07209748.1| hypothetical protein HMPREF9347_02221 [Escherichia coli MS 124-1]
 gi|300401074|gb|EFJ84612.1| hypothetical protein HMPREF9536_05153 [Escherichia coli MS 84-1]
 gi|300841125|gb|EFK68885.1| hypothetical protein HMPREF9347_02221 [Escherichia coli MS 124-1]
 gi|315257856|gb|EFU37824.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWSDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|332884414|gb|EGK04674.1| hypothetical protein HMPREF9456_03377 [Dysgonomonas mossii DSM
           22836]
          Length = 450

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 65/410 (15%), Positives = 123/410 (30%), Gaps = 35/410 (8%)

Query: 87  GIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL 146
           G GK+ L ++ +       P    +        LK T    + K  S+        +   
Sbjct: 29  GGGKSILESYWLTKNSLKYPDTKWLLGRAKMKTLKETTLKSLFKVFSMQ------GITPN 82

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV 206
                         ++   +     +   +       F    +        DE S   + 
Sbjct: 83  YYKYNGANDKENPNTIQFYNGSLIILKDLFYYPSDPEFDELGSLEITGAAIDENSQITEK 142

Query: 207 INLGILGFLTERNANRFWI--MTSNPRRLSGKFYEIFNKPL------DDWKRFQIDTRTV 258
               ++  +    A    I  M           Y  F KP       DD    Q      
Sbjct: 143 CWNIVMSRIRHDVAKNGLIPKMFGACNPTKNFVYNRFYKPHRDGILPDDKAFIQALVTDN 202

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI--PLNIIEEALNREPCPDPYA 316
             +D  + E +     LD       + G++   D    +     I++   N         
Sbjct: 203 PFVDKFYIENLKN---LDPISRARLLDGEWEYDDDPYVLMQYEKIVDLFTNSHVS---GG 256

Query: 317 PLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKY--RPDAIII 374
           P  M  D+A  G D+T + +  G +  +     K  +         L  +Y       I 
Sbjct: 257 PRYMTIDVARLGKDDTTIRIWEGLISIYKKVIPKCRIDDLTVLARKLQTEYSVPNSNTIA 316

Query: 375 DANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI---- 430
           D +  G    D L   G+ V          ++   +N R++ + K+A+ +    +     
Sbjct: 317 DEDGVGGGLVDNLRCKGF-VNNSKPLPIYGEVRNYQNLRSQCYFKLAEIVNSNLMYLKNE 375

Query: 431 ---NHSGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
              +   +++ L+ +K        +L + +K   +    KSTD +D LM 
Sbjct: 376 PIVDRERVVKELEQIKQIDADKDTKLKVITKEMLKSILGKSTDEADNLMM 425


>gi|324112701|gb|EGC06677.1| terminase [Escherichia fergusonii B253]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|218690765|ref|YP_002398977.1| terminase, ATPase subunit (GpP) [Escherichia coli ED1a]
 gi|218428329|emb|CAR09255.2| Terminase, ATPase subunit (GpP) [Escherichia coli ED1a]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|157160343|ref|YP_001457661.1| terminase, ATPase subunit [Escherichia coli HS]
 gi|218559567|ref|YP_002392480.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|256021061|ref|ZP_05434926.1| Terminase, ATPase subunit (GpP) [Shigella sp. D9]
 gi|300817075|ref|ZP_07097294.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|331662228|ref|ZP_08363151.1| terminase, ATPase subunit [Escherichia coli TA143]
 gi|331676606|ref|ZP_08377302.1| terminase, ATPase subunit [Escherichia coli H591]
 gi|332282288|ref|ZP_08394701.1| DNA-dependent ATPase terminase subunit [Shigella sp. D9]
 gi|157066023|gb|ABV05278.1| terminase, ATPase subunit [Escherichia coli HS]
 gi|218366336|emb|CAR04087.1| Terminase, ATPase subunit (GpP) [Escherichia coli S88]
 gi|300530427|gb|EFK51489.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|315615257|gb|EFU95893.1| terminase, ATPase subunit [Escherichia coli 3431]
 gi|323172219|gb|EFZ57857.1| terminase, ATPase subunit [Escherichia coli LT-68]
 gi|323190830|gb|EFZ76098.1| terminase, ATPase subunit [Escherichia coli RN587/1]
 gi|323942735|gb|EGB38900.1| terminase [Escherichia coli E482]
 gi|323946304|gb|EGB42336.1| terminase [Escherichia coli H120]
 gi|323963883|gb|EGB59377.1| terminase [Escherichia coli M863]
 gi|327252355|gb|EGE64027.1| terminase, ATPase subunit [Escherichia coli STEC_7v]
 gi|331060650|gb|EGI32614.1| terminase, ATPase subunit [Escherichia coli TA143]
 gi|331075295|gb|EGI46593.1| terminase, ATPase subunit [Escherichia coli H591]
 gi|332104640|gb|EGJ07986.1| DNA-dependent ATPase terminase subunit [Shigella sp. D9]
          Length = 588

 Score =  120 bits (300), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|222034345|emb|CAP77086.1| Terminase, ATPase subunit [Escherichia coli LF82]
          Length = 588

 Score =  120 bits (300), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVDVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|282599774|ref|ZP_05971828.2| terminase, ATPase subunit [Providencia rustigianii DSM 4541]
 gi|282567779|gb|EFB73314.1| terminase, ATPase subunit [Providencia rustigianii DSM 4541]
          Length = 594

 Score =  120 bits (299), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 58/472 (12%), Positives = 132/472 (27%), Gaps = 50/472 (10%)

Query: 52  RSWQL---EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
             +Q    E +     H   ++      + K      R IG T   A+            
Sbjct: 144 DDFQKFADEMLFGYQKHLRANITKSVRNILK-----SRQIGATWYFAFEAFEDACLTGKP 198

Query: 109 SVICLA--NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGI 164
            +   A        ++ +     K+  +    +   + + +     +   +     S  +
Sbjct: 199 QLFLSASKPQAEVFRSYIVNIAEKFFGVTLTGNPIRLSNGAELRFLSTNKNTAQSYSGHL 258

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
               Y  +          + +  H+ +     +  ++ T               +  R  
Sbjct: 259 YCDEYFWVPDFKRFNEVSSAMATHDHWRTTYFSTPSAKTHPAYPFWTGDEWRGSDPARKK 318

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
           +       L     +    P   W+    ++     G + +  E +  +Y  DS    + 
Sbjct: 319 VKFPQFDELRDGGRDC---PDGQWRYVITLEDAIKGGFNLASIERLRNKYNPDS--FNML 373

Query: 284 VCGQFPQQDIDSFIPLNIIEEALN--REPCPDPYAPL-------IMGCDIAEEGGDNTVV 334
               F       F    + +  ++       +P AP          G D A  G  +T  
Sbjct: 374 FMCVFVDSGASVFKYHQLDKCGVDVHLWEDHNPDAPRPFGDREVWGGFDPARSGDTSTFA 433

Query: 335 VLR------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           ++           +  +F W   + +     I  L ++YR   I ID    G    + ++
Sbjct: 434 IVAPPMMAPEVFRVLAIFYWQGMNWKHQAKLIEDLTKRYRFTYIGIDTTGIGHGVYEMVQ 493

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                        R         + + +L +KM D +    L        ++ +  S++ 
Sbjct: 494 D---------FAPRQTHSIHYSQQTKNQLVMKMIDVVSEERLEWDEEQKEILASFLSIRH 544

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYE 496
                 G +   + R +     D    + +     P    ++F R  + +Y 
Sbjct: 545 TTTGKGGSMTFVADRTQETGHADAFWAIAHAVMNEP----LNFERKRTSKYR 592


>gi|300916285|ref|ZP_07133032.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300416374|gb|EFJ99684.1| conserved hypothetical protein [Escherichia coli MS 115-1]
          Length = 588

 Score =  120 bits (299), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 117/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                +    +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRSKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|332088966|gb|EGI94078.1| terminase, ATPase subunit [Shigella boydii 5216-82]
          Length = 590

 Score =  120 bits (299), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTTQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|320180747|gb|EFW55673.1| Phage terminase, ATPase subunit [Shigella boydii ATCC 9905]
 gi|323167352|gb|EFZ53060.1| terminase, ATPase subunit [Shigella sonnei 53G]
          Length = 590

 Score =  120 bits (299), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 115/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F    +
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKV 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|254286518|ref|ZP_04961475.1| terminase [Vibrio cholerae AM-19226]
 gi|150423467|gb|EDN15411.1| terminase [Vibrio cholerae AM-19226]
          Length = 605

 Score =  120 bits (299), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 59/455 (12%), Positives = 119/455 (26%), Gaps = 40/455 (8%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN-SETQLKTTLW 125
                  N       I   R IG T   A   L          +   A+ +++++     
Sbjct: 167 YQHTMRNNLHQRTRNILKSRQIGATYYFAGEALEQAILTGDNQIFLSASRAQSEVFRRYI 226

Query: 126 AEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPD 182
             ++K    L L  N       +     +            +    Y  + +     +  
Sbjct: 227 VALAKEFLGLELSGNPMTLSNGAELHFLSTNGKTAQSYHGHVYIDEYFWIGKFDELNKVA 286

Query: 183 TFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN 242
           + +     +     +  +S                    R  I       L         
Sbjct: 287 SGMASQKKWRKTYFSTPSSKIHPAYPFWTGEKWRGDKTTRKNIEFPTFDELRDGGRLC-- 344

Query: 243 KPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF----I 297
            P   W+    I+     G D    + +   Y              F       F    I
Sbjct: 345 -PDKQWRYVVTIEDAAKGGCDLFDIDELREEYSETD--FNNLFMCVFVDGASSIFEFNKI 401

Query: 298 PLNIIEEALNREPCPDPYAP-----LIMGCDIAEEGGDNT------VVVLRRGPVIEHLF 346
              +++  + ++  P+   P     + +G D +    +         +V      +    
Sbjct: 402 ERCMVDSEIWQDYKPNAARPFGSREVWLGYDPSRTRDNAVLMVVAPPIVAVEKFRVLEKH 461

Query: 347 DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDL 406
            W     +   ++IS + E++    + ID    GA   D L         V    R    
Sbjct: 462 TWRGLSFQHQASEISKVFERFNVTYLGIDITGIGAGVHDLL---------VNKHPRETVA 512

Query: 407 EFCRNR-RTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKG 462
               N  +  L +KM D ++   L   +          ++K     +   +  +++R + 
Sbjct: 513 IHYSNENKNRLVMKMIDIIDGNRLQFDAGMKETAMAFMAIKRVATNSGNMMTFKAERSEQ 572

Query: 463 AKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           A   D    L +     P   D    R  ++Q   
Sbjct: 573 AGHADDFWALSHALINEP--LDHSTQRKSTWQMAA 605


>gi|331646084|ref|ZP_08347187.1| terminase, ATPase subunit [Escherichia coli M605]
 gi|331044836|gb|EGI16963.1| terminase, ATPase subunit [Escherichia coli M605]
          Length = 588

 Score =  119 bits (298), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDFASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|296104758|ref|YP_003614904.1| terminase, ATPase subunit [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059217|gb|ADF63955.1| terminase, ATPase subunit [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 572

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/453 (11%), Positives = 114/453 (25%), Gaps = 42/453 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           M     H   +                R IG T   A   L    T     +   A+  +
Sbjct: 128 MFEYQRHWWQAGVKHRIRNL----LKSRQIGATYFFAREALIDAITTGRNQIFLSASKAQ 183

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSKHYSTMCRT 175
             +      + +K + +        + + +                  +    Y  + + 
Sbjct: 184 AHVFKQYIIDFAKEVDVELKGDPMTLSNGACLYFLGTNARTAQSYHGNLYLDEYFWIPKF 243

Query: 176 YSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSG 235
               +  + +  H  +     +  +S T                A    +          
Sbjct: 244 QELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDIDLTHGN-- 301

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
                     D   R  +          +  +    R     D  +  +  +F       
Sbjct: 302 --LARGVLCPDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCEFIDDLASV 359

Query: 296 FIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVVL------- 336
           F    +    ++       +            + +G D A+  + GD+   V+       
Sbjct: 360 FPLSELQACMVDSWEVWADFQALALRPFGWREVWIGYDPAKGTQNGDSAGCVVVAPPAVP 419

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                I     W   D R   + I  L ++Y    I ID+   G    + ++     V  
Sbjct: 420 GGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVKAFFPAVRE 479

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
            +            N +  L +K  D +    L   +    + Q+  +++     +    
Sbjct: 480 FVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRATTASGNRP 530

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
             E+ R + A   D +   M+     P + +  
Sbjct: 531 TYEASRSEEASHADLAWATMHALFNEPLQGEAA 563


>gi|324009700|gb|EGB78919.1| hypothetical protein HMPREF9532_00529 [Escherichia coli MS 57-2]
          Length = 588

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKVDKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHINLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRIEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|261251508|ref|ZP_05944082.1| terminase [Vibrio orientalis CIP 102891]
 gi|260938381|gb|EEX94369.1| terminase [Vibrio orientalis CIP 102891]
          Length = 594

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/424 (11%), Positives = 108/424 (25%), Gaps = 40/424 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   +   L          +   A S  Q        + +      +    
Sbjct: 169 ILKSRQIGATYYFSGEALENAILTGDDQLFLSA-SRAQA-EVFRTYIIRIAKEFWDIDLT 226

Query: 142 EMQ------SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
                    +     +         S  + +  Y  + +    ++  + +  H  +    
Sbjct: 227 GNPIVLSNGAHLRFLSTNGKTAQSYSGHLYTDEYFWIGQFAEVKKVSSAIATHKKWRRTY 286

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
            +  +S T             +    R  I          +                ++ 
Sbjct: 287 FSTPSSKTHPAYPFWTGDEWRQGKETRKNIEFPTFD--EYRDGGRLCPDKQWRYVITMED 344

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF----IPLNIIEEALNREPC 311
              +G D    E +   Y  +    +      F       F    +   +++    ++  
Sbjct: 345 AVAQGFDLVDIEDLRDEYSDNE--FKNLFMCIFVDGAASIFEFNKVMRCMVDSKQWQDFD 402

Query: 312 PDPYAP-----LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKI 360
           P    P     + +G D +    +  +VV+           +     W   + +    +I
Sbjct: 403 PKAKRPIGAREVWLGYDPSRTRDNACLVVVAPPALPGEKFRVLEKHYWKGLNFQYQAKQI 462

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRN-RRTELHVK 419
             + + Y    + ID    GA   D L              R        N  +  L +K
Sbjct: 463 GEVFKCYNVTYLGIDVTGIGAGVYDLLSKQ---------HPREAVAIHYSNDNKNRLVMK 513

Query: 420 MADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
           M D ++ + L        +     ++K     +   +  ++ R +     D    + +  
Sbjct: 514 MIDVIDASRLQFDEEHKDMAMAFMAIKRVATNSGNNMTFKADRSELVGHADAFWAISHAV 573

Query: 477 AENP 480
              P
Sbjct: 574 INEP 577


>gi|323185221|gb|EFZ70586.1| terminase, ATPase subunit [Escherichia coli 1357]
          Length = 588

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQAGMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|326784094|ref|YP_004324487.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
 gi|310004826|gb|ADO99217.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           Syn1]
          Length = 550

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 66/474 (13%), Positives = 129/474 (27%), Gaps = 77/474 (16%)

Query: 5   LPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDA 64
           +   PE  ++        + K     F   +         L  F     +Q E +     
Sbjct: 20  IDFTPEQVKEFI------KCKNDPIYFTKTYVQIVSLDEGLVPFKMWD-FQEELIRKFHK 72

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
              N    P            R  GK+T     +L  +     ++V  LAN  +  +  L
Sbjct: 73  SRFNIAKLP------------RQTGKSTTVVSYLLHYLIFNDSVNVGILANKASTARDLL 120

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
            A ++     LP                        ++ +++        T       + 
Sbjct: 121 -ARLATAYENLP-----------KWIQQGVVVWNKGNIELENGSKILAAST-------SA 161

Query: 185 VGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFYE 239
                     I  DE +  P    D     +   +T   +     I T        K ++
Sbjct: 162 SAVRGMSFNIIFLDEFAFVPNHIADSFFASVYPTITSGKSTKVIIISTPQGMNHFYKMWQ 221

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
                 +D+   ++    V G D  + E  I            E   +F           
Sbjct: 222 DAVNGRNDYTYHEVHWSQVPGRDAKWKEETIKNTS--QRQFTQEFECEFLGSVDTLISAS 279

Query: 300 NIIEEALNRE----------PCPDPYAPLIMGCDIAE--EGGDNTVVVLRRGPVIEHL-- 345
            +   A +              P      ++  D++    G  +  +V     V   +  
Sbjct: 280 KLKALAFDEPITRNKGLDIYEKPKDKNEYLLTVDVSRGIGGDYSAFIVYDITTVPYKIVG 339

Query: 346 -FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQ 400
            +  ++       N I+ +   Y    ++ + N+ G +        LE     +  + G+
Sbjct: 340 KYRNNEIKPMLFPNVINDVARAYNNAWVLCEVNDVGDQVASILNFDLEYPNVLMCAMRGR 399

Query: 401 KRAVDLEFCRNRRTELHVKM------------ADWLEFASLI-NHSGLIQNLKS 441
              +  +     +T+L VKM               +E   LI N   +I  L +
Sbjct: 400 AGQIVGQGFSGNKTQLGVKMSVTVKKVGCANLKQIIEDDKLIFNDYEIISELTT 453


>gi|204929563|ref|ZP_03220637.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204321282|gb|EDZ06482.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 588

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/451 (11%), Positives = 115/451 (25%), Gaps = 42/451 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           M     H   +                R IG T   A   L    T     +   A+  +
Sbjct: 144 MFEYQRHWWQAGVKHRIRNL----LKSRQIGATYFFAREALIDAITTGRNQIFLSASKAQ 199

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSKHYSTMCRT 175
             +      + +K + +        + + +                  +    Y  + + 
Sbjct: 200 AHVFKQYIIDFAKEVDVELKGDPMTLSNGACLYFLGTNARTAQSYHGNLYLDEYFWIPKF 259

Query: 176 YSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSG 235
               +  + +  H  +     +  +S T                A    +          
Sbjct: 260 QELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDIDLTHSNLA 319

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
           +         D   R  +          +  +    R     D  +  +  +F       
Sbjct: 320 RGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCEFIDDLASV 375

Query: 296 FIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVVL------- 336
           F    +    ++       +            + +G D A+  + GD+   V+       
Sbjct: 376 FPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCVVVAPPTVP 435

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                I     W   D R   + I  L ++Y    I ID+   G    + ++     V  
Sbjct: 436 GGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVKAFFPAVRE 495

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
            +            N +  L +K  D +    L   +    + Q+  +++     +    
Sbjct: 496 FVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRATTASGNRP 546

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
             E+ R + A   D +   M+     P + +
Sbjct: 547 TYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|331672362|ref|ZP_08373153.1| terminase, ATPase subunit [Escherichia coli TA280]
 gi|331070557|gb|EGI41921.1| terminase, ATPase subunit [Escherichia coli TA280]
          Length = 588

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSLDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|169634245|ref|YP_001707981.1| phage-related terminase, ATPase subunit (GPP-like) [Acinetobacter
           baumannii SDF]
 gi|169153037|emb|CAP02098.1| phage-related terminase, ATPase subunit (GPP-like) [Acinetobacter
           baumannii]
          Length = 594

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/431 (12%), Positives = 110/431 (25%), Gaps = 40/431 (9%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-ETQLKTTLWAEVSKWLSLLPNKH 139
           AI   R IG T   A              +   A+  +  +  T   + +   + +  K 
Sbjct: 167 AILKSRQIGATYYFAREAFIDALKTGRNQIFLSASKAQAHIFKTYIQQFAFEHTGVELKG 226

Query: 140 ----WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
                   Q+                       +          +  + +  H  +    
Sbjct: 227 DPIIIGNNQANLTFLGTNARTAQGHHGNFYFDEFFWTYGFNELNKVASGMAMHKKWRKTY 286

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
            +  ++                       +             +      D   R  +  
Sbjct: 287 FSTPSTMAHQAYAFWTGERYNRGRPKDQRLNIDVSHDA----LKRGRYCEDKIWRQIVTI 342

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---- 311
              E       +    R+   ++     +  QF      S  PLNI++  +         
Sbjct: 343 LDAENGGCDLFDIDELRFEYSAEEFANLLMCQFIDD-GASIFPLNILQACMVDSWEAWAD 401

Query: 312 --------PDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTN 357
                   P    P+ +G D AE G    +VV+           I     +   D +   
Sbjct: 402 DYKPFHARPLASRPVWVGYDPAETGDSAGLVVVAPPSVANGKFRILERHQFRGMDFKAQA 461

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            +I  +  +Y    I +D    G      +     ++                  +T+L 
Sbjct: 462 EQIRQITLRYNVTYIGLDTTGMGTGVAQLVRQFFPNLTTFSYSPE---------VKTQLV 512

Query: 418 VKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMY 474
           +K  D +    L   +    + Q+L S+K  +  +  ++   + R +     D +  LM+
Sbjct: 513 LKTLDVIRNGRLEFDAGHTDIAQSLMSIKKTLTASQRQMTFTAGRSEEIGHADLAWALMH 572

Query: 475 TFAENPPRSDM 485
                P     
Sbjct: 573 AIYNEPLEGAT 583


>gi|293433090|ref|ZP_06661518.1| terminase [Escherichia coli B088]
 gi|291323909|gb|EFE63331.1| terminase [Escherichia coli B088]
          Length = 591

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/455 (10%), Positives = 122/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DIWAEEHLFEYQKHLRRNIGQQVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T             + +  R   
Sbjct: 253 CDEYFWVPNFARLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKQGSKKRAAA 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
              +   +      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 QFPSFDEMRNG-GRLCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDSKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 LR------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  + +W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 IAPPMYAAEKFRVLKVINWKGMNFRYQARQIELLFKKYNFTYLGVDVTGIGQGVFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  +++  
Sbjct: 487 --------HFAMRVAVAIRYDMNTKNQLVLKAADVVESQRIEWDKNLKEIPASFMAVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|323953478|gb|EGB49344.1| terminase [Escherichia coli H252]
          Length = 588

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKNNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQADAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|322614428|gb|EFY11359.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621507|gb|EFY18360.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624368|gb|EFY21201.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626565|gb|EFY23370.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633573|gb|EFY30315.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638384|gb|EFY35082.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322647317|gb|EFY43813.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649287|gb|EFY45724.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655993|gb|EFY52293.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322661388|gb|EFY57613.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322666960|gb|EFY63135.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671329|gb|EFY67452.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677664|gb|EFY73727.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681510|gb|EFY77540.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322683910|gb|EFY79920.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195479|gb|EFZ80657.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200466|gb|EFZ85546.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203030|gb|EFZ88062.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205271|gb|EFZ90246.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210579|gb|EFZ95463.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218140|gb|EGA02852.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221594|gb|EGA06007.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227645|gb|EGA11800.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230903|gb|EGA15021.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234745|gb|EGA18831.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238784|gb|EGA22834.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241484|gb|EGA25515.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248370|gb|EGA32306.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323252865|gb|EGA36699.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257014|gb|EGA40723.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260513|gb|EGA44124.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264430|gb|EGA47936.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269565|gb|EGA53018.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 588

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/459 (11%), Positives = 122/459 (26%), Gaps = 42/459 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E +    + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEIFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVV 335
           F       F    +    ++       +            + +G D A+  + GD+   V
Sbjct: 368 FIDDLASVFPLSELQACMVDSWEVWTDFQSLALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 336 LR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              +      E+ R + A   D +   M+     P + +
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|229589112|ref|YP_002871231.1| terminase ATPase subunit [Pseudomonas fluorescens SBW25]
 gi|229360978|emb|CAY47838.1| terminase, ATPase subunit [Pseudomonas fluorescens SBW25]
          Length = 585

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/431 (11%), Positives = 106/431 (24%), Gaps = 39/431 (9%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET----QLKTTLWAEVSKWLSLLP 136
           AI   R IG T   A   L    T     +   A+       +     +A     + L  
Sbjct: 160 AILKSRQIGATYYFAREALIDALTTGRNQIFLSASKNQAHIFKAYIQAFAREVVGVELTG 219

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +       +                       +    +     +  + +     Y     
Sbjct: 220 DPIILGNGAELHFLGTNARTAQGYHGNFYFDEFFWTFKFKELNKVASGMAMQKQYRRTYF 279

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S   +           +       +             +      D   R  +   
Sbjct: 280 STPSSMAHEAYTFWTGERFNKGKPASQRVKIDVSHNA----LQQGRLCEDRVWRQIVTIL 335

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD--- 313
             E       +    R   D++  +  +  QF      S  PL +++  +          
Sbjct: 336 DAEDRGCDLFDLDELRQEYDAEAFQNLLMCQFIDD-GASIFPLAMLQPCMVDSWDLWAQD 394

Query: 314 ---------PYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                        + +G D AE G    +VV+           +     +   D      
Sbjct: 395 YKPFAARPFGDRQVWVGYDPAESGDSAGLVVIAPPMVPGGKFRVLEKHQFRGMDFAAQAE 454

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
            I  + ++Y    I ID    G+     ++    ++                  +T L +
Sbjct: 455 AIRQVTKRYWVTYIGIDITGMGSGVAQLVKQFFPNITAFSYSPE---------VKTRLVL 505

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D ++   L   +    L Q+L +++  I  +  +    + R       D +    + 
Sbjct: 506 KAYDVIKNGRLEFDAGWTDLAQSLMAIRKTITASGRQFTYTAGRTDETGHADLAWATFHA 565

Query: 476 FAENPPRSDMD 486
               P      
Sbjct: 566 LHNEPLEGQTT 576


>gi|300310242|ref|YP_003774334.1| DNA-dependent ATPase terminase subunit [Herbaspirillum seropedicae
           SmR1]
 gi|300073027|gb|ADJ62426.1| DNA-dependent ATPase terminase subunit [Bacteriophage phi CTX]
           related protein [Herbaspirillum seropedicae SmR1]
          Length = 593

 Score =  118 bits (296), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/473 (11%), Positives = 120/473 (25%), Gaps = 52/473 (10%)

Query: 55  QLEFMEVVDA---HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
           Q   +E  +               E  +  + + R IG T   A   L          + 
Sbjct: 140 QQRIIEAFNDSLFDYQKVWFRNGSERTRIILKS-RQIGATWYFAREALIDAIQTGRNQIF 198

Query: 112 CLANSETQ----------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS 161
             A+               K     E+S    +LPN         +   A  Y    +  
Sbjct: 199 LSASKSQAHVFKQYIIQFAKDACGVELSGDPIVLPNGAHLYFLGTNARTAQGYHGNFYFD 258

Query: 162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNAN 221
                  +          +  + +  H  +     +  ++ T    +        +R A 
Sbjct: 259 ------EFFWTHNFTELNKVASGMALHKKWRKTYFSTPSATTHQAYSFWTGEAFNKRRAK 312

Query: 222 RFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
              +      +   +    F      W++         G    F    +  +    D   
Sbjct: 313 GDKVNIDVSHK---RLSSGFTGEDKIWRQIVTIMDAAAGGCDLFDIDELRDFEYSPDQFD 369

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDN 331
             +   F       F   ++    ++     D           + P+ +G D +  G   
Sbjct: 370 NLLMCNFIDDSASVFPLADLQRGMVDSWVDWDDYKPFTARPFGHRPVWIGYDPSLTGDSA 429

Query: 332 TV------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
                   ++      I     W   D       I  +  +Y    I ID    G     
Sbjct: 430 GCSVIAPPLIPGGNFRILERHQWRGKDFAEQAALIKEMCGRYNVQYIGIDTTGMGVGVYP 489

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSL 442
            ++     V  +               +T + +K  + +    L   +    + Q+  ++
Sbjct: 490 LVKQFFPGVTAISYSPE---------VKTRMVLKAQNIIRSGRLQFDAGWTDIAQSFMAI 540

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +  + P+   +  ++ R +     D +  +M+     P           S ++
Sbjct: 541 RKILTPSGRAVTYDAGRSEETGHADLAWSVMHALDYEPFEGTTA-NNTSSMEF 592


>gi|197249763|ref|YP_002147654.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197213466|gb|ACH50863.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 588

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 116/461 (25%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKINRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                +    +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRSKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVLR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R   + I  L ++Y    I ID+   G    + 
Sbjct: 426 CVVMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|312601717|gb|ADQ92391.1| terminase ATPase subunit [Salmonella phage RE-2010]
 gi|321223512|gb|EFX48577.1| Phage terminase, ATPase subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 572

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 55/459 (11%), Positives = 122/459 (26%), Gaps = 42/459 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 116 QIEKLEEVFHASMFDYQRHWFEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 175

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 176 FLSASKAQAHVFKQYIIDFAKEVDVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 235

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 236 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 295

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
           +       +         D   R  +          +  +    R     D  +  +  +
Sbjct: 296 NLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 351

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVV 335
           F       F    +    ++       +            + +G D A+  + GD+   V
Sbjct: 352 FVDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 411

Query: 336 LR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 412 VMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 471

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 472 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 522

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              +      E+ R + A   D +   M+     P + +
Sbjct: 523 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 561


>gi|323190958|gb|EFZ76225.1| terminase, ATPase subunit [Escherichia coli RN587/1]
          Length = 591

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/460 (11%), Positives = 124/460 (26%), Gaps = 57/460 (12%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H  N++      + K      R IG T   A+             + 
Sbjct: 140 DAWAEEHLFEYQKHLRNNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          AEV +   +   + +F +                  +   +     
Sbjct: 195 LSASKAQ-------AEVFRSYIVNIAEQYFGITLTGNPIRLSNGAELRFLSTNKNTAQSY 247

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T             + + 
Sbjct: 248 SGHLYCDEYFWVPNFAKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKQGSK 307

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  I   +   +      +       +    ++     G + +  E +  RY  +    
Sbjct: 308 KRAAIKFPSFNEMRDG-GRLCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NDATF 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGD 330
            +     F       F   + +E     ++     +P         P+  G D A  G  
Sbjct: 364 NMLYMCVFVDSKDSVF-SFSDLEACGVEIDTWQDHNPDAARPFGDRPVWGGFDPARSGDL 422

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           +  V++           +  +  W   + R    +I  L +KY    + +D    G    
Sbjct: 423 SCFVIIAPPMLAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGVF 482

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINH---SGLIQNLK 440
           D ++             R         N + +L +K  D +E   +        +  +  
Sbjct: 483 DNIQ---------HFAMRVAVPIRYDLNTKNKLVLKAVDVVESQRIEWDKNLKEIAASFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           S++     +   +   + R +     +    + +     P
Sbjct: 534 SVRRTTTQSGNAMTFVADRSQDTGHAEAFWAITHGLHNEP 573


>gi|110804738|ref|YP_688258.1| putative bacteriophage protein [Shigella flexneri 5 str. 8401]
 gi|110614286|gb|ABF02953.1| putative bacteriophage protein [Shigella flexneri 5 str. 8401]
          Length = 255

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 66/231 (28%), Gaps = 47/231 (20%)

Query: 295 SFIPLNIIEEALNREPCP--DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTD 352
           + I L+ IE A++       +P     +G D+A+ G D    V R G V+    +W   +
Sbjct: 10  AIIKLSWIEAAVDAHKTLNFEPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKE 69

Query: 353 LRTTNNKISGL-VEKYRPDAIIIDANNTGARTCDYLEMLG----------YHVYRVLGQK 401
                +          R   I+ D+   GA        +             V       
Sbjct: 70  DELLKSCQRTYQAALEREADIVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNA 129

Query: 402 RA------------VDLEFCRNRRTELHVKMAD-------WLEFASLINHSGLIQ----- 437
            A             + +F  N + +    +AD        +          LI      
Sbjct: 130 GAGVHEPDDEYNGIPNKDFFANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRC 189

Query: 438 -------NLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAE 478
                     +         G + +ESK+    +   S + +D  +  FA 
Sbjct: 190 PLLEKLKLELTTPHRDFDRNGRVMVESKKDLAKREIPSPNVADAFIMAFAP 240


>gi|218704209|ref|YP_002411728.1| putative Terminase, ATPase subunit from bacteriophage origin
           [Escherichia coli UMN026]
 gi|218431306|emb|CAR12184.1| Putative Terminase, ATPase subunit from bacteriophage origin
           [Escherichia coli UMN026]
          Length = 591

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/455 (10%), Positives = 123/455 (27%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWADEHLFEYQKHLRRNIGQQVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T             + +  R   
Sbjct: 253 CDEYFWVPNFARLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKQGSKKRAAA 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
              +   +      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 RFPSFDEMRNG-GRLCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDSKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 LR------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  + +W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 IAPPMYAAEKFRVLKVINWKGMNFRYQARQIELLFKKYNFTYLGVDVTGIGQGVFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  +++  
Sbjct: 487 --------HFAMRVAVAIRYDMNTKNQLVLKAADVVESQRIEWDKNLKEIPASFMAVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|326783087|ref|YP_004323484.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
 gi|310005505|gb|ADO99893.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM2]
          Length = 560

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 62/441 (14%), Positives = 121/441 (27%), Gaps = 60/441 (13%)

Query: 23  EIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAI 82
           + K     F +++         +  F     +Q E +E    H  N    P         
Sbjct: 31  KCKEDPVYFAMNYIKIISLDEGIVPFKMWD-FQQELIESFHEHRFNIAKLP--------- 80

Query: 83  SAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFE 142
              R  GK+T     +L  +     ++V  LAN  +  +  L + +      LP      
Sbjct: 81  ---RQTGKSTTCVSYLLHYILFNDNVNVGILANKLSTARDLL-SRLQLAYEQLPLWIQQG 136

Query: 143 MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG 202
           +   +       +     +                     +           I  DE + 
Sbjct: 137 IVVYNKGSMELENGSKILA------------------ASTSASAVRGMSFNIIFLDEFAF 178

Query: 203 TP----DVINLGILGFLTERN-ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
            P    +     +   +T         I T N      K +    K  + +   ++    
Sbjct: 179 IPNHIAEQFFSSVYPTITSGTSTKVIIISTPNGMNHFYKLWVDAQKGRNGYAWNEVHWSK 238

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNRE-------- 309
           V G D  + E  IA           E   +F     D+ I  + +      +        
Sbjct: 239 VPGRDAKWKEQTIANTSE--RQFTQEFDCEFLGSV-DTLITASKLRVLTYDDVMTTNGSL 295

Query: 310 ---PCPDPYAPLIMGCDIAEE-GGDNTVVVLRRGPVIEHLFDWSKTD----LRTTNNKIS 361
                P      I+  D++     D +  V+               D         N I 
Sbjct: 296 DIYEKPIDKHEYIITVDVSRGLAQDYSAFVVIDITHAPWRLVAKYRDKDVRPMLFPNIIF 355

Query: 362 GLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
            +   Y    ++ + N+ G          LE     +  + G+   +  +     +T++ 
Sbjct: 356 NVATNYNKAYVLTEVNDIGEAVAGSLFYDLEYENTLMCAMRGRAGQIVGQGFSGNKTQMG 415

Query: 418 VKMADWLEFASLINHSGLIQN 438
           VKM+  ++     N   LI++
Sbjct: 416 VKMSKTVKAQGCSNLKTLIED 436


>gi|330503113|ref|YP_004379982.1| phage P2 terminase ATPase subunit, gpP-like protein [Pseudomonas
           mendocina NK-01]
 gi|328917399|gb|AEB58230.1| phage P2 terminase ATPase subunit, gpP-like protein [Pseudomonas
           mendocina NK-01]
          Length = 585

 Score =  118 bits (295), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 61/428 (14%), Positives = 115/428 (26%), Gaps = 37/428 (8%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE--TQLKTTLWAEVSKWL--SLLPN 137
           I   R IG T   A   L    T     +   A+     Q KT + A +++ L   L  +
Sbjct: 163 ILKSRQIGATFYFAREALIDAITTGRNQIFLSASKAQAHQFKTYMQAFLNETLGVKLTGD 222

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +        +      S       +  +       +  + +  H  +     +
Sbjct: 223 PIVLWNNAELHFLGTNFRTAQGRSGNFYFDEFFWVHGFAEINKVASGMALHKRWRKTYFS 282

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
             +S             L +       I             ++     D   R  +    
Sbjct: 283 TPSSMAHPAYVYWTGERLNKGRPTAQHIKQDVSHDA----LQMGRLCDDKVWRQIVTILD 338

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
            E       +    R   D       +  QF     DS  PL +++  +        + P
Sbjct: 339 AEARGCDLFDLDELRLEYDGPAFDNLLMCQFVDD-GDSIFPLTMLQPCMVESWDWPDFKP 397

Query: 318 ----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKIS 361
                     + +G D AE G    ++VL           +   F +   D      KI 
Sbjct: 398 FAARPFGDRQVWLGYDPAENGDSAGLMVLAPPTEPGGKFRVLDRFQFRGMDFEAQAEKIR 457

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
            L + Y    I ID    G      +     ++                  +T+L +K  
Sbjct: 458 QLTQIYWVTYIGIDTTGMGTGVAQLVRQFFPNLRTFSYSPE---------VKTQLVMKAW 508

Query: 422 DWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
           D +    L   +    + Q+L +++  + P+       + R +     D +  L +    
Sbjct: 509 DVVRKGRLEFDAGATDIAQSLMAIRKTMTPSGKSFTYTAGRSEATGHADLAWALFHALFN 568

Query: 479 NPPRSDMD 486
            P      
Sbjct: 569 EPLEGRTS 576


>gi|186895208|ref|YP_001872320.1| hypothetical protein YPTS_1896 [Yersinia pseudotuberculosis PB1/+]
 gi|186698234|gb|ACC88863.1| protein of unknown function DUF264 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 587

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/447 (12%), Positives = 107/447 (23%), Gaps = 39/447 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E M     +   +  +P+  +        R +G T   +W  L          +   A+ 
Sbjct: 142 ESMFDYQRNWYEAGLSPDYRIRNL--LKSRQVGATYFFSWEALLDALDTGRNQMFVSASK 199

Query: 117 E--TQLKTTLWAEVSKW-LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
               Q K  + A   +  + L          +         S        +    Y  + 
Sbjct: 200 AQAHQFKNYIVAAARQVDVDLRGEVIILPNGAEMHFLGTNASTAQGRPGNLYLDEYFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 R  + +     Y     +  +S + +           +  A    I       +
Sbjct: 260 GFQKLRRAASGMASQKKYRSTYFSTPSSTSHEAYPFWAGTLFNKGKAKDKRIEI----DV 315

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQD 292
           S           D   R  +               I      +SD          F   +
Sbjct: 316 SYPRLAGGRLCEDKQYRQIVTIEDALKGGCDLF-DIDELRNENSDQDFENLFMCGFIDDN 374

Query: 293 IDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTV------VVL 336
             +F    +    ++                   P+ +G D A  G           VV 
Sbjct: 375 ASTFKLAEMQRCMVDSWEKWTDVKLLALRPFGDRPVWIGYDPASTGDSAGCAVIAPPVVA 434

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D     + I  + E+Y    I ID    G      +      V  
Sbjct: 435 GGKFRVLERHQWKGMDFADQASNIKKITERYNVTYIGIDDTGLGRSVTQLVRQFFPAVNA 494

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
           +               + +L  K  + ++   L   +    +     S++  +       
Sbjct: 495 IHYS---------LEMKADLIYKAKNIIQGGRLEFDAGCIDIATAFMSIRKTMTATGRNA 545

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENP 480
              + R +G    D +  +M+     P
Sbjct: 546 TFVTSRSEGVSHGDVAWAIMHALFHEP 572


>gi|168752369|ref|ZP_02777391.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756331|ref|ZP_02781338.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4401]
 gi|168770046|ref|ZP_02795053.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4486]
 gi|168775976|ref|ZP_02800983.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4196]
 gi|168782400|ref|ZP_02807407.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4076]
 gi|168799001|ref|ZP_02824008.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC508]
 gi|195938306|ref|ZP_03083688.1| Phage protein P [Escherichia coli O157:H7 str. EC4024]
 gi|208807993|ref|ZP_03250330.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814612|ref|ZP_03255941.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819940|ref|ZP_03260260.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400321|ref|YP_002271352.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4115]
 gi|254793895|ref|YP_003078732.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           TW14359]
 gi|187768594|gb|EDU32438.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4196]
 gi|188013771|gb|EDU51893.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000116|gb|EDU69102.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356443|gb|EDU74862.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360957|gb|EDU79376.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4486]
 gi|189378450|gb|EDU96866.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC508]
 gi|208727794|gb|EDZ77395.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735889|gb|EDZ84576.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740063|gb|EDZ87745.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161721|gb|ACI39154.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           EC4115]
 gi|254593295|gb|ACT72656.1| phage large terminase subunit GpP [Escherichia coli O157:H7 str.
           TW14359]
 gi|326344901|gb|EGD68646.1| Phage terminase, ATPase subunit [Escherichia coli O157:H7 str.
           1125]
          Length = 590

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 114/453 (25%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWF-------EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNSAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFLLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|322833247|ref|YP_004213274.1| hypothetical protein Rahaq_2540 [Rahnella sp. Y9602]
 gi|321168448|gb|ADW74147.1| hypothetical protein Rahaq_2540 [Rahnella sp. Y9602]
          Length = 595

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/459 (11%), Positives = 124/459 (27%), Gaps = 55/459 (11%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            ++  E +     H  N++      + K      R IG T   A              + 
Sbjct: 144 DAFAEEHLFGYQKHLRNNLAQQIRNILK-----SRQIGATWYFAIEAFENAVMTGDPQIF 198

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          AEV +   +   + +F +                  +   +     
Sbjct: 199 LSASKAQ-------AEVFRSYIVNIAEQYFGITLTGNPIRLSNGAELRFLSTNKNTAQSY 251

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T             + + 
Sbjct: 252 SGHLYCDEYFWVPNFAKLNEVASAMATHDHWRTTYFSTPSAKTHQAYPFWTGEEWKQGDK 311

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R   +      +      +       +    ++     G + +  + +  RY  D+   
Sbjct: 312 ERQTAVFPTFDEMRDG-GRLCPDGQWRY-VITMEDAVKGGFNRASIDKLRNRYNRDT--F 367

Query: 281 RVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +     F       F   ++    ++ A  ++  P+   P     +  G D A  G  +
Sbjct: 368 NMLYMCVFVDSKDSVFKFSDLEICGVDVADWQDHDPNAERPFGNREVWGGFDPARSGDTS 427

Query: 332 T------VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T       +       +  LF W   +      +I  L  KY    I +D    G    +
Sbjct: 428 TFAIVAPPLYAVEKFRVLCLFHWKGMNFAYQAAQIKKLFGKYNMTYIGVDVTGIGRGVFE 487

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLI---NHSGLIQNLKS 441
            +E             R           +T L +KM D +    L    ++  +  +  S
Sbjct: 488 LIE---------HFALREAVAIHYGMETKTRLVLKMIDVIGAKRLEWNKDNREIAASFLS 538

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ++     +   +  ++ R       D    + +     P
Sbjct: 539 IRHTSTASGNAMTFKADRTVETGHADAFWAIAHAVINEP 577


>gi|238920149|ref|YP_002933664.1| hypothetical protein NT01EI_2255 [Edwardsiella ictaluri 93-146]
 gi|238869718|gb|ACR69429.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 601

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 58/449 (12%), Positives = 122/449 (27%), Gaps = 49/449 (10%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +     H  ++       + K      R IG T   A+             +   A S  
Sbjct: 153 LFKYQLHLRDNKFRRVRNLLK-----ARQIGATYYFAFEAFEDAVLTGDNQIFLSA-SRR 206

Query: 119 QLK-------TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
           Q +            E    L   P +      +     A   +     S  +    Y  
Sbjct: 207 QAEVFRTYILKIAQVEFGIQLKGNPIR--LSNMAELHFLATNSNTAQSNSGHLYIDEYLW 264

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +  +     + +   + + +   +  ++                 NA R  ++     
Sbjct: 265 ISKFTTFNEVASGMATQSHWRLTYFSTPSAKNHQGYAFWSGDEWRRGNAERKSVVFPAFD 324

Query: 232 RLSGKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
            L     E    P   W+    ++    +G + +  E +  RYG   +         F  
Sbjct: 325 ELRDGGREC---PDKQWRYVVTMEDAIADGFNRADIEELRERYGE--NAFNRLYMCVFVD 379

Query: 291 QDIDSFIPLNIIEEA----LNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL----- 336
                F    ++       + ++  PD  AP     +  G D A  G + T VV+     
Sbjct: 380 DKDSVFDFAKLVRCGVDPHIWQDFHPDEAAPLGNREVWGGFDPARSGDNATFVVIAVPLL 439

Query: 337 -RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 +     W     +   ++I  +  +Y    I ID    G    + ++       
Sbjct: 440 AVERFRVLEKHHWRGLSFQWMADQIRTIKSRYNMTHIGIDVTGIGYGVYELVQG------ 493

Query: 396 RVLGQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
                +R           +  L +KM D ++   +        +  +  ++K     +  
Sbjct: 494 ---FARREAKAIHYSVESKNRLVLKMLDVIDSNRIEWDEDARDIPASFLAIKQSATASGN 550

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENP 480
            +   + R       D    + +  A  P
Sbjct: 551 AVTFTADRTDETGHADIFFAIAHALANEP 579


>gi|238786939|ref|ZP_04630739.1| Terminase, ATPase subunit [Yersinia frederiksenii ATCC 33641]
 gi|238724727|gb|EEQ16367.1| Terminase, ATPase subunit [Yersinia frederiksenii ATCC 33641]
          Length = 587

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/447 (12%), Positives = 107/447 (23%), Gaps = 39/447 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E M     +   +  +P+  +        R IG T   +W  L          +   A+ 
Sbjct: 142 ESMFGYQRNWYEAGLSPDFRIRNL--LKSRQIGATYFFSWEALLDALDTGRNQMFVSASK 199

Query: 117 E--TQLKTTLWAEVSKW-LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
               Q K  + A   +  + L          +         S        +    Y  + 
Sbjct: 200 AQAHQFKNYIVAAARQVDVDLRGEVIILPNGAEMHFLGTNASTAQGRPGNLYLDEYFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 R  + +     Y     +  +S + +           +  A    I       +
Sbjct: 260 GFQKLRRAASGMASQKRYRSTYFSTPSSTSHEAYPFWAGTLFNKGKAKDKRIEI----DV 315

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQD 292
           S           D   R  +               I      +SD          F   +
Sbjct: 316 SYPRLAAGRLCEDKQYRQIVTIEDALKGGCDLF-DIDELRNENSDEDFENLFMCGFIDDN 374

Query: 293 IDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTV------VVL 336
             +F    +    ++                   P+ +G D A  G           VV 
Sbjct: 375 ASTFKLAEMQRCMVDSWEKWSDVKLLALRPFGDRPVWIGYDPASTGDSAGCAVIAPPVVA 434

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D     + I  + E+Y    I ID    G      +      V  
Sbjct: 435 GGKFRVLERHQWKGMDFADQASNIKKITERYNVTYIGIDDTGLGRSVTQLVRQFFPAVNA 494

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
           +               + +L  K  + ++   L   +    +     S++  +  +    
Sbjct: 495 IHYS---------LEMKADLIYKAKNIIQGGRLEFDAGCIDIATAFMSIRKTMTASGRNA 545

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENP 480
              + R K     D +  +M+     P
Sbjct: 546 TFVTDRSKDVSHGDVAWAIMHALFHEP 572


>gi|16763092|ref|NP_458709.1| terminase subunit [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|25315565|pir||AH1037 probable terminase chain [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16505400|emb|CAD06749.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Typhi]
          Length = 588

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/461 (11%), Positives = 118/461 (25%), Gaps = 42/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKINRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE-EGGDNTVVVL 336
           F       F    +    ++       +            + +G D A+     ++   +
Sbjct: 368 FIDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 337 RR--------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
                        I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VIAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
              +      E+ R + A   D +   M+     P + +  
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGEAA 579


>gi|197251462|ref|YP_002147591.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197215165|gb|ACH52562.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|312913681|dbj|BAJ37655.1| hypothetical protein STMDT12_C27120 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
          Length = 594

 Score =  118 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/454 (11%), Positives = 119/454 (26%), Gaps = 45/454 (9%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             + LE +     H  ++++     + K      R IG T   +              + 
Sbjct: 143 DRFALEHLFGYQKHLRDNLHQQIRNILK-----SRQIGATWYFSIEAFENAVMTGDPQIF 197

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 198 LSASKAQAEVFRSYIVNIAEQYFGVELTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 255

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  +S T               +  R  +
Sbjct: 256 CDEYFWVPNFAKLNEVASAMATHDKWRTTYFSTPSSKTHQAYPFWTGEEWKRGDKKRARV 315

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                + L      +       +    ++     G + +  + +  RY  D+    +   
Sbjct: 316 AFPTEKELRDG-GRLCPDGQWRYI-ITLEDAIAGGFNLASIDKLRNRYNRDT--FNMLYM 371

Query: 286 GQFPQQDIDSF---------IPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNT---- 332
             F       F         +  +I E+     P P     +  G D A  G  +T    
Sbjct: 372 CVFVDSKDSVFSFSHVERCCVDPDIWEDHDENLPRPFGNREVWAGYDPARSGDTSTFVII 431

Query: 333 --VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
              +V      +  +F W   + +    +I  L  +Y    I ID    G+   + ++  
Sbjct: 432 APPIVAGEKFRVLRVFHWQGMNWKWQAAQIKKLFGQYNMTYIGIDITGLGSGVFEDVQ-- 489

Query: 391 GYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFI 446
                      R           +  L +KM D +E   +        +  +  +++   
Sbjct: 490 -------HFAMRQAVAIRYGVETKNRLVMKMIDVIEDNRVEWDKEKTEIAASFMTIRRTS 542

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
             +   +   + R       D    + +     P
Sbjct: 543 TASGNAMTFVADRTAETGHADSFWAIAHAIDNEP 576


>gi|170769222|ref|ZP_02903675.1| phage large terminase subunit GpP [Escherichia albertii TW07627]
 gi|170121874|gb|EDS90805.1| phage large terminase subunit GpP [Escherichia albertii TW07627]
          Length = 590

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/453 (12%), Positives = 113/453 (24%), Gaps = 45/453 (9%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 147 DYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 201

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 202 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 260 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 319

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 320 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 376

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 377 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 436

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 437 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 487

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +        
Sbjct: 488 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSIGRSAT 547

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
            E+ R + A   D +   M+     P  + +  
Sbjct: 548 YEASRSEEASHADLAWATMHALLNEPLTAGIST 580


>gi|51596194|ref|YP_070385.1| gpP phage P2 terminase [Yersinia pseudotuberculosis IP 32953]
 gi|170024552|ref|YP_001721057.1| hypothetical protein YPK_2327 [Yersinia pseudotuberculosis YPIII]
 gi|51589476|emb|CAH21098.1| similar to gpP phage P2 TERMINASE [Yersinia pseudotuberculosis IP
           32953]
 gi|169751086|gb|ACA68604.1| protein of unknown function DUF264 [Yersinia pseudotuberculosis
           YPIII]
          Length = 587

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 54/447 (12%), Positives = 106/447 (23%), Gaps = 39/447 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E M     +   +  +P+  +        R +G T   +W  L          +   A+ 
Sbjct: 142 ESMFDYQRNWYEAGLSPDFRIRNF--LKSRQVGATYFFSWEALLDALDTGRNQMFVSASK 199

Query: 117 E--TQLKTTLWAEVSKW-LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
               Q K  + A   +  + L          +         S        +    Y  + 
Sbjct: 200 AQAHQFKNYIVAAARQVDVDLRGEVIILPNGAEMHFLGTNASTAQGRPGNLYLDEYFWIP 259

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 R  + +     Y     +  +S + +           +  A    I       +
Sbjct: 260 GFQKLRRAASGMASQKRYRSTYFSTPSSTSHEAYPFWAGTLFNKGKAKDKRIEI----DV 315

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQD 292
           S           D   R  +               I      +SD          F   +
Sbjct: 316 SYPRLAGGRLCEDKQYRQIVTIEDALKGGCDLF-DIDELRNENSDQDFENLFMCGFIDDN 374

Query: 293 IDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTV------VVL 336
             +F    +    ++                   P+ +G D A  G           VV 
Sbjct: 375 ASTFKLAEMQRCMVDSWEKWTDVKLLALRPFGDRPVWIGYDPASTGDSAGCAVIAPPVVA 434

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D     + I  + E+Y    I ID    G      +      V  
Sbjct: 435 GGKFRVLERHQWKGMDFADQASNIKKITERYNVTYIGIDDTGLGRSVTQLVRQFFPAVNA 494

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
           +               + +L  K  + +    L   +    +     S++  +       
Sbjct: 495 IHYS---------LEMKADLIYKAKNIIHGGRLEFDAGCIDIATAFMSIRKTMTATGRNA 545

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENP 480
              + R +G    D +  +M+     P
Sbjct: 546 TFVTSRSEGVSHGDVAWAIMHALFHEP 572


>gi|168822445|ref|ZP_02834445.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205341120|gb|EDZ27884.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 594

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 54/459 (11%), Positives = 123/459 (26%), Gaps = 55/459 (11%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             + LE +     H  ++++     + K      R IG T   +              + 
Sbjct: 143 DRFALEHLFGYQKHLRDNLHQQIRNILK-----SRQIGATWYFSIEAFENAVMTGDPQIF 197

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A+          AEV +   +   + +F ++                 +   +     
Sbjct: 198 LSASKAQ-------AEVFRSYIVNIAEQYFGVELTGNTIRLSNGAELRFLSTNKNTAQSY 250

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  +S T               + 
Sbjct: 251 SGHLYCDEYFWVPNFAKLNEVASAMATHDKWRTTYFSTPSSKTHQAYPFWTGEEWKRGDK 310

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  +     + L      +       +    ++     G + +  + +  RY  D+   
Sbjct: 311 KRARVAFPTEKELRDG-GRLCPDGQWRYI-ITLEDAIAGGFNLASIDKLRNRYNRDT--F 366

Query: 281 RVEVCGQFPQQDIDSF---------IPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDN 331
            +     F       F         +  +I E+     P P     +  G D A  G  +
Sbjct: 367 NMLYMCVFVDSKDSVFSFSHVERCCVDPDIWEDHDENLPRPFGNREVWAGYDPARSGDTS 426

Query: 332 T------VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T       +V      +  +F W   + +    +I  L  +Y    I ID    G+   +
Sbjct: 427 TFVIIAPPIVAGEKFRVLRVFHWQGMNWKWQAAQIKKLFGQYNMTYIGIDITGLGSGVFE 486

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSG---LIQNLKS 441
            ++             R           +  L +KM D +E   +        +  +  +
Sbjct: 487 DVQ---------HFAMRQAVAIRYGVETKNRLVMKMIDVIEDNRVEWDKEKTEIAASFMT 537

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ++     +   +   + R       D    + +     P
Sbjct: 538 IRRTSTASGNAMTFVADRTAETGHADSFWAIAHAIDNEP 576


>gi|262273310|ref|ZP_06051125.1| terminase [Grimontia hollisae CIP 101886]
 gi|262222683|gb|EEY73993.1| terminase [Grimontia hollisae CIP 101886]
          Length = 594

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/453 (11%), Positives = 109/453 (24%), Gaps = 41/453 (9%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
                  N       I   R IG T   A   L          V   A S  Q       
Sbjct: 155 YQLTMRENRHQRIRNILKSRQIGATYYFACEALEGAVLTGDNQVFLSA-SRAQA-EIFRT 212

Query: 127 EVSKW------LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180
            +         + L  N       +     +            +    Y  + +     +
Sbjct: 213 YIINIAREFLGIELSGNPIILSNGAELRFCSTNSKTAQGFHGHVYVDEYFWIPKFDELNK 272

Query: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240
             + +  H T+     +  +S T                  R  +               
Sbjct: 273 LASAMATHKTWRKTYFSTPSSKTHQAYPFWTGDTWRGNANTREHVEFPTFEDFRN--GGA 330

Query: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300
                       ++     G D    + +   Y  +           F   +   F    
Sbjct: 331 LCPDKHWRYVVTLEDAAAGGCDLFDIDELRDEYSKND--FANLFMCVFVDGNASVFTFSK 388

Query: 301 I----IEEALNREPCPDPYAPL-----IMGCDIAEEGGDNTVVVLR------RGPVIEHL 345
           +    ++ +  ++  PD   P       +G D +    +  +VV+           +   
Sbjct: 389 LEKCMVDASKWKDFKPDAARPYANQEVWLGYDPSRTRDNACLVVIAPPQTHAEVFRVLEK 448

Query: 346 FDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVD 405
             W   + +   ++I     +Y    I ID    G    D +              R   
Sbjct: 449 HYWKGLNFQYQASQIDEAFHRYHVTYIGIDTTGVGYGVWDLVSAA---------HPREAV 499

Query: 406 LEFCRNR-RTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELAIESKRVK 461
                N  +  L +KM D ++   L   +    +     ++K     +   +  +++R  
Sbjct: 500 AIHYSNENKNRLVLKMIDVIDAGRLQYDAEHKDIAMAFMAIKRVASNSGNMMTFKAERSD 559

Query: 462 GAKSTDYSDGLMYTFA-ENPPRSDMDFGRCPSY 493
                D    + +    E    +D   G   ++
Sbjct: 560 TTGHADAFWAIAHALINEPLNTADAQRGSSYTF 592


>gi|34335039|gb|AAQ65014.1| unknown [synthetic construct]
 gi|301159280|emb|CBW18795.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|323131065|gb|ADX18495.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 588

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/459 (11%), Positives = 121/459 (26%), Gaps = 42/459 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVV 335
           F       F    +    ++       +            + +G D A+  + GD+   V
Sbjct: 368 FVDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 336 LR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              +      E+ R + A   D +   M+     P + +
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|168262802|ref|ZP_02684775.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205348497|gb|EDZ35128.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 591

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 52/455 (11%), Positives = 121/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DTWAEEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T               +  R  I
Sbjct: 253 CDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKRGSKKRTAI 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                  L      +       +    ++     G + +  + +  RY  ++    +   
Sbjct: 313 KFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIDKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDSKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  +  W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 VAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGIFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  S++  
Sbjct: 487 --------HFAMRVAVAIRYDLNTKNKLVLKAADVVESQRIEWDKNLKEIPASFMSVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|226945807|ref|YP_002800880.1| phage P2 terminase ATPase subunit, gpP-like protein [Azotobacter
           vinelandii DJ]
 gi|226720734|gb|ACO79905.1| Phage P2 terminase ATPase subunit, gpP-like protein [Azotobacter
           vinelandii DJ]
          Length = 585

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 50/426 (11%), Positives = 103/426 (24%), Gaps = 37/426 (8%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSE--TQLKTTLWAEVSKWL-SLLPNKHWF 141
            R IG T   A   L          +   A+     Q K  + A + + L   L      
Sbjct: 164 SRQIGATYYFAREALIDALLTGRNQIFLSASKAQAHQFKNYMQAFIQEVLGRQLTGDPIV 223

Query: 142 EMQSLSL-HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
                 L      Y      S       +  +       +  + +  H  +     +  +
Sbjct: 224 LWNGAELHFLGTNYRTAQGRSGNFYFDEFFWVHGFDELNKVASGMALHKKWRKTYFSTPS 283

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           S             L E       +              +     D   R  +     E 
Sbjct: 284 SKGHPAYRWWTGERLNEGKPTAQHLTLDVGHDA----LAMGRLSEDKIWRQIVTILDAER 339

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFI-----------PLNIIEEALNRE 309
                 +    R+  +++     +  +F       F             +   E+     
Sbjct: 340 RGCDLFDLEELRFEYNAEQFANLLMCEFVDDGASIFPLAMLQPCQVDSWVEWAEDFKPFA 399

Query: 310 PCPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGL 363
             P     + +G D AE G    +VV+           +     +   D       I  +
Sbjct: 400 ARPFGDRQVWVGYDPAETGDSAGLVVVAPPLVPGGKFRVLERHQFRGMDFAAQAEFIRQV 459

Query: 364 VEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
             +Y    I +D    G      +     ++                  +  L +K  D 
Sbjct: 460 TRRYWVTYIGLDTTGMGTGVAQLVRSFFPNLTTFSYSPE---------VKARLVMKAWDV 510

Query: 424 LEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           +    L   +    L  ++ +++  +  +  ++   + R       D +  LM+     P
Sbjct: 511 VHNGRLEYDAGWTDLTSSMMAIRKTMTASGRQMTYVAGRTDATGHADLAWALMHALHNEP 570

Query: 481 PRSDMD 486
                 
Sbjct: 571 LEGQTA 576


>gi|330830158|ref|YP_004393110.1| phage-related terminase [Aeromonas veronii B565]
 gi|328805294|gb|AEB50493.1| Phage-related terminase [Aeromonas veronii B565]
          Length = 588

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 63/480 (13%), Positives = 117/480 (24%), Gaps = 45/480 (9%)

Query: 39  GEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAIS---AGRGIGKTTLNA 95
           G K  P      P   Q   +E  ++   +          +  I      R IG T   A
Sbjct: 119 GPKKAPDRNVVEPEQ-QERLIERFESTMFDYQRVWYQAGQEYRIRDLLKSRQIGATYFFA 177

Query: 96  WLVLWLMSTRPGISVICLANSE--TQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAP- 152
           +             +   A+       K  +     +    L            L+    
Sbjct: 178 FEAFIDALVTGRNQIFLSASKAQAHMFKQYIIQFAKEEGVELKGDPMVLPNGAHLYFLGT 237

Query: 153 WYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGIL 212
                      I    Y  +       +  + +  H  +    I+  +S +         
Sbjct: 238 NARTAQSYHGNIYMDEYFWIHGFLEFRKVASGMAMHKKWRQTYISTPSSLSHPAYGFWSG 297

Query: 213 GFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSF-HEGIIA 271
                  A    +                      W++       V G    F  + + +
Sbjct: 298 ANFNRGKAKADRVEIDLSHANLSAGKLCA---DGQWRQIVTVEDAVRGGCNLFDLDQLRS 354

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMG 321
            Y  D    R  +  +F       F    +    ++     + Y P          + +G
Sbjct: 355 EYSEDE--YRNLLMCEFMDDTESLFPLATLQRCMVDSWLVWEDYKPHTLRPLANRAVWIG 412

Query: 322 CDIAEEGGDNTV--------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAII 373
            D A+ G  ++         +V      +     W   D       I  + ++Y    I 
Sbjct: 413 YDPAKGGKGDSAGCAVLAPPLVPGGKFRVLERHRWQGMDFDAQAKSIRAICDRYNVAYIG 472

Query: 374 IDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS 433
           ID    G      ++     V  +             N +  + +K  D +    L   S
Sbjct: 473 IDTTGIGEGVYQLVKQFYPAVTAIQYNP---------NVKMRMVMKAQDVMNKGRLEFDS 523

Query: 434 ---GLIQNLKSLKSFIVPNTGEL-AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
               L Q   S++   V  +G+L   E+ R       D +   M      P         
Sbjct: 524 GWTDLAQAFMSIRR-AVTQSGKLPTFEASRSDETSHADIAWATMQALLHEPLEGQTGTNS 582


>gi|16766035|ref|NP_461650.1| terminase-like protein [Enterobacteria phage Fels-2]
 gi|169936048|ref|YP_001718747.1| P2 gpP-like protein [Enterobacteria phage Fels-2]
 gi|16421269|gb|AAL21609.1| Fels-2 prophage protein [Enterobacteria phage Fels-2]
 gi|312913743|dbj|BAJ37717.1| terminase-like protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
          Length = 588

 Score =  117 bits (293), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/459 (11%), Positives = 121/459 (26%), Gaps = 42/459 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVDVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVV 335
           F       F    +    ++       +            + +G D A+  + GD+   V
Sbjct: 368 FIDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 336 LR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              +      E+ R + A   D +   M+     P + +
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|200387487|ref|ZP_03214099.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199604585|gb|EDZ03130.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 588

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/459 (11%), Positives = 121/459 (26%), Gaps = 42/459 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTVVV 335
           F       F    +    ++       +            + +G D A+  + GD+   V
Sbjct: 368 FVDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 336 LR-------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VMAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 AFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
              +      E+ R + A   D +   M+     P + +
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|262042498|ref|ZP_06015656.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040136|gb|EEW41249.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 587

 Score =  117 bits (292), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/453 (10%), Positives = 111/453 (24%), Gaps = 42/453 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           M     H   +            +   R IG T   A   L          +   A+  +
Sbjct: 143 MFEYQRHWWEAGIKHRIRN----VLKSRQIGATYYFAREALMDALMTGRNQIFLSASKAQ 198

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQ--SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRT 175
             +      E +K + +        +   +                  +    Y  + + 
Sbjct: 199 AHVFKQYIIEFAKEVDVELKGDPMVLPNGATLYFLGTNARTAQSYHGNLYLDEYFWIPKF 258

Query: 176 YSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSG 235
               +  + +  H  +     +  +S T                A    +          
Sbjct: 259 QELRKVASGMALHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADRVDIDLTHSALA 318

Query: 236 KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDS 295
                     D   R  +          +  +    R     D  +  +  +F       
Sbjct: 319 AGLLCA----DGQFRQIVTVEDAVRGGCNLFDLDQLRLEYSPDEYQNLLMCEFIDDLASV 374

Query: 296 FIPLNIIEEALNREPCPDPY----------APLIMGCDIAE-EGGDNTVVVLRR------ 338
           F   ++    ++     + +            + +G D A+     ++   +        
Sbjct: 375 FPLADLQACMVDSWEVWEDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCVVIAPPTVP 434

Query: 339 --GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                I     W   D R     I  L ++Y    I ID+   G    + ++     V  
Sbjct: 435 GGKFRILERHQWRGMDFRAQAEAIRKLTQQYNVTYIGIDSTGVGHGVYENVKGFFPAVRE 494

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
            +            N +  L +K  D +    L   +    + ++  +++     +    
Sbjct: 495 FVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIARSFMAIRRATTASGNRP 545

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
             E+ R + A   D +   M+     P + +  
Sbjct: 546 TYEASRSEEASHADLAWATMHALFNEPLQGEAA 578


>gi|322832199|ref|YP_004212226.1| terminase, ATPase subunit [Rahnella sp. Y9602]
 gi|321167400|gb|ADW73099.1| terminase, ATPase subunit [Rahnella sp. Y9602]
          Length = 588

 Score =  117 bits (292), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/437 (10%), Positives = 109/437 (24%), Gaps = 42/437 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   A   L          +   A S+TQ    ++ E     + L      
Sbjct: 163 ILKSRQIGATFFFAREALLRALATGHNQIFLSA-SKTQAY--VFREYIIQFARLAGVELT 219

Query: 142 EMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                     +  +      +     +  +       +       +  + +         
Sbjct: 220 GDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIPNFQKLRKVASGMASQEHLRTT 279

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
             +  ++ T         G L  +                        +     +   I+
Sbjct: 280 YFSTPSALTHGAYPFW-SGELFNKGRENPNDRIELDIGHHSLAKGRLCEDGQWRQIVTIE 338

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
                G +    + +      +    R     +F       F    +    +        
Sbjct: 339 DALAGGCNLFNIDTLKQENSAED--FRNLFMCEFVDDQTSVFPFAELQRCMVESAEEWQD 396

Query: 315 YAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
           ++P          + +G D +  G      V+           +     W   D      
Sbjct: 397 FSPFAVRPFGYRAVWIGYDPSHTGDSAGCAVVAPPLVDGGKFRVLERHQWKGMDFAAQAK 456

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
            I  L ++Y  + I +DA   G      +         +               +T++ +
Sbjct: 457 SIEELTKRYCVEYIGVDATGIGQGVFQLVRQFFPAAMEIRYSPET---------KTKMVL 507

Query: 419 KMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L        +  +  +++  +  +      E+ R + A   D +  +M+ 
Sbjct: 508 KAKDTITSGRLEYDTNHKDITSSFMAIRKTMTASGSRSTYEASRSEEASHADVAWAIMHA 567

Query: 476 FAENPPRSDMDFGRCPS 492
               P  +  + G+ P+
Sbjct: 568 LLNEPLTAA-NGGQSPN 583


>gi|224582696|ref|YP_002636494.1| hypothetical protein SPC_0883 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224467223|gb|ACN45053.1| putative phage protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 591

 Score =  116 bits (291), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/455 (11%), Positives = 121/455 (26%), Gaps = 47/455 (10%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 140 DAWADEHLFEYQKHLRRNIGQLVRNILK-----SRQIGATWYFAFEAFENAVMTGDPQIF 194

Query: 112 CLANSETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
             A+          +           L+  P +     +      +   +     S  + 
Sbjct: 195 LSASKVQAEYFRSYIVNIAEQYFGITLTGNPIRLSNGAELR--FLSTNKNTAQSYSGHLY 252

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  +          + +  H+ +     +  ++ T               +  R  I
Sbjct: 253 CDEYFWVPNFTKLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGDEWKRGSKKRTAI 312

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                  L      +       +    ++     G + +  E +  RY  ++    +   
Sbjct: 313 KFPTFDELRDG-GRVCPDGQWRY-VITMEDAIAGGFNLANIEKLRNRY--NTATFNMLYM 368

Query: 286 GQFPQQDIDSFIPLNIIEEA---LNREPCPDPY-------APLIMGCDIAEEGGDNTVVV 335
             F       F   + +E     ++     +P         P+  G D A  G  +  V+
Sbjct: 369 CVFVDSKDSVF-SFSDLEACGVEVDTWQDHNPDAARPFGDRPVWGGFDPARSGDLSCFVI 427

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +  +  W   + R    +I  L +KY    + +D    G    D ++ 
Sbjct: 428 VAPPMFAVEKFRVLKVIYWKGMNFRYQAKQIEQLFKKYNFTYLGVDVTGIGQGIFDNIQ- 486

Query: 390 LGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSF 445
                       R         N + +L +K AD +E   +     L +   +  S++  
Sbjct: 487 --------HFAMRVAVAIRYDLNTKNKLVLKAADVVESQRIEWDKNLKEIPASFMSVRRT 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
              +   +   + R +     +    + +     P
Sbjct: 539 TTQSGNAMTFVADRSQDTGHAEAFWAITHALHNEP 573


>gi|58532911|ref|YP_195134.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
 gi|58331378|emb|CAF34164.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-PM2]
          Length = 548

 Score =  116 bits (291), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 66/475 (13%), Positives = 135/475 (28%), Gaps = 79/475 (16%)

Query: 5   LPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDA 64
           +    E  ++        +       F  ++         L  F     +Q E +     
Sbjct: 20  IDFTKEQVKEWI------KCANDPVYFTKNYVKIVSLDEGLVPFKMWD-FQEELIMKFHK 72

Query: 65  HCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTL 124
           +  N    P            R  GK+T     +L  +     +++  LAN  +  +  L
Sbjct: 73  NRFNIAKLP------------RQTGKSTTVVSYLLHYLIFNDNVNIGILANKASTARDLL 120

Query: 125 WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTF 184
            A ++     LP                        ++ +++        T       + 
Sbjct: 121 -ARLATAYENLP-----------KWIQQGVVVWNKGNIELENGSKILAAST-------SA 161

Query: 185 VGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGKFYE 239
                     I  DE +  P    D     +   +T   +     I T        K + 
Sbjct: 162 SAVRGMSFNIIFLDEFAFVPNHIADSFFASVYPTITSGKSTKVIIISTPQGMNHFYKMWV 221

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
                 + +   ++    V G D  + E  I            E   +F     D+ I  
Sbjct: 222 DATNGRNGYTFHEVHWSQVPGRDEKWKEETIKNTSE--RQFTQEFECEFLGSV-DTLIAA 278

Query: 300 NIIEEALNREP-----------CPDPYAPLIMGCDIAEE-GGDNTVVVLRRG----PVIE 343
           + ++  +  +P            P   +  +M  D++   GGD +  ++         + 
Sbjct: 279 SKLKALVFNDPIKRNKGLDIYEEPKEKSEYLMTVDVSRGIGGDYSAFIIFDITTVPYKVV 338

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVLG 399
             +  ++       N I+ L   Y    ++ + N+ G +        LE     +  + G
Sbjct: 339 GKYRNNEIKPMLFPNIINDLARSYNNAWVLCEVNDIGDQVASILNYDLEYPNVLMCAMRG 398

Query: 400 QKRAVDLEFCRNRRTELHVKM------------ADWLEFASLI-NHSGLIQNLKS 441
           +   +  +     +T+L VKM               +E   LI N   +I  L +
Sbjct: 399 RAGQLVGQGFSGSKTQLGVKMSITVKKVGCANLKTIVEEDKLIFNDYDIINELTT 453


>gi|326782137|ref|YP_004322538.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM1]
 gi|310004344|gb|ADO98737.1| terminase DNA packaging enzyme large subunit [Prochlorococcus phage
           P-HM1]
          Length = 560

 Score =  116 bits (291), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 64/460 (13%), Positives = 124/460 (26%), Gaps = 66/460 (14%)

Query: 4   ELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVD 63
           E+  + E  Q+        + K     F  ++         +  F     +Q E +E   
Sbjct: 18  EIQFSKEQIQEYL------KCKEDPVYFARNYIKIISLDEGIVPFDMWD-FQEELIESFH 70

Query: 64  AHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTT 123
            +  N    P            R  GK+T     +L  +     ++V  LAN  +  +  
Sbjct: 71  ENRFNIAKLP------------RQTGKSTTCVSYLLHYILFNDNVNVGILANKLSTARDL 118

Query: 124 LWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDT 183
           L   +      LP      +   +       +     +                     +
Sbjct: 119 L-GRLQLAYEQLPLWLQQGIVVYNKGSMELENGSKILA------------------ASTS 159

Query: 184 FVGHHNTYGMAIINDEASGTP----DVINLGILGFLTERN-ANRFWIMTSNPRRLSGKFY 238
                      I  DE +  P    +     +   +T         I T N      K +
Sbjct: 160 ASAVRGMSFNIIFLDEFAFIPNHIAEQFFSSVYPTITSGTSTKVIIISTPNGMNHFYKLW 219

Query: 239 EIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP 298
               K  + +   ++    V G D  + E  IA           E   +F     D+ I 
Sbjct: 220 VDAQKGRNGYAWSEVHWSKVPGRDAKWKEQTIANTSE--RQFTQEFDCEFLGSV-DTLIT 276

Query: 299 LNIIEEALNREP-----------CPDPYAPLIMGCDIAEE-GGDNTVVVLRRGPVIEHLF 346
              +      +P            P      I+  D++     D +  V+          
Sbjct: 277 AAKLRTLTYDDPLTTNGSLDVYENPVRDHDYIICVDVSRGLAQDYSAFVVIDITHAPWRL 336

Query: 347 DWSKTD----LRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVYRVL 398
                D         N I  +   Y    ++ + N+ G          LE     +  + 
Sbjct: 337 VAKYRDHDVRPMVYPNIIFNVATNYNKAYVLTEVNDIGEAVSGSLFYDLEYENVLMCAMR 396

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN 438
           G+   +  +     + ++ VKM+  ++     N   LI++
Sbjct: 397 GRAGQIVGQGFSGNKVQMGVKMSKTVKAQGCSNLKTLIED 436


>gi|51596097|ref|YP_070288.1| phage terminase subunit GpP [Yersinia pseudotuberculosis IP 32953]
 gi|51589379|emb|CAH21001.1| terminase subunit [Enterobacteria phage 186] gb|AAC3414 [Yersinia
           pseudotuberculosis IP 32953]
          Length = 590

 Score =  116 bits (290), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 51/460 (11%), Positives = 121/460 (26%), Gaps = 38/460 (8%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS- 116
           F E +  +  N          +  + + R IG T   A   L    T     +   A+  
Sbjct: 140 FHENIFDYQRNWFEAGLTHRIRNILKS-RQIGATFFFAREALLDAITTGRNQIFLSASKA 198

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQ--SLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
           +  +  +   + ++ + +        +   +               +  +    Y  + +
Sbjct: 199 QAHVFKSYIIDFARMVDVDLKGDPMVLPNGARLFFLGTNVRTAQSYTGNLYLDEYFWIPK 258

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                +  + +  H  +     +  +S           G L  +               S
Sbjct: 259 FQELRKVASGMSLHKKWRTTYFSTPSSLAHSAYPFW-SGELFNKGRRNKSDHIQLDLSHS 317

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
                         +   ++     G +      +   YG      +  +  +F      
Sbjct: 318 HLARGALCDDGQWRQIVTVEDALAGGCNLFDLNQLSLEYG--PSEYQNLLMCEFVDDQAS 375

Query: 295 SFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTV--------VVL 336
            F    +    ++     + Y P            +G D +E  G ++         +V 
Sbjct: 376 VFPFAELQACMVDSLEEWEDYNPYSLRPFGHRPVWIGYDPSEANGGDSAGCAVIAPPMVP 435

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D       I  L +KY  + I IDA   G      +         
Sbjct: 436 GGKFRVLERHQWKGMDFEAQAKHIEELTQKYCVEYIGIDATTVGQGVFQLVRQFFPAARE 495

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGEL 453
           +               +T + +K    +    L      + + Q+  +++  +  +    
Sbjct: 496 IKYTPE---------IKTAMVLKAKHTINNGRLEYDTGHTDITQSFMAIRKTMTASGKSS 546

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
              + R + A   D +  +M+     P  +    G  P++
Sbjct: 547 TYVASRSEEASHADVAWAIMHALLNEPLTATY-GGHSPNF 585


>gi|320177430|gb|EFW52430.1| Phage terminase, ATPase subunit [Shigella dysenteriae CDC 74-1112]
          Length = 588

 Score =  116 bits (290), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 58/461 (12%), Positives = 114/461 (24%), Gaps = 46/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E      + +      E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEKNFHSSMFNYQRHWWEAGKTNRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGID 165
              A+        Q       EV   L   P        +                  + 
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDP--MVLPNGATLYFLGTNARTAQSYHGNLY 249

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S T                     +
Sbjct: 250 LDEYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRNKADKV 309

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                               D   R  +          +  +    R     D  +  + 
Sbjct: 310 DIDLSHSNLAPGLLCA----DGQYRQIVTVEDAVRGACNLFDLDQLRMEYSPDEYQNLLM 365

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE--EGGDNTV 333
            +F       F    +    ++       +            + +G D A+  + GD+  
Sbjct: 366 CEFVDDLASVFPLSELQACMVDSWEVWTDFHALALRPFGWREVWIGYDPAKGTQNGDSAG 425

Query: 334 VVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            V+            I     W   D R     I  L E+Y    I ID+   G    + 
Sbjct: 426 CVVVAPPAVPGGKFRILERHQWRGMDFRAQAYAIKKLTEQYNVTYIGIDSTGVGHGVYEN 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++     V   +            N +  L +K  D +    L   +    + Q+  +++
Sbjct: 486 VKAFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +      E+ R + A   D +   M+     P + +
Sbjct: 537 RATTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGE 577


>gi|188532717|ref|YP_001906514.1| Terminase, ATPase subunit [Erwinia tasmaniensis Et1/99]
 gi|188027759|emb|CAO95616.1| Terminase, ATPase subunit [Erwinia tasmaniensis Et1/99]
          Length = 588

 Score =  116 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/470 (11%), Positives = 123/470 (26%), Gaps = 42/470 (8%)

Query: 55  QLEFMEVVDAHCLNSVNNPN-PEVFKGAIS---AGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E ++ +    +            K A+      R IG T   A   L    T     +
Sbjct: 132 QIEKLQDIFHSTMFGYQRQWWEAGNKYAVRNLLKSRQIGATFFFAREALIDALTTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      E ++   +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIVEFAREADVDLKGDPMTLDNGACLYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +    ++  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELQKVASGMALHKKWRETYFSTPSSLTHSAYPFWSGAQFNRGRAKADRVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                 +              +   ++     G D    E +  RY  +    +  +   
Sbjct: 312 --DLSHASLAAGRLCADGQFRQIVTVEDAVRGGCDLFDLEQLRTRYSPED--YQNLLMCV 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAE-EGGDNTVVVL 336
           F       F    + +  ++     D +            + +G D A+     ++   +
Sbjct: 368 FMDDLASVFQLAMLQKCMVDSWEVWDDFEALALRPFGWKEVWIGYDPAKGTQNGDSAGCV 427

Query: 337 RR--------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
                        I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VIAPPAVPGGKFRILERHQWRGMDFRAQADAIKTLTQQYNVTYIGIDSTGVGLGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +              +  L +K  D +    L   +    + Q+  S++  
Sbjct: 488 AFFPQVKEFVYNPT---------VKNALVLKAYDTMATGRLEFDASHLDIAQSFMSIRKA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
              +      E+ R +     D +   M+  A  P +      +     Y
Sbjct: 539 TTSSGNRPTYETSRSEEVSHGDLAWATMHALANEPLQGQAAHTQNIVEMY 588


>gi|322831306|ref|YP_004211333.1| terminase, ATPase subunit [Rahnella sp. Y9602]
 gi|321166507|gb|ADW72206.1| terminase, ATPase subunit [Rahnella sp. Y9602]
          Length = 596

 Score =  116 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/442 (10%), Positives = 107/442 (24%), Gaps = 45/442 (10%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   A   L          +   A S+TQ    ++ E     + L      
Sbjct: 171 ILKSRQIGATFFFAREALLRALATGHNQIFLSA-SKTQAY--VFREYIIQFARLAGVELT 227

Query: 142 EMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
                     +  +      +     +  +       +       +  + +         
Sbjct: 228 GDPIVIGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIPNFQKLRKVASGMASQEHLRTT 287

Query: 195 IINDEASGTPDVINLGILGFLTER--NANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQ 252
             +  ++ T             +   N N    +       +     +            
Sbjct: 288 YFSTPSALTHGAYPFWSGELFNKGRENPNDRIELDIGHH--ALAKGRLCEDGQWRQIV-T 344

Query: 253 IDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
           I+     G +    + +      +    R     +F       F    +    +      
Sbjct: 345 IEDALAGGCNLFNIDTLKQENSAED--FRNLFMCEFVDDQTSVFPFAELQRCMVESAEEW 402

Query: 313 DPYAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTT 356
             ++P          + +G D +  G      V+           +     W   D    
Sbjct: 403 QDFSPFAMRPFGYRAVWIGYDPSHTGDSAGCAVVAPPLVDGGKFRVLERHQWKGMDFAAQ 462

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
              I  L ++Y  + I +DA   G      +         +               +T++
Sbjct: 463 AKSIEELTKRYCVEYIGVDATGIGQGVFQLVRQFFPAAMEIRYSPET---------KTKM 513

Query: 417 HVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLM 473
            +K  D +    L        +  +  +++  +  +      E+ R + A   D +  +M
Sbjct: 514 VLKAKDTITSGRLEYDTNHKDITSSFMAIRKTMTASGSRSTYEASRSEEASHADVAWAIM 573

Query: 474 YTFAENPPRSDMDFGRCPSYQY 495
           +     P  +          ++
Sbjct: 574 HALLNEPLTAASGGQSPNILEF 595


>gi|152973346|ref|YP_001337126.1| putative prophage large terminase protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150958195|gb|ABR80225.1| putative prophage large terminase protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 589

 Score =  116 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/471 (12%), Positives = 118/471 (25%), Gaps = 54/471 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F+    +QL +      H +              I   R IG T   +   L        
Sbjct: 142 FAESFEYQLRWHRAGLEHRIRD------------ILKSRQIGATFYFSREALLHALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     +   +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARRVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +   +       +  ++                  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVSSGMASQSHLRSTYFSTPSTLAHGAYPFWSGELFNRGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +                  I+     G      E +     +D    
Sbjct: 307 SASERVDIDISHDALAAGVACPDGQWRQIV-TIEDALAGGCTLFNLEQLKRENSVDD--F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGD 330
           R     +F       F   ++    ++     +             P+ +G D +  G  
Sbjct: 364 RNLFMCEFVDDKASVFPFEDLQRCMVDSLEEWEDFAPFADNPFGSRPVWVGYDPSHSGDS 423

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
              VVL           I     W   D  T    I  L EKY  + I IDA   G    
Sbjct: 424 AGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRQLTEKYNVEYIGIDATGLGIGVF 483

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKS 441
             +               A D+ +    +T + +K  D +    L      + +  +  +
Sbjct: 484 QLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITTSFMA 534

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPS 492
           ++  +  +      E+ R + A   D +   M+     P  +        S
Sbjct: 535 IRKTMTSSGRSATYEASRTEEASHADVAWATMHALLNEP-LTAGSGQVTSS 584


>gi|253991767|ref|YP_003043123.1| putative phage terminase subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638542|emb|CAR67163.1| probable phage terminase subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783217|emb|CAQ86382.1| probable phage terminase subunit [Photorhabdus asymbiotica]
          Length = 585

 Score =  116 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/466 (12%), Positives = 126/466 (27%), Gaps = 44/466 (9%)

Query: 46  EGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTR 105
           E            +        ++            I   R IG T   A   L    T 
Sbjct: 128 EQVKKLEDIFRSTLFDYQHDWYHAGLTHRIRN----ILKSRQIGATFFFAREALIDALTT 183

Query: 106 PGISVICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQ--SLSLHPAPWYSDVLHCSL 162
               +   A+  +  +      E+++ +++        +   +                 
Sbjct: 184 GRNQIFLSASKAQAHVFKQYILEMAREVNVELKGDPITLSNGATLYFLGTNARTAQSYHG 243

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +    Y  + +     +  + +  H  +     +  +S T         G L  R   +
Sbjct: 244 NLYLDEYFWIPKFQELRKVASGMAMHKKWRQTYFSTPSSLTHSAYPYW-SGKLFNRGRAK 302

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
              +  +    +     +            ++     G +    + +   Y  D    + 
Sbjct: 303 ANRIDIDISHQALASGLLCADGQWRQIV-TVEDAVRGGCNLFDIDQLRLEYSPDE--YQN 359

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEE--GG 329
            +  +F      S   L +++  +                P  Y P+ +G D A+    G
Sbjct: 360 LLMCEFMDDIE-SIFSLQLMQGCMVDSWEIWNDVQPLMLRPYGYNPVWIGYDPAKGGKNG 418

Query: 330 DNTVVVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
           D+   V+            I     W   + R  ++ I  L E+Y  + I ID+   G  
Sbjct: 419 DSAGCVVVAPPLVPGGKFRILERHQWRGMNFRAQSDAIKRLTEQYNVEYIGIDSTGVGHG 478

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNL 439
               ++     V   +              +  L +K  D +    L   +    + Q+ 
Sbjct: 479 VYQNVKEFFPSVREFVYNPS---------VKNALVLKAWDIINHRRLEFDAGQTDIAQSF 529

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDM 485
            +++     +      E+ R + A   D +   M+     P   D 
Sbjct: 530 MAIRRSTTASGNRPTYEASRSEEASHADLAWATMHALFNEPITGDT 575


>gi|29144574|ref|NP_807916.1| terminase subunit [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|29140212|gb|AAO71776.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 588

 Score =  116 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/461 (11%), Positives = 117/461 (25%), Gaps = 42/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKINRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAE-EGGDNTVVVL 336
           F       F    +    ++       +            + +G D A+     ++   +
Sbjct: 368 FIDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDPAKGTQNGDSAGCV 427

Query: 337 RR--------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
                        I     W   D R   + I  L ++Y    I ID+   G      ++
Sbjct: 428 VIAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYLNVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 DFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
              +      E+ R + A   D +   M+     P + +  
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGEAA 579


>gi|326783799|ref|YP_004324193.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
 gi|310003811|gb|ADO98206.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-SSM7]
          Length = 552

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/479 (12%), Positives = 126/479 (26%), Gaps = 74/479 (15%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N         +    +       F  ++         L  F     +Q + +  
Sbjct: 12  PNLKKANVAQNFTKKQVAEFLKCAQDPVYFAKNYVQIINLDEGLVPFEM-YDFQEKLVNN 70

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              +  N    P            R  GK+T     +L        +++  LAN     +
Sbjct: 71  FHNNRFNICKMP------------RQSGKSTTVVSYLLHYAIFNDSVTIGILANKAQTAR 118

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L   +      LP                        S+ +++K       T      
Sbjct: 119 DLL-GRLQIAYENLP-----------KWMQQGIIAWNKGSMELENKSKIIAAST------ 160

Query: 182 DTFVGHHNTYGMAIINDEASGT----PDVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
            +           I  DE +       D     +   ++   +     + T        +
Sbjct: 161 -SASAVRGMSFNIIFLDEFAFVANHLADDFFSSVYPTISSGKSTKVIIVSTPRGMNHFYR 219

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +       +++    +    V G D ++ E  I          RVE   +F     D+ 
Sbjct: 220 LWHDAELGRNEYVTTDVHWSEVPGRDEAWKEQTIKNTSE--AQFRVEFECEFLGSV-DTL 276

Query: 297 IPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRG----------------- 339
           I  + ++  +  EP         +  +  E+   +  V + RG                 
Sbjct: 277 IAPSKLKTMVYDEPINTGKRGGEIYQNPIEKHNYSITVDVARGVEKDYSAFIVFDTTTFP 336

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD----YLEMLGYHVY 395
             +   +  +        + I+     Y    I+ + N+ G +        LE     + 
Sbjct: 337 YKVVAKYRNNTIKPMLFPSVIAEFARAYNNAFILCEVNDIGDQIASILFYDLEYENVLMT 396

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS-------------LINHSGLIQNLKS 441
            V G+   V  +     + +L VKM+  ++                +IN   +I  L +
Sbjct: 397 AVRGRAGQVLGQGFSGSKVQLGVKMSKTVKKIGALNLKTLIESDKLIINDYNIIAELTT 455


>gi|48697520|ref|YP_024878.1| gp33 TerL [Burkholderia phage BcepB1A]
 gi|47717490|gb|AAT37736.1| gp33 TerL [Burkholderia phage BcepB1A]
          Length = 532

 Score =  115 bits (288), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/383 (14%), Positives = 111/383 (28%), Gaps = 59/383 (15%)

Query: 150 PAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH-HNTYGMAIINDEASGTPDVIN 208
           P  +            S     +  T +  R +                DEA+   +   
Sbjct: 156 PPEFRGGWNPHDHTHSSHMRVIIPDTGAVIRGEAGKNIGRGGRVSIQFVDEAAHLENAQA 215

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
           +      T        I  S+   L+  F E   +     K   +  R     D  +++ 
Sbjct: 216 VDTALAATT----NCRIDISSVNGLNNPFAEK--RFSGRVKVKTMHWRDDPRKDDEWYKK 269

Query: 269 IIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP--DPYAPLIMGCDIAE 326
              ++  ++ V   E+   +        IPL  I+ A++ +               D+A+
Sbjct: 270 QKQKF--NALVVAQEIDIDYSASAEGVLIPLEWIDAAIDADVKLGLTVTGQRFSSLDVAD 327

Query: 327 EGGDNTVVVLRRGPVIEHLFDWSKT--DLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
           EG D      R G  +++   WS    ++  T  +  GLV          D++  G    
Sbjct: 328 EGKDMNAFGSRLGIRMDYAESWSGKGSNIYGTTLRTIGLVIAQNGRDFQFDSDGLGVGVR 387

Query: 385 DYLEMLG--------YHVYRVLGQKRAVDLE----------------FCRNRRTELHVKM 420
              E +           +  +  +  +   E                F +NR+ + +  +
Sbjct: 388 GDAEAINALPERKAYPKIDAIAFRGSSSVREPDKQVPGAYKGVKNVDFFQNRKAQEYWAL 447

Query: 421 ADWLE--------------------FASLINHSGLIQNLKSLKSFIVPNTGELAIESKRV 460
               E                     + + +   +   L     +    TG++ I+ K  
Sbjct: 448 RMRFEATYRAVVEKLEYDPDEIISISSRIPDLQKIRMEL-HQPLYKPSTTGKIMIQ-KTP 505

Query: 461 KGAKSTDYSDGLMYTFAENPPRS 483
            G  S +Y+D  M  +A    + 
Sbjct: 506 DGMVSPNYADMTMMLYAPQQTKR 528


>gi|291618711|ref|YP_003521453.1| P [Pantoea ananatis LMG 20103]
 gi|291153741|gb|ADD78325.1| P [Pantoea ananatis LMG 20103]
          Length = 588

 Score =  115 bits (287), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/470 (11%), Positives = 125/470 (26%), Gaps = 42/470 (8%)

Query: 55  QLEFMEVVDAHCLNSVNNPN-PEVFKGAIS---AGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E ++ +    +            K A+      R IG T   A   L    T     +
Sbjct: 132 QIEKLQDIFHSTMFGYQRQWWEAGNKYAVRNLLKSRQIGATFFFAREALLDALTTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      E ++   +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIVEFAREADVDLKGDPMTLANGACLYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +    ++  + +  H  +     +  +S T             +  A    +  
Sbjct: 252 EYFWIPKFQELQKVASGMALHKKWRETYFSTPSSLTHSAYPFWSGAQFNKGRAKADRVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                 +              +   ++     G D    E +  RY  +    +  +   
Sbjct: 312 --DLSHASLAAGRLCADGQFRQIVTVEDAVRGGCDLFDLEQLRTRYSPED--YQNLLMCV 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEE--GGDNTVVV 335
           F       F    +    ++     D +            + +G D A+    GD+   V
Sbjct: 368 FMDDLASVFQLAMLQRCMVDSWEVWDDFEALALRPFGWKEVWIGYDPAKGTKNGDSAGCV 427

Query: 336 L-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
           +            I     W   D R   + I  L ++Y    I ID+   G    + ++
Sbjct: 428 VIAPPAVPGGKFRILERHQWRGMDFRAQADAIKSLTQQYNVTYIGIDSTGVGLGVYENVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +              +  L +K  D +    +   +    + Q+  S++  
Sbjct: 488 AFFPQVKEFVYNPT---------VKNALVLKAYDTISSGRMEFDASHLDIAQSFMSIRKA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
              +      E+ R +     D +   M+  A  P +      +     Y
Sbjct: 539 TTASGNRPTYETSRSEEVSHGDLAWATMHALANEPLQGQAAHTQNIVEMY 588


>gi|126173520|ref|YP_001049669.1| hypothetical protein Sbal_1282 [Shewanella baltica OS155]
 gi|125996725|gb|ABN60800.1| protein of unknown function DUF264 [Shewanella baltica OS155]
          Length = 602

 Score =  115 bits (287), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 58/475 (12%), Positives = 127/475 (26%), Gaps = 64/475 (13%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             +Q +  E +     N             I   R IG T   A              + 
Sbjct: 159 FEYQKKMHENLHQRIRN-------------ILKSRQIGATYYFAGEAFEQAVLTGDPQIF 205

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--------------LHPAPWYSDV 157
             A S +Q       EV +   +     +FE++                    +      
Sbjct: 206 LSA-SRSQA------EVFRSYIIAIAHEFFEIELTGNPIVLNTAHGAAELRFLSTNSKTA 258

Query: 158 LHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTE 217
                 +    Y  + +     +  + +  H+ +     +  ++               +
Sbjct: 259 QSYHGHVYVDEYFWIGKFDVLNKLASAMATHSNWRKTYFSTPSTKAHPAYPFWTGDHWRK 318

Query: 218 RNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDS 277
               R  +      ++      +       +    I+     G +    + +   Y  D 
Sbjct: 319 GKPEREEVEFPTFDQMRDG-GRVCPDKQWRY-VVTIEDALAGGCELFDIDELRDEYNGDD 376

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEG 328
                     F       F   ++    +E A  ++  P    P     + +G D +   
Sbjct: 377 --FANLFMCIFVDDADSVFKFSDLEKCMVEAARWQDYKPAAPRPFGNREVWLGYDPSRTR 434

Query: 329 GDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
            + T+VV+           +     W   +      +I  +  KYR   I +D    GA 
Sbjct: 435 DNATLVVVAPGEKKGEKFRVLEKHYWRGMNFSHHVAEIQKIYAKYRVTYIGVDTTGIGAG 494

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNL 439
             D +  L            A  + +    +T L +KM D +E   +   +    +  + 
Sbjct: 495 VFDSISTLYPR--------EATAIHYSVGSKTRLVLKMIDVIEGGRIEWDAGHKDIAMSC 546

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
            S++  +  + G +  ++ R       D    + +     P   +       + Q
Sbjct: 547 LSIRRTVTDSGGAITFKASRDNVTGHADVFFAIAHAVINEPLNYEHKRTSSWAMQ 601


>gi|161521371|ref|YP_001584798.1| hypothetical protein Bmul_4835 [Burkholderia multivorans ATCC
           17616]
 gi|189352462|ref|YP_001948089.1| ATPase subunit of bacteriophage terminase [Burkholderia multivorans
           ATCC 17616]
 gi|327198040|ref|YP_004306409.1| gp42 [Burkholderia phage KS5]
 gi|160345421|gb|ABX18506.1| protein of unknown function DUF264 [Burkholderia multivorans ATCC
           17616]
 gi|189336484|dbj|BAG45553.1| ATPase subunit of bacteriophage terminase [Burkholderia multivorans
           ATCC 17616]
 gi|310657174|gb|ADP02289.1| gp42 [Burkholderia phage KS5]
          Length = 588

 Score =  115 bits (287), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/459 (12%), Positives = 115/459 (25%), Gaps = 42/459 (9%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+E +  +  N       E  +  +   R IG T   A   L       G + I L+ S+
Sbjct: 137 FLESIFDYQRNWYRAGFKERIR-NVLKSRQIGATWYFAREALLDAL-NTGRNQIFLSASK 194

Query: 118 TQLKTTLWAEVSKWLSLLPNKHW------FEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
            Q        + ++     +             +                  +    Y  
Sbjct: 195 AQAH-VFRQYIVQFAKDAVDVELKGDPIVLPNGATLYFLGTNARTAQSYHGNLYFDEYFW 253

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + R     +  + +  H+ +     +  +S   D                   +      
Sbjct: 254 VPRFQELRKVASGMAIHDQWRQTYFSTPSSLAHDAYPFWSGKLFNRGRPKDQHVSIDISH 313

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRT--VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
             +                   D                   R     +     +  QF 
Sbjct: 314 -AALAAGRSCQDGQWRQIVTVEDAVRGGCNSGARPLFNLDRLRLEYSPEEYANLLLCQFI 372

Query: 290 QQDIDSFIPLNIIEEAL-NREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL-- 336
                S  PL +++  + +     D + P          + +G D +  G     VV+  
Sbjct: 373 DD-SLSVFPLTVLQPCMVDTWEVWDDFKPLYLRPFGDEEVWIGYDPSHTGDSAGCVVIAP 431

Query: 337 ----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY 392
                    +   F W   D      +I  L  +YR   I ID    G      +     
Sbjct: 432 PKRPGGKFRVLERFQWHGLDFEAQAAQIEALTRRYRVTYIGIDTTGIGQGVYQLVTKFFP 491

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPN 449
                               +T L +K  + +    L   +    L  +  ++K  I P+
Sbjct: 492 AATPFHYSVE---------IKTALVMKAQNVIRKGRLEFDAGWNDLAASFMAIKKTITPS 542

Query: 450 TGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFG 488
             ++  ++ R + A   D +   M+  A  P        
Sbjct: 543 GLQVTYKASRSEEASHGDLAWACMHALANEPLEGATATN 581


>gi|318604142|emb|CBY25640.1| phage terminase, ATPase subunit [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|318605359|emb|CBY26857.1| phage terminase, ATPase subunit [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 590

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/475 (10%), Positives = 120/475 (25%), Gaps = 59/475 (12%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS- 116
           F E +  +  N  +       +  + + R IG T   A   L    T     +   A+  
Sbjct: 140 FHENIFDYQRNWFDAGLQHRIRNILKS-RQIGATFFFAREALLDAITTGRNQIFLSASKA 198

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQ--SLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
           +  +  +   + ++ + +        +   +               +  +    Y  + +
Sbjct: 199 QAHVFKSYIIDFARMVDVDLKGDPMVLPNGARLFFLGTNVRTAQSYTGNLYLDEYFWIPK 258

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                +  + +  H  +     +  +S                 +A  FW      +   
Sbjct: 259 FQELRKVASGMSLHKKWRTTYFSTPSS--------------LAHSAYPFWSGELFNKGRR 304

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA-----------RYGLDSDVTRVE 283
            K   I                  +       E  +A                    +  
Sbjct: 305 NKSDHIQLDLSHSHLARGAICADGQWRQIVTVEDALAGGCNLFDLNQLSLEYSPAEYQNL 364

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTV 333
           +  +F       F    +    ++     + Y P            +G D +E  G ++ 
Sbjct: 365 LMCEFVDDQASVFPFAELQACMVDSLEEWEDYNPYSLRPFGHRPVWIGYDPSEANGGDSA 424

Query: 334 --------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
                   +V      +     W   D       I  L +KY  + I IDA   G     
Sbjct: 425 GCAVIAPPMVPGGKFRVLERHQWKGMDFEAQAKHIEELTQKYCVEYIGIDATTVGQGVFQ 484

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSL 442
            +         +               +T + +K    +    L      + + Q+  ++
Sbjct: 485 LVRQFFPAAREIKYTPE---------IKTAMVLKAKHTINNGRLEYDTGHTDITQSFMAI 535

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
           +  +  +       + R + A   D +  +M+     P  +          ++ G
Sbjct: 536 RKTMTASGKSSTYVASRSEEASHADVAWAIMHALLNEPLTATYGGHSPNFLEFYG 590


>gi|300723941|ref|YP_003713254.1| Terminase, ATPase subunit [Xenorhabdus nematophila ATCC 19061]
 gi|297630471|emb|CBJ91136.1| Terminase, ATPase subunit (GpP) [Xenorhabdus nematophila ATCC
           19061]
          Length = 573

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 60/433 (13%), Positives = 116/433 (26%), Gaps = 46/433 (10%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   A   L    T     V   A+            +      +  +   
Sbjct: 148 ILKSRQIGATYFFAREALMDALTTGRNQVFLSASKAQA--HVFKEYILDMAREVDVELRG 205

Query: 142 EMQ-----SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +       +                  +    Y  + R     +  + +  H  +     
Sbjct: 206 DPITLSNGATLYFLGTNARTAQSYHGNLYLDEYFWIPRFQELRKVASGMAIHKKWRQTYF 265

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF-QIDT 255
           +  +S T           +    A    I             E      D W++   ++ 
Sbjct: 266 STPSSLTHSAYPFWSGKLINRGRAKADRIEIDISH---DVLAEGVLCGDDQWRQIVTLED 322

Query: 256 RTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC---- 311
               G D    + +  +Y  D    +  +  +F      S   L +++  +         
Sbjct: 323 AIQGGCDLFDIDRLRRQYSPDE--YQNLLMCEFMDDIE-SIFSLQLMQGCMVDSWEIWHD 379

Query: 312 -------PDPYAPLIMGCDIAEE--GGDNTVVVL-------RRGPVIEHLFDWSKTDLRT 355
                  P  Y P+ +G D A+    GD+   V+            I     W   D R 
Sbjct: 380 VQPLMLRPYGYHPVWIGYDPAKGGENGDSAGCVVIAPPQVPGGKFRILERHQWRGMDFRA 439

Query: 356 TNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTE 415
            ++ I  L E+Y  + I ID+   G      ++         +              +  
Sbjct: 440 QSDAIRQLTEQYNVEYIGIDSTGIGHGVYQNVKEFFPAAREFVYNPS---------VKNA 490

Query: 416 LHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGL 472
           L +K  D +    L   +    + Q+  +++     +      E+ R + A   D +   
Sbjct: 491 LVLKAWDIIHHRRLEFDAGHTDIAQSFMAIRRATTASGNRPTYEASRSEEASHADLAWAT 550

Query: 473 MYTFAENPPRSDM 485
           M+     P   D 
Sbjct: 551 MHALFNEPITGDT 563


>gi|291336011|gb|ADD95601.1| large terminase protein [uncultured phage MedDCM-OCT-S09-C7]
          Length = 526

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 63/454 (13%), Positives = 132/454 (29%), Gaps = 60/454 (13%)

Query: 11  TEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSV 70
           T+Q+        +      +F+ ++         +  F   R +Q + +E  +++  N  
Sbjct: 25  TDQE-MQEYV--KCSQDPCHFIENYTQIISLDEGMVPFKL-RGYQDKLIEHYNSNRFN-- 78

Query: 71  NNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK 130
                      + A R  GK+  +   +LW +   P ++V  LAN     +  + A +  
Sbjct: 79  ----------IVLASRQSGKSITSCAYLLWFLLFNPEVTVAVLANKGAIAREMI-ARMVT 127

Query: 131 WLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNT 190
            L  +P      ++ L+     + +D    +                     +       
Sbjct: 128 MLESVPFFLQPGVKILNKGSIEFANDSKVVA------------------AATSSSSIRGL 169

Query: 191 YGMAIINDEASGTPDV--INLGILGFLTER-NANRFWIMTSNP-RRLSGKFYEIFNKPLD 246
               +  DE +   D           +T   ++      T+N    +  K YE       
Sbjct: 170 SINLLYLDEFAFVDDAETFYTATYPVVTSGKDSKVIITSTANGVGNMFYKIYESAVHDQS 229

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIP-------- 298
           ++K F I+   V G D  + +  IA           E    F                  
Sbjct: 230 EYKHFLINWFDVPGRDEEWKKETIANTSE--AQFEQEYGNSFLGTGNTLINSNTLLGLMS 287

Query: 299 --LNIIEEALNREPCPDPYAPLIMGCDIAEEG--GDNTVVVLRRGPVIEHLFDWSK---T 351
              +  ++ +     P      I   D+++      +T  ++             +    
Sbjct: 288 KEPDWNKDGVKVYEKPKEGHTYITTVDVSKGRGIDYSTFTIMDISVKPFRQVCTYRDNMI 347

Query: 352 DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE-MLGYHVYRVLGQKRAVDLE--F 408
                 + I+   + Y    +II+ N  G      L   + Y    V G  +A D+    
Sbjct: 348 SPMLFPDLIAKYTKPYNESLVIIENNAEGGMVATQLHYDIEYPNVFVQGMSKAEDIGVTM 407

Query: 409 CRNRRTELHVKMADWLEFASLINHSGL-IQNLKS 441
            +  +      + + LE   +       I  L +
Sbjct: 408 TKRIKRIGCSTLKELLEENRMTICDRDGITELMT 441


>gi|238760573|ref|ZP_04621704.1| Terminase, ATPase subunit [Yersinia aldovae ATCC 35236]
 gi|238701192|gb|EEP93778.1| Terminase, ATPase subunit [Yersinia aldovae ATCC 35236]
          Length = 590

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/464 (10%), Positives = 119/464 (25%), Gaps = 37/464 (7%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS- 116
           F E +  +  N          +  + + R IG T   A   L          +   A+  
Sbjct: 140 FHENIFDYQRNWFEAGLTHRIRNILKS-RQIGATFFFAREALLDAIVTGRNQIFLSASKA 198

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQ--SLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
           +  +  +   + ++ + +        +   +               +  +    Y  + +
Sbjct: 199 QAHVFKSYIIDFARMVDVDLKGDPMVLPNGARLFFLGTNVRTAQSYTGNLYLDEYFWIPK 258

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                +  + +  H  +     +  +S           G L  +               S
Sbjct: 259 FQELRKVASGMSLHKKWRTTYFSTPSSLAHSAYPFW-SGELFNKGRRNKSDHIQLDLSHS 317

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
                         +   ++     G +      +   YG      +  +  +F      
Sbjct: 318 HLARGALCADGQWRQIVTVEDALAGGCNLFDLNQLSLEYG--PSEYQNLLMCEFVDDQAS 375

Query: 295 SFIPLNIIEEALNREPCPDPYAPL----------IMGCDIAEEGGDNTV--------VVL 336
            F    +    ++     + Y P            +G D +E  G ++         +V 
Sbjct: 376 VFPFKELQACMVDSLEEWEDYNPYSLRPFGYRPVWIGYDPSEANGGDSAGCAVIAPPMVP 435

Query: 337 RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   D       I  L +KY  + I IDA   G      +         
Sbjct: 436 GGKFRVLERHQWKGMDFEAQAKHIEELTQKYCVEYIGIDATTVGQGVFQLVRQFFPAARE 495

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGEL 453
           +               +T + +K    +    L      + + Q+  +++  +  +    
Sbjct: 496 IKYTPE---------IKTAMVLKAKHTINNGRLEYDTGHTDITQSFMAIRKTMTASGKSS 546

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQYEG 497
              + R + A   D +  +M+     P  +          ++ G
Sbjct: 547 TYVASRSEEASHADVAWAIMHALLNEPLTATYGGHSPNFLEFYG 590


>gi|210062534|gb|ACJ06274.1| probable terminase subunit [Photorhabdus luminescens]
          Length = 585

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 55/430 (12%), Positives = 114/430 (26%), Gaps = 40/430 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-ETQLKTTLWAEVSKWLSLLPNKHW 140
           I   R IG T   A   L    T     +   A+  +  +      E+++ +        
Sbjct: 160 ILKSRQIGATFFFAREALIDALTTGRNQIFLSASKAQAHVFKQYILEMAREVDAELKGDP 219

Query: 141 FEMQ--SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIND 198
             +   +                  +    Y  + +     +  + +  H  +     + 
Sbjct: 220 ITLNNGATLYFLGTNARTAQSYHGNLYLDEYFWIPKFQELRKVASGMAMHKKWRQTYFST 279

Query: 199 EASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTV 258
            +S T                A    I       +S +      +  D   R  +     
Sbjct: 280 PSSLTHGAYPYWSGKLFNRGRAKANRIDI----DISHQALASGLRCADGQWRQIVTVEDA 335

Query: 259 EGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--- 315
                +  +    R     D  +  +  +F      S   L +++  +            
Sbjct: 336 VRGGCNLFDIDQLRLEYSPDEYQNLLMCEFMDDIE-SIFSLQLMQGCMVDSWEIWDDVQP 394

Query: 316 --------APLIMGCDIA---EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                    P+ +G D A   E G     VV+           I     W   + R  ++
Sbjct: 395 LMLRPYGYHPVWIGYDPAKGGENGDSAGCVVVAPPRVPGDKFRILERHQWRGMNFRAQSD 454

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
            I  L E+Y  + I ID+   G      ++     V   +              +  L +
Sbjct: 455 AIKRLTEQYNVEYIGIDSTGVGHGVYQNVKEFFPSVREFVYNPA---------VKNALVL 505

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L   +    + Q+  +++     +      ++ R + A   D +   M+ 
Sbjct: 506 KAWDIINHRRLEFDAGQTDIAQSFMAIRRSTTASGNRPTYQASRSEEASHADLAWATMHA 565

Query: 476 FAENPPRSDM 485
               P   D 
Sbjct: 566 LFNEPITGDT 575


>gi|56414686|ref|YP_151761.1| terminase subunit [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197363613|ref|YP_002143250.1| terminase subunit [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56128943|gb|AAV78449.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095090|emb|CAR60636.1| probable terminase subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 588

 Score =  115 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/461 (11%), Positives = 115/461 (24%), Gaps = 42/461 (9%)

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGA----ISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           Q+E +E V    +        E  K      +   R IG T   A   L          +
Sbjct: 132 QIEKLEEVFHASMFDYQRHWFEAGKINRIRNLLKSRQIGATFYFAREALIDALLTGRNQI 191

Query: 111 ICLANS-ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--LHPAPWYSDVLHCSLGIDSK 167
              A+  +  +      + +K + +        + + +                  +   
Sbjct: 192 FLSASKAQAHVFKQYIIDFAKEVEVELKGDPMVLPNGAALYFLGTNARTAQSYHGNLYLD 251

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
            Y  + +     +  + +  H  +     +  +S T                A    +  
Sbjct: 252 EYFWIPKFQELRKVASGMAIHKKWRQTYFSTPSSLTHSAYPFWSGALFNRGRAKADKVDI 311

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
                   +         D   R  +          +  +    R     D  +  +  +
Sbjct: 312 DLTHSNLARGLLC----PDGQYRQIVTVEDAVRGGCNLFDLDQLRMEYSPDEYQNLLMCE 367

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCD-IAEEGGDNTVVVL 336
           F       F    +    ++       +            + +G D        ++   +
Sbjct: 368 FIDDLASVFPLSELQACMVDSWEVWTDFQALALRPFGWREVWIGYDSAKGTQNGDSAGCV 427

Query: 337 RR--------GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLE 388
                        I     W   D R   + I  L ++Y    I ID+   G      ++
Sbjct: 428 VIAPPTVPGGKFRILERHQWRGMDFRAQADAIKKLTQQYNVTYIGIDSTGVGHGVYLNVK 487

Query: 389 MLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSF 445
                V   +            N +  L +K  D +    L   +    + Q+  +++  
Sbjct: 488 DFFPAVREFVYNP---------NVKNALVLKAYDIISHRRLEFDAGHTDIAQSFMAIRRA 538

Query: 446 IVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
              +      E+ R + A   D +   M+     P + +  
Sbjct: 539 TTASGNRPTYEASRSEEASHADLAWATMHALFNEPLQGEAA 579


>gi|260557981|ref|ZP_05830193.1| phage terminase large subunit [Acinetobacter baumannii ATCC 19606]
 gi|260408491|gb|EEX01797.1| phage terminase large subunit [Acinetobacter baumannii ATCC 19606]
          Length = 529

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 84/238 (35%), Gaps = 27/238 (11%)

Query: 275 LDSDVTRVEVCGQFPQQDID---SFIPLNIIEEALNREPCPDPYAPLI--------MGCD 323
           L   +    + G F     D     IP   +E A  R    +    L          G D
Sbjct: 280 LPEPLRSQMLYGDFGAGIEDDPWQVIPTEWVEAAQARWKPLEDMRILHRGDFKMDSYGLD 339

Query: 324 IAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR-PDAIIIDANNTGAR 382
           +A  GGDNT+   R G   ++       D        S  V   R    I +D    GA 
Sbjct: 340 VARGGGDNTIGFARYGYWYDNPNVLEGKDSPDGPTSASFAVSHVRDHAPIHVDVIGVGAS 399

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEF-----CRNRRTELHVKMADWLE-----FASLINH 432
           T D+L+  G HV  V  +  A   +        N R++L  +  + L+       +L   
Sbjct: 400 TYDFLKQSGIHVVPVDVRNAATAFDRSGQLSFYNLRSQLWWQFREALDPAYGSTVALPPE 459

Query: 433 SGLIQNLKSLKSFIVPNTGELAIESKR---VKGAKSTDYSDGLMYTFAENPPRSDMDF 487
             L+ +L + +  +     ++ +ES+     +  +S DY   ++    + P R  M  
Sbjct: 460 PKLLADLTAPRWGL--QGTKIKVESREEIIKRIGRSPDYGSAIINAQIDTPKRHIMQT 515


>gi|167623253|ref|YP_001673547.1| hypothetical protein Shal_1320 [Shewanella halifaxensis HAW-EB4]
 gi|167353275|gb|ABZ75888.1| protein of unknown function DUF264 [Shewanella halifaxensis
           HAW-EB4]
          Length = 617

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/425 (11%), Positives = 116/425 (27%), Gaps = 39/425 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN-SETQLKTTLWAEVSKWL------SL 134
           I   R IG T   A              +   A+ S+ ++  T   ++++          
Sbjct: 191 ILKSRQIGATYYFAGEAFEQAVLTGDPQIFLSASRSQAEVFRTYIVQIAQQFFEIELTGN 250

Query: 135 LPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMA 194
               H     +     +            +    Y  + +     +  + +  H  +   
Sbjct: 251 PIVLHTAHGDAELRFLSTNSKTAQSYHGHVYVDEYFWIGKFDVLNKLASAMATHKNWRKT 310

Query: 195 IINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
             +  ++      +           ++R  +       +  +           +    I+
Sbjct: 311 YFSTPSTKAHPAYSFWTGDHWRRGMSDREEVEFPTFDAMRDR-GRFCPDKQWRY-VVTIE 368

Query: 255 TRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI----IEEALNREP 310
                G      E +   Y  D    +      F       F   ++    +E A  ++ 
Sbjct: 369 DALAGGCGLFDIEELRDEYNDDD--FKNLFMCIFVDDADSVFKFSDLEKCMVESARWQDH 426

Query: 311 CPDPYAP-----LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNK 359
            P    P     + +G D +    + T+VV+           +     W   +     ++
Sbjct: 427 KPKEQRPFGNREVWLGYDPSRTRDNATLVVIAPGEKKGEKFRVLEKHYWRGLNFSHHVSE 486

Query: 360 ISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY-HVYRVLGQKRAVDLEFCRNRRTELHV 418
           I  +  +YR   I +D    GA   D +  L       +     +         +T L +
Sbjct: 487 IQKVYARYRVTYIGVDTTGIGAGVFDSISTLFPREATAIHYSVSS---------KTRLVL 537

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           KM D +E   +   +    +  +  S++       G +  ++ R       D    + + 
Sbjct: 538 KMIDVVESGRIEWDASHKDIAMSCLSIRKTTTDTGGAITFKASRDNVTGHADVFFAIAHA 597

Query: 476 FAENP 480
               P
Sbjct: 598 VINEP 602


>gi|121606179|ref|YP_983508.1| hypothetical protein Pnap_3289 [Polaromonas naphthalenivorans CJ2]
 gi|120595148|gb|ABM38587.1| protein of unknown function DUF264 [Polaromonas naphthalenivorans
           CJ2]
          Length = 596

 Score =  114 bits (284), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/458 (11%), Positives = 105/458 (22%), Gaps = 39/458 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKG-AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
           E                     +   I   R IG T   A   L          +   A+
Sbjct: 147 EVQAAFRDSLFGHQKVWLRNGERTRMILKSRQIGATWYFAREALCDALATGRNQIFLSAS 206

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + +     ++L  +    +  +                       +  
Sbjct: 207 KAQAHIFKQYIQQFANEACGVTLSGDPIVLDNGAELHFLGTNARTAQGYHGNFYFDEFFW 266

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR-FWIMTSNP 230
             R     +  + +  H  +     +  +S   +   L       +R        +    
Sbjct: 267 THRFEELNKVASGMAMHKQWRKTYFSTPSSIQHEAYALWSGARFNKRRPKNERIALDLTH 326

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
            RL+G F               I      G D    + +   Y  +       +   F  
Sbjct: 327 ERLAGGFTGEDRVWR---NIVNILDAAAGGCDLFDIDELRLEYSTEE--FENLLMCGFID 381

Query: 291 QDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL---- 336
                F    + +  ++     + Y P          + +G D +  G     VVL    
Sbjct: 382 DTQSVFPMAELQKCMVDSWVDWEDYKPFTARPYGYRAVWVGYDPSHTGDTAGCVVLAAPL 441

Query: 337 --RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
                  +     W   D       I  +  ++    I ID    G      +       
Sbjct: 442 TPGGKFRVLERHQWRGLDFEAQAEAIRQITLRFNVQHIGIDTTGLGQGVYQLVSKFFPAA 501

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     +++  +  +  
Sbjct: 502 QSINYSVE---------VKTRLVLKAKSVISKGRLEFDAGAVDLAHAFLAIRRALTASGR 552

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
            +  ES R       D +   M+     P        R
Sbjct: 553 NVTFESGRSDDTGHADLAWACMHALDNEPLEGQTSANR 590


>gi|167753387|ref|ZP_02425514.1| hypothetical protein ALIPUT_01661 [Alistipes putredinis DSM 17216]
 gi|167658012|gb|EDS02142.1| hypothetical protein ALIPUT_01661 [Alistipes putredinis DSM 17216]
          Length = 472

 Score =  114 bits (284), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/406 (12%), Positives = 114/406 (28%), Gaps = 37/406 (9%)

Query: 90  KTTLNAWLVLWLMSTRPGISVICLANSETQLKT---TLWAEVSKWLSLLPNKHWFEMQSL 146
           K+      ++++    PG           +L+      + +V     +  +K +      
Sbjct: 64  KSWTGCTWLVFMSLCYPGTKWFIGREELKRLRESTLITFFKVCTQYGIKRDKDFKYNGQD 123

Query: 147 SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV 206
                   S +    L               E                   D        
Sbjct: 124 HYIQFANNSRIDLLDLRYLPSDPLYERYGSVEYTGGWIE--EGGEVNFGAYDTLKTRIGR 181

Query: 207 INLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID----TRTVEGID 262
                 G L          ++ NP++                   QI      +    I+
Sbjct: 182 HLNDKYGILR------KLFISCNPKKNWMHSTFYKPAKAGTLPGHQIYLAALVQDNPFIE 235

Query: 263 PSFHEGIIARYGLDSDVTRVEVCGQF-PQQDIDSFIPLNIIEEALNREPCPDPYAPLIMG 321
             + E + +    D       + G +    + ++    + I E               + 
Sbjct: 236 KDYIEALKSTT--DKVKKERLLKGNWDYDDNPNALCSYDNIREIFY-PKIHTRTGIKYIT 292

Query: 322 CDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIII--DANNT 379
            DIA  G D   +++  G  I     + ++        I  L  K+R     I  D +  
Sbjct: 293 ADIARFGSDRARILVWDGWAIIEQVSFDRSATTEIAACIESLAAKHRIPRYRIIADEDGV 352

Query: 380 GARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH------- 432
           G    D        +   +   + ++ E   N +T+   K+A+ +   ++          
Sbjct: 353 GGGVVDMCR-----ISGFVNNSQCLNGENFSNLQTQCGYKLANKINSFAISFDCELSDGQ 407

Query: 433 -SGLIQNLKSLKSFIVPNTGELAIESK---RVKGAKSTDYSDGLMY 474
              + + L+ L+++ V N  +L ++ K   +    +S D+ D L+ 
Sbjct: 408 KDEITEELEQLQTWNVDNDRKLFLKPKDEIKQDIGRSPDWRDALLM 453


>gi|307129625|ref|YP_003881641.1| hypothetical protein Dda3937_02574 [Dickeya dadantii 3937]
 gi|306527154|gb|ADM97084.1| Possible phage protein [Dickeya dadantii 3937]
          Length = 591

 Score =  114 bits (284), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/459 (12%), Positives = 128/459 (27%), Gaps = 55/459 (11%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 141 DAWADEHLFGYQKHLRTNLGQQVRNILK-----SRQIGATWYFAFEAFENAVLTGEPQIF 195

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A S  Q       EV +   +   + +F++                  +   +     
Sbjct: 196 LSA-SRAQA------EVFRSYIVNIAQQYFDITLTGNPIRLSNGAELRFLSTNKNTAQSY 248

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T               N 
Sbjct: 249 SGHLYCDEYFWVPNFARLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKRGNK 308

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  +       L      +       +    ++     G + +  E +  RY +D+   
Sbjct: 309 KRAGVNFPGFDELRDG-GRLCPDGQWRY-VITMEDAIRGGFNLASLEKLRNRYNVDT--F 364

Query: 281 RVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +     F       F   ++    ++ A  ++  P    P     +  G D A  G  +
Sbjct: 365 NMLYMCVFVDNKDAVFSFDDLERCGVDPATWQDHDPTAPRPFGNREVWGGYDPARSGDLS 424

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T+V++           +  + +W   + R   N+I  L ++Y    I ID    GA   +
Sbjct: 425 TLVIVAPPIYDGEKFRVLLVVNWHGMNFRYQANQIKKLFQRYHFTYIGIDVTGIGAGVFE 484

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSG---LIQNLKS 441
            ++             R           +  L +K AD +E   +        +  +  +
Sbjct: 485 NIQ---------HFAMRQATAIRYGVETKNRLVMKAADVVESQRIEWDQDEKAIPASFMA 535

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ++     +   +   + R       +    + +     P
Sbjct: 536 IRRTTTASGNAMTFIADRSAETGHAEAFFAIAHALDNEP 574


>gi|212709268|ref|ZP_03317396.1| hypothetical protein PROVALCAL_00303 [Providencia alcalifaciens DSM
           30120]
 gi|212688180|gb|EEB47708.1| hypothetical protein PROVALCAL_00303 [Providencia alcalifaciens DSM
           30120]
          Length = 585

 Score =  114 bits (284), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/457 (12%), Positives = 113/457 (24%), Gaps = 44/457 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            E              +   +     I   R IG T   A        T     +   A+
Sbjct: 134 EEIFRQNMFGYQKVWYSAGHKHRIRNILKSRQIGATYFFAREAFMDALTTGRNQIFLSAS 193

Query: 116 SETQLKTTLWAEVSKWLSLLPNKHW-----FEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
                       +      +              +                  +    Y 
Sbjct: 194 KAQA--HVFKGYIIDMAREVDVDLKGDPIVLPNGATLYFLGTNARTAQSYHGNLYLDEYF 251

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
            + +     +  + +  H  +     +  +S T         G L  R   +   +  + 
Sbjct: 252 WIPKFQELRKVASGMAMHKKWRQTYFSTPSSLTHSAYPFW-SGKLFNRGRRKAEHVDVDV 310

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
              +     +            ++     G D    E +   Y  D       +  +F  
Sbjct: 311 SHQALVNGMVCADGQWRQIV-TVEDAIRGGCDLFEIEQLSLEYSPDE--FENLLMCEFVD 367

Query: 291 QDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAE--EGGDNTVVVL- 336
               S   L ++++ +                P  Y P+ +G D A+  + GD+   V+ 
Sbjct: 368 DIA-SIFNLQLMQKCMVDSWEVWNDVQPLMVRPYAYHPVWIGYDPAKGTQNGDSAGCVVV 426

Query: 337 ------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
                      I     W   D R   N I  L E+Y    I ID+   G      +   
Sbjct: 427 APPLRAGDKFRILEHHQWRGMDFRAQANAIKELTERYNVQYIGIDSTGIGHGVLQNVRDF 486

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIV 447
                  +              +  L +K  D +    L   +    + Q+  +++    
Sbjct: 487 FPAAKEFVYNPA---------LKNALVLKAYDVISHDRLEYDAGCNDITQSFMAIRRATT 537

Query: 448 PNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
            +      E+ R + A   D +   M+     P   +
Sbjct: 538 ASGNRPTYEADRSEEASHADLAWATMHALYNEPITGE 574


>gi|238027628|ref|YP_002911859.1| Bbp25 [Burkholderia glumae BGR1]
 gi|237876822|gb|ACR29155.1| Bbp25 [Burkholderia glumae BGR1]
          Length = 486

 Score =  113 bits (283), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 72/217 (33%), Gaps = 21/217 (9%)

Query: 290 QQDIDSFIPLNIIEEALNREPCPD-PYAPLI-MGCDIAEEGGDNTVVVLRRGPVIEHLFD 347
           + D    IP   +  A  R      P  P+  +G D+A  G D ++   R G   +    
Sbjct: 273 EDDPWQVIPSEWVRLAQERWRARSRPRIPMTALGVDVARGGQDQSIYTPRYGNWFDEQVC 332

Query: 348 WSKTDLRTTNNKISGLVE-KYRPDAIIIDANNTGARTCDYLEM-LGYHVYRVLGQKRAVD 405
                          +   +     + +D    GA   D +   +G  ++ + G  R  +
Sbjct: 333 QPGLATPDGFVVAQQVFNLREPSTLVNLDVVGVGASPFDIIHQVIGDKIWGISGAARTDE 392

Query: 406 LEF-----CRNRRTELHVKMADWL-----EFASLINHSGLIQNLKSLKSFIVPNTGELAI 455
           L+        N R  L  +M + L     E  ++     L  +L + +    P    + +
Sbjct: 393 LDMSGQFGFVNLRALLWWRMREALDPINGEDLAIPPDPALAADLCAPRYRKAPRG--ILV 450

Query: 456 ESK---RVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           ESK   + +  +S D  D  +Y            FG 
Sbjct: 451 ESKEEIKKRIGRSPDRGDSAVYAL--PERSGGFAFGS 485


>gi|226953564|ref|ZP_03824028.1| possible ATPase terminase subunit [Acinetobacter sp. ATCC 27244]
 gi|226835689|gb|EEH68072.1| possible ATPase terminase subunit [Acinetobacter sp. ATCC 27244]
          Length = 374

 Score =  113 bits (283), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/369 (11%), Positives = 91/369 (24%), Gaps = 36/369 (9%)

Query: 149 HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVIN 208
                Y         +              E+  + +  H+ +     +  +S T +   
Sbjct: 21  FLGTNYRTAQGPHGNLYFDEIFWTYGFDELEKVASGMATHDKWRKTYFSTPSSITHEAYK 80

Query: 209 LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEG 268
                   +                         +  +D    QI T             
Sbjct: 81  FWTGTRFNKGKPKDQQFKI-----DLSHKALKHGRVCEDLMWRQIVTVEDAKEGGCDLFN 135

Query: 269 IIARYGLDSDV-TRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY-----------A 316
           I       S          +F       F PL++++  +                     
Sbjct: 136 IERLKFEYSPEDFANLFMCEFVDDGQSMF-PLSMLQICMVDTLEIWNDFKIWHNRPFSNK 194

Query: 317 PLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPD 370
           P+ +G D A  G +  +VV+           +     +   D      +I  +  +Y   
Sbjct: 195 PVWIGYDPALTGDNAGLVVVAPPAVAGGKFRVLEKHQFKGDDFSEQAERIRAITLRYNVT 254

Query: 371 AIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLI 430
            I ID    G    + +      +                  +++L  K  D +    L 
Sbjct: 255 YIGIDTTGMGYGVAELVRAFFPALTTFNYSPE---------VKSQLVYKTLDVIRNGRLE 305

Query: 431 NHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDF 487
             +    L Q+L S+K  +  +  ++   + R +     D +  LM+     P     + 
Sbjct: 306 FDAGDKDLAQSLMSIKKTLTSSQKQITFSAGRSEETGHADLAWALMHAIYNEPLAGITET 365

Query: 488 GRCPSYQYE 496
                  Y 
Sbjct: 366 NTSMVEIYS 374


>gi|258544092|ref|ZP_05704326.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
 gi|258520720|gb|EEV89579.1| probable terminase (atpase subunit) related protein
           [Cardiobacterium hominis ATCC 15826]
          Length = 562

 Score =  113 bits (283), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 58/450 (12%), Positives = 125/450 (27%), Gaps = 40/450 (8%)

Query: 56  LEFMEV-VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
                  +  H +    +      +  + + R IG T   A   L       G + I ++
Sbjct: 109 KRAFRERMYPHQMAWYEHSKKYEMRQYVKS-RQIGATYYFAQEALLTAL-ETGKNQIFIS 166

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK-----HY 169
            S++Q        ++    +L  +   E   LS     ++      +    S       Y
Sbjct: 167 ASKSQAHIFRSNIIAFVDEVLGVQLKGEHIKLSPGTTLYFLGTNSNTAQSYSGDLYIDEY 226

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + +    +     +  H+   +   +  ++ T +   L       +       I    
Sbjct: 227 FWIPQFKKIQHVAAGMTVHDDRRITYFSTPSTVTHEAYPLWTGAEFNKGRPKSEHIDLDV 286

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
             +         +          I+     G D    E +  ++          +  QF 
Sbjct: 287 SHKALKDGRLCEDGYFRQ--VITIEDAINSGFDRVTMEKLRIKFPPG--QFENLLMCQFV 342

Query: 290 QQDIDSFIPLNIIEEALNRE----------PCPDPYAPLIMGCDIAEEGGDNTVVVL--- 336
                 F    +    ++            P P   AP+ +G D +    D ++VV+   
Sbjct: 343 NDTDSIFKMAELQRCMVDAWTLWKDYTPLAPRPLDDAPVWIGYDPSRSQDDASLVVIAPP 402

Query: 337 -RRGPVIEHLF--DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYH 393
              G V   +    ++  D      KI      Y    I IDA   G    D +      
Sbjct: 403 RVEGGVFRIVDKQSFNGLDFDGQAQKIREFCAIYNVANIAIDATGIGQAVYDLVRQ---- 458

Query: 394 VYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNT 450
                   RA  + +    + E+ +K    +    L   +    +     ++      + 
Sbjct: 459 -----FYPRARKIIYTVEAKNEMVLKAKQLIHHGRLQWDAGWTDIAHAFLTIHQAQTGSG 513

Query: 451 GELAIESKRVKGAKSTDYSDGLMYTFAENP 480
            ++  ++ R       D +   M+    +P
Sbjct: 514 RQVTYKANRTAATGHADLAWATMHALINDP 543


>gi|120599697|ref|YP_964271.1| hypothetical protein Sputw3181_2900 [Shewanella sp. W3-18-1]
 gi|120559790|gb|ABM25717.1| protein of unknown function DUF264 [Shewanella sp. W3-18-1]
          Length = 602

 Score =  113 bits (283), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/475 (12%), Positives = 125/475 (26%), Gaps = 64/475 (13%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
             +Q +  E +     N             I   R IG T   A              + 
Sbjct: 159 FEYQKKMHENLHQRIRN-------------ILKSRQIGATYYFAGEAFEQAVLTGDPQIF 205

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS--------------LHPAPWYSDV 157
             A S +Q       EV +   +     +FE++                    +      
Sbjct: 206 LSA-SRSQA------EVFRSYIIAIAHEFFEIELTGNPIVLNTAHGAAELRFLSTNSKTA 258

Query: 158 LHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTE 217
                 +    Y  + +     +  + +  H+ +     +  ++               +
Sbjct: 259 QSYHGHVYVDEYFWIGKFDVLNKLASAMATHSNWRKTYFSTPSTKAHPAYPFWTGDHWRK 318

Query: 218 RNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDS 277
               R  I      ++      +       +    I+     G +    + +   Y  D 
Sbjct: 319 GKPEREEIEFPTFDQMRDG-GRVCPDKQWRY-VVTIEDALAGGCELFDIDELRDEYNGDD 376

Query: 278 DVTRVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEG 328
                     F       F   ++    +E A  ++  P    P     + +G D +   
Sbjct: 377 --FANLFMCIFVDDADSVFKFSDLEKCMVEAARWQDYKPAAPRPFGNREVWLGYDPSRTR 434

Query: 329 GDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
            +  + V+           +     W   +      +I  +  KYR   I +D    GA 
Sbjct: 435 DNAVLAVVAPGEKKGEKFRVLERHRWRGMNFAHHVAEIQKIYAKYRVTYIGVDTTGIGAG 494

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNL 439
             D +  L            A  + +    +T L +KM D +E   +   +    +  + 
Sbjct: 495 VFDSISTLYPR--------EATAIHYSVGSKTRLVLKMIDVVEGGRIEWDAGLKDIAMSF 546

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
            S++  +  + G +  ++ R       D    + +     P   +       + Q
Sbjct: 547 LSIRRTVTDSGGAITFKASRDNVTGHADDFFAISHAVINEPLNYEHKRTSSWAMQ 601


>gi|271499312|ref|YP_003332337.1| hypothetical protein Dd586_0742 [Dickeya dadantii Ech586]
 gi|270342867|gb|ACZ75632.1| protein of unknown function DUF264 [Dickeya dadantii Ech586]
          Length = 591

 Score =  113 bits (282), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 56/459 (12%), Positives = 125/459 (27%), Gaps = 55/459 (11%)

Query: 52  RSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
            +W  E +     H   ++      + K      R IG T   A+             + 
Sbjct: 141 DTWADEHLFGYQKHLRANLGKQVRNILK-----SRQIGATWYFAFEAFENAVLTGEPQIF 195

Query: 112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHC 160
             A S  Q       EV +   +   + +F++                  +   +     
Sbjct: 196 LSA-SRAQA------EVFRSYIVNIAQQYFDITLTGNPIRLSNGAELRFLSTNKNTAQSY 248

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           S  +    Y  +          + +  H+ +     +  ++ T               N 
Sbjct: 249 SGHLYCDEYFWVPNFAHLNEVASAMATHDKWRTTYFSTPSAKTHQAYPFWTGEEWKRGNK 308

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
            R  +       L      +       +    ++     G + +  E +  RY +D+   
Sbjct: 309 KRAGVNFPGFDELRDG-GRLCPDGQWRY-VITMEDAIRGGFNLASLEKLRNRYNVDT--F 364

Query: 281 RVEVCGQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDN 331
            +     F       F   ++    ++ A  ++  P    P     +  G D A  G  +
Sbjct: 365 NMLYMCVFVDNKDAVFSFDDLERCGVDPATWQDHDPTAPRPFGNREVWGGYDPARSGDLS 424

Query: 332 T------VVVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
           T       +       +  + +W   + R   N+I  L ++Y    I ID    GA   +
Sbjct: 425 TFVIVAPPIYEGEKFRVLLVVNWHGMNFRYQANQIKKLFQRYHFTYIGIDVTGIGAGVFE 484

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHSG---LIQNLKS 441
            ++             R           +  L +K AD +E   +        +  +  +
Sbjct: 485 NIQ---------HFAMRQATAIRYGVETKNRLVMKAADVVESQRIEWDQDEKAIPASFMA 535

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           ++     +   +   + R       +    + +     P
Sbjct: 536 IRRTTTASGNAMTFIADRSAETGHAEAFFAIAHALDNEP 574


>gi|163801735|ref|ZP_02195633.1| hypothetical protein 1103602000597_AND4_09782 [Vibrio sp. AND4]
 gi|159174652|gb|EDP59454.1| hypothetical protein AND4_09782 [Vibrio sp. AND4]
          Length = 546

 Score =  113 bits (282), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 55/462 (11%), Positives = 121/462 (26%), Gaps = 45/462 (9%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E +        N+++     + K      R IG T   +   L          +   A S
Sbjct: 105 ESLFEYQHTMRNNLHQRTRNILK-----SRQIGATYYFSGEALEDAILTGDNQIFLSA-S 158

Query: 117 ETQLK-----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             Q +         A+    + L  N       +     +            +    Y  
Sbjct: 159 RAQAEVFRSYIIAIAQSFLGIELTGNPIILSNGAELRFLSTNSKTAQSYHGHVYVDEYFW 218

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  ++ T                  R  I      
Sbjct: 219 IPKFDELNKLASAMATHKNWRKTYFSTPSAKTHQAYTFWTGDQWRRGRDTRANIEFPTFD 278

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
               +                I+     G +    + +   Y  D           F   
Sbjct: 279 --EYRDGGRLCPDKQWRYVVTIEDAAAGGCELFDIDELRDEYSKDD--FDNLFMCIFVDG 334

Query: 292 DIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVLR----- 337
               F    +    ++ +  ++  P+   P     + +G D +    +  +VV+      
Sbjct: 335 ASSVFKFSALEKAMVDISRWQDFKPNDNDPFERREVWLGYDPSRTRDNACLVVVAPPVIA 394

Query: 338 -RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   + +    ++S + E+Y    + ID    GA   D L         
Sbjct: 395 IEKFRVLEKHYWRGLNFQYQAQQVSKVFERYNVSYLGIDTTGIGAGVYDLLSKK------ 448

Query: 397 VLGQKRAVDLEFCRNR-RTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGE 452
                R        N  +  L +KM D +E   +   +    +     ++K     +   
Sbjct: 449 ---HPRETVAIQYSNESKNRLVMKMIDVVEANRIQFDAEHKDIAMAFMAIKRATTNSGNS 505

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
           +  +++R +     D    + +     P   D    R  ++Q
Sbjct: 506 MTFKAERSELTGHADAFWAISHACINEP--LDHTAKRKSTWQ 545


>gi|323978427|gb|EGB73511.1| terminase [Escherichia coli TW10509]
          Length = 595

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 50/446 (11%), Positives = 121/446 (27%), Gaps = 43/446 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           +         +       + K      R IG T   A+             +   A+  +
Sbjct: 153 LFAYQLRLRENKFRRVRNLLK-----SRQIGATYYFAFEAFEDAVLTGDTQIFLSASKRQ 207

Query: 118 TQLKTTLWAEVSKWLSLLPNKH---WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            ++  T   ++++    +P K         +     A   +     S  +    Y  +  
Sbjct: 208 AEVFRTYIVKIAQTEFGIPIKGNPVKLSNLAELYFLATNSNTAQSNSGHLYIDEYLWIPG 267

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +  H+ + +   +  +S T             + +  R  +   +   L 
Sbjct: 268 FRRLNEVASGMATHSHWRITYFSTPSSKTHQGYPFWSGDEWRKGDPKRKGVEFPSFDELR 327

Query: 235 GKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
               E    P   W+    ++     G + +    +  RY        +     F     
Sbjct: 328 DGGREC---PDGQWRYVVTLEDAIAGGFNLADINELRERYNE--TAFNMLFMCVFVDDKE 382

Query: 294 DSFIPLNIIEEALN---------REPCPDPYAPLIMGCDIAEEGGDNTVVVL------RR 338
             F   +++   ++          +  P     +  G D A  G + T VVL        
Sbjct: 383 SVFKFDDLVRCGVDVSTWEDFHPEDAMPFGNREVWGGFDPARSGDNATFVVLSPPLVAAE 442

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
              +     W     +    +I  +  +Y    I ID    G    + ++          
Sbjct: 443 RFRVLEKHHWRSMSFQFMAERIRSIKARYNMTFIGIDVTGLGYGVFELVQG--------- 493

Query: 399 GQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELA 454
             +R           +  L +KM D +    +        +  +  +++     +  ++ 
Sbjct: 494 FARRETVAIHYSVESKNRLVMKMLDLIYANRIEWDEEATDIPASFLAIRQESTNSGNKVT 553

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENP 480
             ++R +     D    + +  +  P
Sbjct: 554 FTAERSEETGHADIFFAIAHAASNEP 579


>gi|188495109|ref|ZP_03002379.1| terminase [Escherichia coli 53638]
 gi|188490308|gb|EDU65411.1| terminase [Escherichia coli 53638]
          Length = 607

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 56/476 (11%), Positives = 135/476 (28%), Gaps = 64/476 (13%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
            +     +     +     + K     GR  G T   AW             +   A+  
Sbjct: 154 HLFEYQQYVREHGDELFRFILK-----GRQEGFTYYFAWEGFEKAVLTGKNQIFFSASKP 208

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQ-----------SLSLHPAPWYSDVLHCSLGIDS 166
                   AEV ++  L   + +F ++           ++    A   +     S  +  
Sbjct: 209 Q-------AEVFRFYILSIAQQFFGVELKGNPIRLSNGAILRFLATNPNTAQSYSGDLYG 261

Query: 167 KHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
                + +        + +  H+ + +   +  ++ T     L         +  R    
Sbjct: 262 DEVFWISKFARLHEVASAMATHDEFRITYFSTPSTKTHQAYRLWTGDEWKGDDPKRKAAE 321

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCG 286
               + L  K  ++    +  +     D            E +  RY   +    +    
Sbjct: 322 FPTSKELR-KGGQVCPDGIWRYVITMEDACAKGLSARVNIEKLRNRYS--ATAFAMLYMC 378

Query: 287 QFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL- 336
           +F       F   ++    +E  + ++  P    P     +  G D +  G ++T V++ 
Sbjct: 379 EFTDSRDTVFKFSDLEKCEVEFGIWQDFDPSALRPFGNREVWGGFDPSRTGDNSTFVIVA 438

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL-EML 390
                +    +  ++ W   +      +I  L+++YR   I +D    G    D L    
Sbjct: 439 PPVEPKEKFRVLAVYQWVGLNFTWQVKQIEELMKRYRFTHIGVDITGIGRGVYDQLVRSA 498

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQN-----------L 439
              V  +       +          L +KM D +E   +      +              
Sbjct: 499 PREVMGINYSVDNKNK---------LVLKMIDLIERRRIQWVKDAVDEVTKERADIPLAF 549

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
            +++  +  +   +   ++R +     D    + +     P   D ++ R   + +
Sbjct: 550 MAIRRVMTASQNAMTFAAERSETTGHADVFFAISHAVCNEP--LDYEYDRPSVWAF 603


>gi|152985800|ref|YP_001350388.1| hypothetical protein PSPA7_5052 [Pseudomonas aeruginosa PA7]
 gi|152986886|ref|YP_001346099.1| hypothetical protein PSPA7_0704 [Pseudomonas aeruginosa PA7]
 gi|150960958|gb|ABR82983.1| conserved hypothetical protein, putative [Pseudomonas aeruginosa
           PA7]
 gi|150962044|gb|ABR84069.1| conserved hypothetical protein, putative [Pseudomonas aeruginosa
           PA7]
          Length = 682

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 60/449 (13%), Positives = 116/449 (25%), Gaps = 44/449 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN--- 115
           M         +  NP     +  I   R IG T   A              +   A+   
Sbjct: 152 MFGYQLELFAAKKNPLTARIR-HILKSRQIGLTYYFAAEAFMDAVLTGDNQIFLSASRAQ 210

Query: 116 -----SETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
                S        W ++    + +      +  +     +   +        +      
Sbjct: 211 SEVFRSYIVAFAAQWFDIELSGNPIILSKDGKPWAELRFLSTNSNTAQSYHGHVYIDEVF 270

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
            +      +   + +  H  + +   +  ++ T              RN+ R       P
Sbjct: 271 WIPNFQKLQTVASAMASHAKWRLTYFSTPSAVTHQAYPYWTGEEF--RNSKRGKKAGPWP 328

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
                    +        K   I      G +    E +   Y  D +        +F  
Sbjct: 329 SEAQIHAGALCPDGQWR-KVITIQDAIAGGCNLFDLERLQLEY--DEERFEQLFMCKFID 385

Query: 291 QDIDSFIPLNIIEEALNR---EPCPDPY-------APLIMGCDIAEEGGDNTVVVL---- 336
               +F  L  +E   +        DP         P+ +G D +    D T VV+    
Sbjct: 386 STQAAF-ALADLERCYSDLGLWTDYDPDSPRPFDNRPVWLGYDPSRTRDDATCVVVAPPL 444

Query: 337 --RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
                  I     W  T       +I  L E++    I ID    G    D ++      
Sbjct: 445 EPGGKFRILEKHSWRGTSFTHQAKQIEKLCERFNVQHIGIDITGVGYGVFDLVKDFFPRA 504

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +     A +          L +K  D ++   +   +    +     S+K      +G
Sbjct: 505 TPIHYSLEAKNA---------LVLKAQDVIQGKRIEWDAGWTEVAAAFLSIKR-GTTASG 554

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENP 480
            +   + R +     D +  +M+  A  P
Sbjct: 555 LITYSASRTEATGHADVAWSIMHALAHEP 583


>gi|194436023|ref|ZP_03068125.1| putative conserved hypothetical protein [Escherichia coli 101-1]
 gi|194424751|gb|EDX40736.1| putative conserved hypothetical protein [Escherichia coli 101-1]
          Length = 595

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 51/446 (11%), Positives = 120/446 (26%), Gaps = 43/446 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           +         +       + K      R IG T   A+             +   A+  +
Sbjct: 153 LFAYQLRLRENKFRRVRNLLK-----SRQIGATYYFAFEAFEDAVLTGDTQIFLSASKRQ 207

Query: 118 TQLKTTLWAEVSKWLSLLPNKH---WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            ++  T   ++++    +P K         +     A   +     S  +    Y  +  
Sbjct: 208 AEVFRTYIVKIAQTEFGIPIKGNPVKLSNLAELYFLATNSNTAQSNSGHLYIDEYLWIPG 267

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +  H  + +   +  +S T             + +  R  +   +   L 
Sbjct: 268 FRRLNEVASGMATHKHWRITYFSTPSSKTHQGYPFWSGDEWRKGDPKRKGVEFPSFDELR 327

Query: 235 GKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
               E    P   W+    ++     G + +    +  RY        +     F     
Sbjct: 328 DGGREC---PDGQWRYVVTLEDAIAGGFNLADINELRERYNE--TAFNMLFMCVFVDDKE 382

Query: 294 DSFIPLNIIEEALN--REPCPDPYAPL-------IMGCDIAEEGGDNTVVVLR------R 338
             F   +++   ++        P  P+         G D A  G + T VVL        
Sbjct: 383 SVFKFDDLVRCGVDVSTWEDFHPEEPMPFGNREVWGGFDPARSGDNATFVVLAPPLVSAE 442

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
              +     W     +    +I  +  +Y    I ID    G    + ++          
Sbjct: 443 RFRVLEKHHWRSMSFQFMAERIRSIKARYNMTFIGIDVTGLGYGVFELVQG--------- 493

Query: 399 GQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELA 454
             +R           +  L +KM D +    +        +  +  +++     +  ++ 
Sbjct: 494 FARRETVAIHYSVESKNRLVMKMLDLIYANRIEWDEEATDIPASFLAIRQESTNSGNKVT 553

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENP 480
             ++R +     D    + +  +  P
Sbjct: 554 FTAERSEKTGHADIFFAIAHAASNEP 579


>gi|170769336|ref|ZP_02903789.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170121988|gb|EDS90919.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 595

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 51/446 (11%), Positives = 120/446 (26%), Gaps = 43/446 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-E 117
           +         +       + K      R IG T   A+             +   A+  +
Sbjct: 153 LFAYQLRLRENKFRRVRNLLK-----SRQIGATYYFAFEAFEDAVLTGDTQIFLSASKRQ 207

Query: 118 TQLKTTLWAEVSKWLSLLPNKH---WFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            ++  T   ++++    +P K         +     A   +     S  +    Y  +  
Sbjct: 208 AEVFRTYIVKIAQTEFGIPIKGNPVKLSNLAELYFLATNSNTAQSNSGHLYIDEYLWIPG 267

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +  H  + +   +  +S T             + +  R  +   +   L 
Sbjct: 268 FRRLNEVASGMATHKHWRITYFSTPSSKTHQGYPFWSGDEWRKGDPKRKGVEFPSFDELR 327

Query: 235 GKFYEIFNKPLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
               E    P   W+    ++     G + +    +  RY        +     F     
Sbjct: 328 DGGREC---PDGQWRYVVTLEDAIAGGFNLADINELRERYNE--TAFNMLFMCVFVDDKE 382

Query: 294 DSFIPLNIIEEALN--REPCPDPYAPL-------IMGCDIAEEGGDNTVVVLR------R 338
             F   +++   ++        P  P+         G D A  G + T VVL        
Sbjct: 383 SVFKFDDLVRCGVDVSTWEDFHPEEPMPFGNREVWGGFDPARSGDNATFVVLAPPLVSAE 442

Query: 339 GPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVL 398
              +     W     +    +I  +  +Y    I ID    G    + ++          
Sbjct: 443 RFRVLEKHHWRSMSFQFMAERIRSIKARYNMTFIGIDVTGLGYGVFELVQG--------- 493

Query: 399 GQKRAVDLEFCR-NRRTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGELA 454
             +R           +  L +KM D +    +        +  +  +++     +  ++ 
Sbjct: 494 FARRETVAIHYSVESKNRLVMKMLDLIYANRIEWDEEATDIPASFLAIRQESTNSGNKVT 553

Query: 455 IESKRVKGAKSTDYSDGLMYTFAENP 480
             ++R +     D    + +  +  P
Sbjct: 554 FTAERSEKTGHADIFFAIAHAASNEP 579


>gi|118590957|ref|ZP_01548357.1| hypothetical protein SIAM614_19891 [Stappia aggregata IAM 12614]
 gi|118436479|gb|EAV43120.1| hypothetical protein SIAM614_19891 [Stappia aggregata IAM 12614]
          Length = 526

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 43/275 (15%), Positives = 95/275 (34%), Gaps = 27/275 (9%)

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLD-SDV 279
              W+    P  + G+            + F    R       + ++  + +        
Sbjct: 230 RTVWVDGPEPVEIEGEIRT------PKSRTFIPARRQDNRFLGTDYDAQLDQMPEPMRTA 283

Query: 280 TRVEVCGQFPQQDIDSFIPLNIIEEALNR-EPCPDPYAPL-IMGCDIAEEGGDNTVVVLR 337
            +        Q      IP + ++ A  R +   D   P+ ++  D+A+ G D TV+   
Sbjct: 284 LKTGDFLAARQDHEWQVIPSDWVDLAFERYDQGIDRDEPMTVLAVDVAQGGKDRTVLQPL 343

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDA--NNTGARTCDYL-EMLGYHV 394
            G   E       TD +   +  S ++ + R +A+I+       G  T  +L        
Sbjct: 344 HGRRFETNIVRKGTDTKDGADVGSLIIRERRDNAMIVVDCTGGWGGDTVGFLKRENNIPA 403

Query: 395 YRVLGQKRAVDLEF-----CRNRRTELHVKMADWLE-----FASLINHSGLIQNLKSLKS 444
            + +   ++ +          N R EL+ ++ + L        ++   + +   L + + 
Sbjct: 404 EKCVFSAQSGERAKDSRIPFYNLRAELYWRLREALHPKSGLGLAIRRSATVKAQLTAHRW 463

Query: 445 FIVPNTGELAIESK---RVKGAKSTDYSDGLMYTF 476
            +    G++ IESK   + +   S D +D ++   
Sbjct: 464 KM--RNGKILIESKEEIKDRLGSSPDEADAIVEAL 496


>gi|187939507|gb|ACD38655.1| terminase ATPase subunit [Pseudomonas aeruginosa]
          Length = 593

 Score =  113 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/435 (12%), Positives = 106/435 (24%), Gaps = 51/435 (11%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ----------LKTTLWAEVSKW 131
           I   R IG T   A   L          +   A+               +  +  E+   
Sbjct: 169 ILKSRQIGATFYFAREALIDALETGRNQIFLSASKAQAHIFKAYIQAFARDAVGVELKGD 228

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
             +LPN         +   A  Y    +         +    +     +  + +     Y
Sbjct: 229 PIILPNGAELHFLGTNARTAQGYHGNFYFD------EFFWTFKFKELNKVASGMAMQKRY 282

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF 251
                +  +S   +           +       I             +      D   R 
Sbjct: 283 RRTYFSTPSSMAHEAYTFWTGERFNKGKPAADRIKIDVGHDA----LQQGRLCEDRIWRQ 338

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
            +     E       +    R   D++  +  +  QF      S  PL +++  +     
Sbjct: 339 IVTILDAEARGCDLFDIDELRLEYDAEAFQNLLMCQFVDD-GASIFPLTMLQPCMVDSWD 397

Query: 312 PD------------PYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDL 353
                             + +G D AE G    +VV+           +     +   D 
Sbjct: 398 LWSEDYKPFALRPFGDRQVWLGYDPAETGDTAGLVVVAPPAVPGGKFRVLERHQFRGKDF 457

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                 I  + ++Y    I +D    G+     +      V                  +
Sbjct: 458 AEQAEFIRKVTQRYWVTYIGVDTTGMGSGVAQLVRQFFPGVRTFSYSPE---------VK 508

Query: 414 TELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSD 470
           T+L +K    ++   L   +    L Q L +++  I     +    + R       D + 
Sbjct: 509 TQLVMKAWSVIKNGRLEFDAGWTDLAQALMAIRKTITAGGRQFTYTAGRNDNTGHADLAW 568

Query: 471 GLMYTFAENPPRSDM 485
            L +     P     
Sbjct: 569 ALFHALQNEPLEGQT 583


>gi|317152167|ref|YP_004120215.1| hypothetical protein Daes_0447 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942418|gb|ADU61469.1| hypothetical protein Daes_0447 [Desulfovibrio aespoeensis Aspo-2]
          Length = 590

 Score =  113 bits (281), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 60/467 (12%), Positives = 128/467 (27%), Gaps = 66/467 (14%)

Query: 53  SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
            +Q E  +  + H + +            I   R IG T   A              +  
Sbjct: 148 EYQHELRQAKETHRVRN------------ILKSRQIGATWYFAQEAFEDACLSGDNQIFL 195

Query: 113 LANSETQLKTTLWAEVSKWLSLL----------PNKHWFEMQSLSLHPAPWYSDVLHCSL 162
            A +  Q      A +   +                H    Q+     +           
Sbjct: 196 SA-TRRQA-DVFRAYIVAIVKEKFDIELKGKDEIVLHTAHGQATLYFLSNNSKSAQSYHG 253

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +    Y  + +     +  + +  H  + + + +  ++ T +  +L       +R + +
Sbjct: 254 HVYIDEYFWITKFNELYKVASAMAAHKKWRITLFSTPSAVTHEAYDLWTGDRFNKRWSRQ 313

Query: 223 FWIMTSNPRRLSGKFYEIFNK----PLDDWK-RFQIDTRTVEGIDPSFHEGIIARYGLDS 277
                   +R     +E   +    P   W+    I      G D    E +  +Y  D 
Sbjct: 314 A-------KRKEFPSFEAMQRGVVCPDKVWRKVITIKDAEAGGCDLFDFEDLNLQYSTDE 366

Query: 278 DVTRVEVCGQFPQQDIDSFI--PLNIIEEALNREPCPDPYA-------PLIMGCDIAEEG 328
              R     +F       F    L      ++     +P A       P+  G D +   
Sbjct: 367 --FRNLFMCEFVDDLQAVFRLHNLEACYGDMDEWTDFNPDAARPFGNLPVWGGYDPSRNR 424

Query: 329 GDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
            D + V+L           +   + W          +I  L +++    I ID    G  
Sbjct: 425 DDASFVILAPPLQPGGMFRVLARYKWVDKSYTWQAQRIKELTQQFNFVHIGIDVTGPGIG 484

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNL 439
             + ++        +    +          +T L +K  D +E   +   +    +    
Sbjct: 485 VFESVQAFFPAAMPITYGVQT---------KTTLVLKAKDVIESGRIQWDASLTDIAHAF 535

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMD 486
            +++       G +   + R +     D +  +M+  A  P  S   
Sbjct: 536 LTIRQ-GTTGNGMITYSAGRTEATGHADVAWAIMHALANEPLNSQHQ 581


>gi|148807391|gb|ABR13464.1| predicted ATPase terminase subunit [Pseudomonas aeruginosa]
          Length = 593

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/435 (12%), Positives = 106/435 (24%), Gaps = 51/435 (11%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ----------LKTTLWAEVSKW 131
           I   R IG T   A   L          +   A+               +  +  E+   
Sbjct: 169 ILKSRQIGATFYFAREALIDALETGRNQIFLSASKAQAHIFKAYIQAFARDAVGVELKGD 228

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
             +LPN         +   A  Y    +         +    +     +  + +     Y
Sbjct: 229 PIILPNGAELHFLGTNARTAQGYHGNFYFD------EFFWTFKFKELNKVASGMAMQKRY 282

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF 251
                +  +S   +           +       I             +      D   R 
Sbjct: 283 RRTYFSTPSSMAHEAYTFWTGERFNKGKPAADRIKIDVSHDA----LQQGRLCEDRIWRQ 338

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
            +     E       +    R   D++  +  +  QF      S  PL +++  +     
Sbjct: 339 IVTILDAEARGCDLFDIEELRLEYDAEAFQNLLMCQFVDD-GASIFPLTMLQPCMVDSWD 397

Query: 312 PD------------PYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDL 353
                             + +G D AE G    +VV+           +     +   D 
Sbjct: 398 LWSEDYKPFALRPFGDRQVWLGYDPAETGDTAGLVVVAPPAVPGGKFRVLERHQFRGKDF 457

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                 I  + ++Y    I +D    G+     +      V                  +
Sbjct: 458 AEQAEFIRKVTQRYWVTYIGVDTTGMGSGVAQLVRQFFPGVRTFSYSPE---------VK 508

Query: 414 TELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSD 470
           T+L +K    ++   L   +    L Q L +++  I     +    + R       D + 
Sbjct: 509 TQLVMKAWSVIKNGRLEFDAGWTDLAQALMAIRKTITAGGRQFTYTAGRNDNTGHADLAW 568

Query: 471 GLMYTFAENPPRSDM 485
            L +     P     
Sbjct: 569 ALFHALQNEPLEGQT 583


>gi|220903520|ref|YP_002478832.1| hypothetical protein Ddes_0239 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867819|gb|ACL48154.1| protein of unknown function DUF264 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 615

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/438 (13%), Positives = 116/438 (26%), Gaps = 44/438 (10%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ------LKTTLWAEVSKWLSLLP-N 137
            R +G T   A              +   A           ++          L   P  
Sbjct: 195 ARQLGFTWFFAQEAFEDAVLNGDNQIFLSATRAQSEIFLHYIRDICGEAFDIELKGNPLV 254

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
            H  +  +     A            +    +  M +     +  + +  H  +   + +
Sbjct: 255 LHTAKGPATLYFLATSSRSAQGYHGHVYGDEFFWMPKFKEFWKVASGMAAHAKWRRTMFS 314

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
             +  T +            R  N        P + + +   I     D+  R  +    
Sbjct: 315 TPSIITHEAYPRWSGKEYLSRFKNPA----PWPDKAALRQGLICP---DNTYRRIVTLDD 367

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALN---------R 308
            E    +             +  R     +F    +  F+ L ++E  +          R
Sbjct: 368 AEAGGCNLFNRADLEQEYSPEDMRQLFGCEFIDDTLAVFL-LGLLEGCMEDPDGWGIDLR 426

Query: 309 EPCPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISG 362
           +  P   A +  G D +    D + VVL                 W          +I  
Sbjct: 427 QARPVDNAGVWGGYDPSRTRDDASFVVLLPPQKAGDKIRTLERHTWKGKSYLWQVGRIRE 486

Query: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMAD 422
           L +KYR   + ID    G    + +  L   V   +    A         +  L +K  +
Sbjct: 487 LHDKYRFQHMGIDVTGPGQAVLENVR-LFCPVAMPITYSLAT--------KAALVLKALE 537

Query: 423 WLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF-AE 478
            +E   L   +    +     +++      +G++   + R       D +  +M+   AE
Sbjct: 538 VMEQKRLAWDAAQTDIAHAFMTIRQV-ATPSGQITYAAHRTDTTGHADVAWAIMHALAAE 596

Query: 479 NPPRSDMDFGRCPSYQYE 496
              R     G+  S  + 
Sbjct: 597 PLARQSRAGGKTSSLAFS 614


>gi|145708080|ref|YP_001165255.1| terminase [Ralstonia phage phiRSA1]
 gi|139003869|dbj|BAF52383.1| terminase [Ralstonia phage phiRSA1]
          Length = 593

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/469 (11%), Positives = 114/469 (24%), Gaps = 41/469 (8%)

Query: 39  GEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAIS---AGRGIGKTTLNA 95
           G +  P     +P   Q + +E       +             I      R IG T   A
Sbjct: 124 GPRSKPERNAISPEE-QTQLLEAFRDSMFDYQRVWYEAGQVERIRNLLKSRQIGATWYFA 182

Query: 96  WLVLWLMSTRPGISVICLANSET----QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPA 151
                   T     +   A+       +     +A+ +  + L  +       +      
Sbjct: 183 REAFIDALTTGRNQIFLSASKAQAHVFKQYIIQFAKDAAGIELKGDPMVLPNGATLYFLG 242

Query: 152 PWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI 211
                       +    Y  + R     +  + +  H  +     +  +S + +      
Sbjct: 243 TNARTAQSYHGNLYFDEYFWVPRFQELRKVASGMAIHKHWRQTYFSTPSSLSHEAYPFWS 302

Query: 212 LGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIA 271
                   A    I             +        W++  +          +  +    
Sbjct: 303 GALFNRGKAKDKQIKLDLSHA---ALRDGMRCADGQWRQI-VTVEDALRGGCNLFDLDQL 358

Query: 272 RYGLDSDVTRVEVCGQFPQQDIDSF----------IPLNIIEEALNREPCPDPYAPLIMG 321
           R           +   F   +   F              + E+     P P    P+ +G
Sbjct: 359 RLEYSELDFANLLMCVFIDDNASVFPLAMLMRGMVDSWEVWEDFRPFAPRPFGNRPVWVG 418

Query: 322 CDIAEEGGDNTVVVL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIII 374
            D    GGD+  +V+            +     +   D       I  + E+Y    + I
Sbjct: 419 YDPNGGGGDSAALVVVAPPLVPGGKFRVLERHQFRGIDYEEQAGAIRRVAERYDVAYVGI 478

Query: 375 DANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS- 433
           D    G      ++                      + +T L +K  D +    L   + 
Sbjct: 479 DRTGIGDAVFRLVQKFRPDAEGFTYS---------VDVKTALVLKAHDVISKGRLEFDAG 529

Query: 434 --GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
                 +  S+K       G +  ++ R +     D +   M+  +  P
Sbjct: 530 WTDFAASFMSIKKTTTAAGGRVTYQAGRSEDTSHADLAWACMHALSHEP 578


>gi|17313220|ref|NP_490600.1| predicted DNA-dependent ATPase terminase subunit [Pseudomonas phage
           phiCTX]
 gi|4063774|dbj|BAA36228.1| unnamed protein product [Pseudomonas phage phiCTX]
          Length = 594

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/435 (12%), Positives = 106/435 (24%), Gaps = 51/435 (11%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQ----------LKTTLWAEVSKW 131
           I   R IG T   A   L          +   A+               +  +  E+   
Sbjct: 169 ILKSRQIGATFYFAREALIDALETGRNQIFLSASKAQAHIFKAYIQAFARDAVGVELKGD 228

Query: 132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY 191
             +LPN         +   A  Y    +         +    +     +  + +     Y
Sbjct: 229 PIILPNGAELHFLGTNARTAQGYHGNFYFD------EFFWTFKFKELNKVASGMAMQKRY 282

Query: 192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF 251
                +  +S   +           +       I             +      D   R 
Sbjct: 283 RRTYFSTPSSMAHEAYTFWTGERFNKGKPAADRIKIDVSHDA----LQQGRLCEDRIWRQ 338

Query: 252 QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPC 311
            +     E       +    R   D++  +  +  QF      S  PL +++  +     
Sbjct: 339 IVTILDAEARGCDLFDIDELRLEYDAEAFQNLLMCQFVDD-GASIFPLTMLQPCMVDSWD 397

Query: 312 PD------------PYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDL 353
                             + +G D AE G    +VV+           +     +   D 
Sbjct: 398 LWSEDYKPFALRPFGDRQVWLGYDPAETGDTAGLVVVAPPAVPGGKFRVLERHQFRGKDF 457

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                 I  + ++Y    I +D    G+     +      V                  +
Sbjct: 458 AEQAEFIRKVTQRYWVTYIGVDTTGMGSGVAQLVRQFFPGVRTFSYSPE---------VK 508

Query: 414 TELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSD 470
           T+L +K    ++   L   +    L Q L +++  I     +    + R       D + 
Sbjct: 509 TQLVMKAWSVIKNGRLEFDAGWTDLAQALMAIRKTITAGGRQFTYTAGRNDNTGHADLAW 568

Query: 471 GLMYTFAENPPRSDM 485
            L +     P     
Sbjct: 569 ALFHALQNEPLEGQT 583


>gi|226329986|ref|ZP_03805504.1| hypothetical protein PROPEN_03899 [Proteus penneri ATCC 35198]
 gi|225200781|gb|EEG83135.1| hypothetical protein PROPEN_03899 [Proteus penneri ATCC 35198]
          Length = 584

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/453 (11%), Positives = 108/453 (23%), Gaps = 45/453 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            +                     +  + + R IG T   A        T     V   A+
Sbjct: 134 EDIFRNTLFEYQKVWYRAGHHRIRNILKS-RQIGATFYFAREAFIDALTTGRNQVFLSAS 192

Query: 116 SETQLKTTLWAE-VSKW-----LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
                +  ++ E + K      + L  +       +                  +     
Sbjct: 193 K---AQAYMFREYIIKMALEVDVELKGDPLMLSNGATLYFLGTNARTAQSYHGNLYLDET 249

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + +     +  + +     +     +  ++ + +                   +    
Sbjct: 250 FWIPKFQELRKVTSGMAIQKHWRQTYFSTPSTMSHEAYPFWSGKLYNRGRKKEDRVEIDI 309

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
               +     +            I+     G D    E +   Y  D       +   F 
Sbjct: 310 SH-EALVNGRLCEDGQWRQIV-NIEDALRGGCDLFDLEQLKKEYSPDE--YNNLLMCHFM 365

Query: 290 QQDIDSF----------IPLNIIEEALNREPCPDPYAPLIMGCDI---AEEGGDNTVVVL 336
                 F              + ++       P  Y P+ +G D     E G     VV+
Sbjct: 366 DDIESLFNFNMMQNCMVDSWEVWDDIQPLALRPYGYDPVWVGYDPSKGGENGDSAGCVVI 425

Query: 337 ------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
                      I     W   D R   + I  + E++  + + ID    G      +   
Sbjct: 426 APPKVPGGKFRILERHQWRGMDFRAQADAIKKITERFYVEYMGIDTTGLGHGVYQNVIQF 485

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIV 447
                  +            N +  L +K  D +    L   +    +IQ+  S++    
Sbjct: 486 FPAAREFIYNP---------NVKNALVIKAYDVISHGRLEFDAQCVDIIQSFTSIRRTTT 536

Query: 448 PNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
            +      E+ R + +   D +   M+     P
Sbjct: 537 GSGNRPTYEASRSEESGHADLAWATMHALFNEP 569


>gi|324115403|gb|EGC09352.1| terminase [Escherichia coli E1167]
          Length = 572

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/439 (12%), Positives = 110/439 (25%), Gaps = 45/439 (10%)

Query: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120
               H   +            I   R IG T   +   L          +   A S+TQ 
Sbjct: 153 EYQLHWYRAGLEHRIRD----ILKSRQIGATFYFSREALLRALKTGHNQIFLSA-SKTQA 207

Query: 121 KTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
              ++ E     + L +              +  +      +     +  +       + 
Sbjct: 208 Y--VFREYIIAFARLVDVDLTGDPIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIP 265

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
                 +  + +   +       +  ++   D              A+    +  +    
Sbjct: 266 NFQVLRKVASGMASQSHLRSTYFSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHN 325

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDI 293
           +     +            I+     G      E +      D    +     +F     
Sbjct: 326 ALAGGLLCADGQWRQIV-TIEDALKGGCTLFDIEQLKRENSADD--FKNLFMCEFVDDKA 382

Query: 294 DSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDNTVVVL------R 337
             F    +    ++     + Y           P+ +G D +  G     VVL       
Sbjct: 383 SVFPFEELQRCMVDTLEEWEDYAPFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAG 442

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               I     W   D  T    I  L EKY  + I IDA   G      +          
Sbjct: 443 GKFRILERHQWKGMDFATQAESIRKLTEKYNVEYIGIDATGLGVGVFQLVR--------- 493

Query: 398 LGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELA 454
                A D+ +    +T + +K  D +    L      + +  +  +++  +  +     
Sbjct: 494 SFYPAARDIRYTPEMKTAMVLKAKDVIRRGCLEYDVSATDITSSFMAIRKTMTSSGRSAT 553

Query: 455 IESKRVKGAKSTDYSDGLM 473
            E+ R + A   D +   M
Sbjct: 554 YEASRSEEASHADLAWATM 572


>gi|307315386|ref|ZP_07594955.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|307315408|ref|ZP_07594975.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905258|gb|EFN35804.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|306905260|gb|EFN35805.1| protein of unknown function DUF264 [Escherichia coli W]
          Length = 385

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 70/242 (28%), Gaps = 30/242 (12%)

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--------- 315
             E +      D    +     +F       F    +    ++     + Y         
Sbjct: 145 DIEQLKRENSADD--FKNLFMCEFVDDKASVFPFEELQRCMVDTLEEWEDYAPFAANPFG 202

Query: 316 -APLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL           I     W   D  T    I  L EKY 
Sbjct: 203 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 262

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 263 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRGC 313

Query: 429 LINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDM 485
           L      + +  +  +++  +  +      E+ R + A   D +   M+     P  + +
Sbjct: 314 LEYDVSATDITSSFMAIRKTMTSSGRSATYEASRSEEASHADLAWATMHALLNEPLTAGI 373

Query: 486 DF 487
             
Sbjct: 374 ST 375


>gi|323943519|gb|EGB39636.1| terminase [Escherichia coli H120]
          Length = 367

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 70/242 (28%), Gaps = 30/242 (12%)

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY--------- 315
             E +      D    +     +F       F    +    ++     + Y         
Sbjct: 127 DIEQLKRENSADD--FKNLFMCEFVDDKASVFPFEELQRCMVDTLEEWEDYAPFAANPFG 184

Query: 316 -APLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYR 368
             P+ +G D +  G     VVL           I     W   D  T    I  L EKY 
Sbjct: 185 SRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAESIRKLTEKYN 244

Query: 369 PDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFAS 428
            + I IDA   G      +               A D+ +    +T + +K  D +    
Sbjct: 245 VEYIGIDATGLGVGVFQLVR---------SFYPAARDIRYTPEMKTAMVLKAKDVIRRGC 295

Query: 429 LINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDM 485
           L      + +  +  +++  +  +      E+ R + A   D +   M+     P  + +
Sbjct: 296 LEYDVSATDITSSFMAIRKTMTSSGRSATYEASRSEEASHADLAWATMHALLNEPLTAGI 355

Query: 486 DF 487
             
Sbjct: 356 ST 357


>gi|146313136|ref|YP_001178210.1| hypothetical protein Ent638_3501 [Enterobacter sp. 638]
 gi|145320012|gb|ABP62159.1| protein of unknown function DUF264 [Enterobacter sp. 638]
          Length = 589

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 58/473 (12%), Positives = 116/473 (24%), Gaps = 60/473 (12%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F++    + LN          +  I   R IG T   A   L       G + I L+ S+
Sbjct: 141 FLDQSFEYQLNWHRAGIAHRIR-HILKSRQIGATFYFAREALLRALKT-GQNQIFLSASK 198

Query: 118 TQLK-----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           TQ          +A +                +  +      +     +  +       +
Sbjct: 199 TQAYVFRKYIIAFARLVDVDLSGDPIVIGNNGAELIFLGTNSNTAQSHNGDLYVDEIFWI 258

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
                  +  + +   +       +  ++                  A  FW      R 
Sbjct: 259 PNFQRLRKVASGMASQSHLRTTYFSTPST--------------LAHGAYPFWSGELFNRG 304

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGII----------ARYGLDS-DVTR 281
            S +   +            +     +       E  +               +S D  R
Sbjct: 305 RSNRDERVDIDISHKALAGGVLCPDGQWRQIVTIEDALAGGCTLFNLDQLKQENSADDFR 364

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY----------APLIMGCDIAEEGGDN 331
                +F       F    +    ++     + +           P+ +G D +  G   
Sbjct: 365 NLFMCEFVDDKASVFPFEELQRCMVDAMEEWEDFEQFADRPFNWRPVWIGYDPSHTGDSA 424

Query: 332 TV------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
                   +V      I     W   D       I  L EKY  D I IDA   G     
Sbjct: 425 GCAVLAPPLVAGGKFRILERHQWKGMDFAAQAEAIRSLTEKYTVDYIGIDATGIGQGVYQ 484

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSL 442
            +         +               +T + +K  D +    L   +    + Q+  ++
Sbjct: 485 LVRSFFPAARAIRYTPE---------MKTAMVLKAKDTIRRGCLEYDAGATDITQSFMAI 535

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +  +  +      E+ R + A   D +   M+     P  +          + 
Sbjct: 536 RKTMTSSGRSSTYEASRSEEASHADIAWATMHALLNEPLSAGSGMHSNSILEI 588


>gi|197285843|ref|YP_002151715.1| phage terminase, ATPase subunit [Proteus mirabilis HI4320]
 gi|194683330|emb|CAR44037.1| phage terminase, ATPase subunit [Proteus mirabilis HI4320]
          Length = 584

 Score =  112 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/453 (11%), Positives = 108/453 (23%), Gaps = 45/453 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            +                     +  + + R IG T   A        T     V   A+
Sbjct: 134 EDIFRNTLFEYQKVWYRAGHHRIRNILKS-RQIGATFYFAREAFIDALTTGRNQVFLSAS 192

Query: 116 SETQLKTTLWAE-VSKW-----LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
                +  ++ E + K      + L  +       +                  +     
Sbjct: 193 K---AQAYMFREYIIKMALEVDVELKGDPLMLSNGATLYFLGTNARTAQSYHGNLYLDET 249

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + +     +  + +     +     +  ++ + +                   +    
Sbjct: 250 FWIPKFQELRKVTSGMAIQKHWRQTYFSTPSTMSHEAYPFWSGKLYNRGRKKEDRVDIDI 309

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
               +     +            I+     G D    E +   Y  D       +   F 
Sbjct: 310 SH-EALVNGRLCEDGQWRQIV-NIEDALRGGCDLFDLEQLKKEYSPDE--YNNLLMCHFM 365

Query: 290 QQDIDSF----------IPLNIIEEALNREPCPDPYAPLIMGCDI---AEEGGDNTVVVL 336
                 F              + ++       P  Y P+ +G D     E G     VV+
Sbjct: 366 DDIESLFNFNMMQNCMVDSWEVWDDIQPLALRPYGYDPVWVGYDPSKGGENGDSAGCVVI 425

Query: 337 ------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
                      I     W   D R   + I  + E++  + + ID    G      +   
Sbjct: 426 APPKVPGGKFRILERHQWRGMDFRAQADAIKKITERFYVEYMGIDTTGLGHGVYQNVIQF 485

Query: 391 GYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIV 447
                  +            N +  L +K  D +    L   +    +IQ+  S++    
Sbjct: 486 FPAAREFIYNP---------NVKNALVIKAYDVISHGRLEFDAQCVDIIQSFTSIRRTTT 536

Query: 448 PNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
            +      E+ R + +   D +   M+     P
Sbjct: 537 GSGNRPTYEASRSEESGHADLAWATMHALFNEP 569


>gi|156976253|ref|YP_001447159.1| hypothetical protein VIBHAR_05025 [Vibrio harveyi ATCC BAA-1116]
 gi|156527847|gb|ABU72932.1| hypothetical protein VIBHAR_05025 [Vibrio harveyi ATCC BAA-1116]
          Length = 593

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/463 (11%), Positives = 122/463 (26%), Gaps = 45/463 (9%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E +        N+++     + K      R IG T   +   L          +   A S
Sbjct: 152 ESLFEYQHTMRNNLHQRTRNILK-----SRQIGATYYFSGEALEDAILTGDNQIFLSA-S 205

Query: 117 ETQLK-----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             Q +         A+    + L  N       +     +            +    Y  
Sbjct: 206 RAQAEVFRSYIIAIAQAFLGIELTGNPIILSNGAELRFLSTNSKTAQSYHGHVYVDEYFW 265

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  ++ T             +    R  I      
Sbjct: 266 IPKFDELNKLASAMATHKNWRKTYFSTPSAKTHQAYTFWTGDQWRQGRDTRANIEFPTFD 325

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
               +                I+     G +    + +   Y  D           F   
Sbjct: 326 D--YRDGGRLCPDKQWRYVVTIEDAAAGGCELFDIDELRDEYSKDD--FDNLFMCIFVDG 381

Query: 292 DIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVLR----- 337
               F    +    ++ +  ++  P+   P     + +G D +    +  +VV+      
Sbjct: 382 ASSVFKFSALEKAMVDISRWQDFKPNDNDPFDRREVWLGYDPSRTRDNACLVVVAPPIVA 441

Query: 338 -RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYR 396
                +     W   + +    ++S + E+Y    + ID    GA   D L         
Sbjct: 442 IEKFRVLEKHYWRGLNFQYQAQQVSKVFERYNVSYLGIDTTGIGAGVYDLLSKK------ 495

Query: 397 VLGQKRAVDLEFCRNR-RTELHVKMADWLEFASLINHSG---LIQNLKSLKSFIVPNTGE 452
                R        N  +  L +KM D +E   +   +    +     ++K     +   
Sbjct: 496 ---HPRETVAIQYSNESKNRLVMKMIDVVEANRIQFDAEHKDIAMAFMAIKRATTNSGNS 552

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +  +++R +     D    + +     P   D    R  ++Q 
Sbjct: 553 MTFKAERSELTGHADAFWAISHACINEP--LDHSEKRKSTWQM 593


>gi|323973818|gb|EGB68992.1| terminase [Escherichia coli TA007]
          Length = 589

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/446 (12%), Positives = 109/446 (24%), Gaps = 59/446 (13%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK-----TTLWAEVSKWLSLL 135
            I   R IG T   A   L       G + I L+ S+TQ          +A +       
Sbjct: 163 HILKSRQIGATFYFARESLLRALKT-GQNQIFLSASKTQAYVFRKYIIAFARLVDVDLSG 221

Query: 136 PNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
                    +  +      +     +  +       +       +  + +   +      
Sbjct: 222 DPIVIGNNGAELIFLGTNSNTAQSHNGDLYVDEIFWIPNFQKLRKVASGMASQSHLRTTY 281

Query: 196 INDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
            +  ++                  A  FW      R  S +   +            +  
Sbjct: 282 FSTPST--------------LAHGAYPFWSGELFNRGRSNRDERVDIDISHQALTGGVLC 327

Query: 256 RTVEGIDPSFHEGII----------ARYGLDS-DVTRVEVCGQFPQQDIDSFIPLNIIEE 304
              +       E  +               +S D  R     +F       F    +   
Sbjct: 328 GDGQWRQIVTIEDALAGGCTLFNLDQLKQENSADDFRNLFMCEFVDDKASVFPFEELQRC 387

Query: 305 ---ALNREPCPDPY-------APLIMGCDIAEEGGDNTV------VVLRRGPVIEHLFDW 348
              A+      +P+        P+ +G D +  G           +V      I     W
Sbjct: 388 MVDAMEEWEDFEPFADRPFNWRPVWIGYDPSHTGDSAGCAVLAPPLVAGGKFRILERHQW 447

Query: 349 SKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEF 408
              D       I  L EKY  D I IDA   G      +         +           
Sbjct: 448 KGMDFAAQAEAIRALTEKYTVDYIGIDATGIGQGVYQLVRSFFPAARAIRYTPE------ 501

Query: 409 CRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKS 465
               +T + +K  D +    L   +    + Q+  +++  +  +      E+ R + A  
Sbjct: 502 ---MKTAMVLKAKDTIRRGCLEYDAGATDITQSFMAIRKTMTNSGRSATYEASRSEEASH 558

Query: 466 TDYSDGLMYTFAENPPRSDMDFGRCP 491
            D +   M+     P  +        
Sbjct: 559 ADIAWATMHALLNEPLSAGSGMQSSS 584


>gi|325921366|ref|ZP_08183223.1| hypothetical protein XGA_2215 [Xanthomonas gardneri ATCC 19865]
 gi|325548124|gb|EGD19121.1| hypothetical protein XGA_2215 [Xanthomonas gardneri ATCC 19865]
          Length = 594

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/467 (10%), Positives = 104/467 (22%), Gaps = 53/467 (11%)

Query: 49  SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI 108
                +Q                          I   R IG T   A   L    T    
Sbjct: 149 DGCFDYQR-------DWYRAGNERTR------IILKSRQIGATFYFAREALIDALTTGRN 195

Query: 109 SVICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLG 163
            +   A+                E         +   F   +                  
Sbjct: 196 QIFLSASKAQAHLFRGYMQQFVRETIDETLSGGDSIVFPNGAELFFLGTNARTAQGYHGN 255

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
                +          +  + +  H  +     +  +S   +           +      
Sbjct: 256 FYFDEFFWTYGFNELNKVASGMAMHKKWRKTYFSTPSSMAHEAYTFWTGERRNKGKPAAQ 315

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
            I                 +  D   R  ++    +       +    R     D     
Sbjct: 316 RIQIDVSHDA----LAGGRRCQDRAWRQIVNILDAQRRGCDLFDIDELREEYSPDAFANL 371

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNREP------------CPDPYAPLIMGCDIAEEGGDN 331
           +  +F      S  PL +++  +                 P     + +G D AE G   
Sbjct: 372 LMCEFVDD-GASIFPLAMLQPCMVDSWVEWGQDYKPFAARPYGDRAVWIGYDPAETGDTA 430

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
            +VVL           +     +   D      +I  +  +Y    I ID    G+    
Sbjct: 431 GLVVLAPPQLPGGKFRLLERIQFRGMDFAKQAAEIERITRRYWVTYIGIDTTGMGSGVAQ 490

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSL 442
            ++    ++                  +T L +K  D +    L   +    + Q+L ++
Sbjct: 491 LVKQFFPNLVTFSYSPE---------VKTRLVLKAFDVIHNGRLEFDAGWTDVAQSLMAI 541

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           +  +  +  +    + R +     D +  L +     P         
Sbjct: 542 RKTMTASGRQSTFTAGRSEETGHADLAWALFHALQNEPLEGRTARNS 588


>gi|327198304|ref|YP_004306879.1| gp35 [Burkholderia phage KS14]
 gi|310657267|gb|ADP02380.1| gp35 [Burkholderia phage KS14]
          Length = 604

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/423 (10%), Positives = 104/423 (24%), Gaps = 37/423 (8%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET----QLKTTLWAEVSKWLSLLPN 137
           I   R IG T   A   L          +   A+       +     +A  +  + L  +
Sbjct: 180 ILKSRQIGATFYFAREALDDALQTARNQIFLSASKAQAHVFKSYIRQFAAEAAEVELTGD 239

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +  +                    Y  +       +  + +  H  +     +
Sbjct: 240 PIILPNMAELIFLGTNSRTAQSYHGNFYFDEYFWVSGFRQLNKVASGMAMHKKWRKTYFS 299

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
             +S T +              A    I        S        +     +   ++   
Sbjct: 300 TPSSITHEAYTFWSGEHYNRGRAKADHIHL--DISHSALARGRLCEDRQFRQIVTVEDAV 357

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY-- 315
             G D    + +   Y          +  QF       F    +    ++          
Sbjct: 358 AGGCDLFDIDELRLEYSAQE--YANLLMCQFIDDTASIFPLAELQRCMVDSWEEWADDFK 415

Query: 316 ---------APLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKI 360
                     P+ +G D A  G    +VV+           + H   +   D       I
Sbjct: 416 PLAPRPFGFRPVWVGYDPALSGDSAGLVVVAPPAVPGGKFRVLHKCQFRGMDFEGQAEAI 475

Query: 361 SGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKM 420
             + ++Y  + + ID    G      ++        +               +  L +K 
Sbjct: 476 RQITQQYNVEYMSIDTTGIGQGVYQLVKQFYPSAVALNYSPE---------IKGRLVLKG 526

Query: 421 ADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFA 477
              +    L   +    L Q+  +++  +  +  ++  E+ R +     D +   ++   
Sbjct: 527 LSVIGKGRLEFDAGWTDLAQSFMAIRKTMTASGRKVTYEASRSEETGHADLAWACLHALD 586

Query: 478 ENP 480
             P
Sbjct: 587 NEP 589


>gi|167584288|ref|ZP_02376676.1| bacteriophage terminase, ATPase subunit [Burkholderia ubonensis Bu]
          Length = 520

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/450 (10%), Positives = 99/450 (22%), Gaps = 41/450 (9%)

Query: 67  LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA 126
                  N       +   R IG T   +   L          +   A S  Q      +
Sbjct: 81  YQKNWYHNGNNRTRNVLKSRQIGATYYFSHEALDDALQSHRNQIFLSA-SRAQAH-VFRS 138

Query: 127 EVSKWLSLLPNKHWFE-------MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEE 179
            +  ++  + +              +     +            +    Y  +       
Sbjct: 139 YICDFVRKVIDVELTGEVIALPGYDAELYFLSTNSRTAQSYHGNLYFDEYFWVHGFRELN 198

Query: 180 RPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYE 239
           +    +     +     +  +S +                A    I              
Sbjct: 199 KVAQAMASQKQWRKTYFSTPSSISHQAYPFWSGEAYNRGRAKADHIHLDISHAALSGGRL 258

Query: 240 IFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPL 299
                 D   R  +       +     +    R    +D        QF       F   
Sbjct: 259 C----EDRQWRQIVTIEDAAAMGCDLFDLDELRLENSADDFAQLYLCQFIDDSASIFKFA 314

Query: 300 NIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTVVVL------RRGPVIE 343
           +I    ++     D           + P+ +G D A  G    +V++           + 
Sbjct: 315 DIQRCMIDSWEEWDDVEFLIQRPFGHRPVWLGYDPALSGDSAGLVIVAPPAVPGGKFRVL 374

Query: 344 HLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRA 403
               W   D       I  L E+Y    + ID    G      +         +      
Sbjct: 375 EKMQWRGMDFEAQAESIRQLTERYTVTYMAIDTTGIGQGVYQLVSKFFPAAVPLNYSPE- 433

Query: 404 VDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRV 460
                    +  L +K    +    L   +    L Q   +++  +  +  ++   + R 
Sbjct: 434 --------VKGRLVLKGLSVIGNGRLEFDAGWTDLAQAFMAIRRTMTASGRQVTYHAGRS 485

Query: 461 KGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
           +     D +   ++     P        R 
Sbjct: 486 EEIGHADLAWACLHALGNEPLEGSTTNNRS 515


>gi|148727151|ref|YP_001285645.1| putative terminase large subunit [Aeromonas phage phiO18P]
 gi|110349286|gb|ABG73174.1| putative terminase large subunit [Aeromonas phage phiO18P]
          Length = 604

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/466 (12%), Positives = 123/466 (26%), Gaps = 57/466 (12%)

Query: 66  CLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLW 125
            +    N         I   R IG T   A   L       G  +   A +  Q      
Sbjct: 161 RVREAKNDPALPRTRNILKSRQIGMTYYFAGEALEDAILTGGNQIFLSA-TRAQA----- 214

Query: 126 AEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHCSLGIDSKHYSTMCR 174
            EV +       + +  +                  +   +     S  +    Y  +  
Sbjct: 215 -EVFRSYICKIAQTFLGVTLTGNPIVLSNGAELHFCSTNSNSAQSRSGNVYIDEYFWIPN 273

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
                   + +   + +     +  +S   +            +  +R  I       L 
Sbjct: 274 FEKLSDVASAMATQSHWRKTYFSTPSSKVHEAYRFWTGDRWKGQRPSRVAIDFPGEDDLR 333

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPS--FHEGIIARYGLDSDVTRVEVCGQFPQQD 292
                      D   R+ I       +       E +   Y  +  V       +F    
Sbjct: 334 DGGRIC----PDRQWRYVITIEDAIRLGCHLIDIEELKDEYPEE--VFDRLYMCRFIDDA 387

Query: 293 IDSFIPLNIIEEALN--REPCPDPYAP-------LIMGCDIAEEGGDNTVVVL------R 337
           +  F   ++    ++  R     P  P       + MG D +    + T+VV+       
Sbjct: 388 LSVFKFQDMERAGVDPTRWEDYKPGRPDPFGRREVWMGYDPSRTRDNATLVVVAPPTVAG 447

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV-YR 396
               +     W   + +    +I  + +K+R   + +D +  GA   D L+ +   V + 
Sbjct: 448 ERFRVLEKHYWRGLNFQYQAQEIERIAKKFRVTYLGVDVSGIGAGVYDLLKPVFKGVCHP 507

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQ---NLKSLKSFIVPNTGEL 453
           +     +         ++ L +KM D +E   +   S          ++K       G++
Sbjct: 508 INYSIES---------KSRLVLKMIDVVEANRIEWDSSDRDIPLAFLAIKR-STTGGGQM 557

Query: 454 AIESKRVKGAKSTDYSDGLMYTFAENP--PRSDMDFGRCPSYQYEG 497
              + R       D    + +  A  P             S + + 
Sbjct: 558 TFRAARDNVTGHADVFFAIAHAVANEPLDTHRKRKSTWATSQEKKA 603


>gi|145298582|ref|YP_001141423.1| phage terminase ATPase subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|145300715|ref|YP_001143556.1| phage terminase ATPase subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851354|gb|ABO89675.1| phage terminase ATPase subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853487|gb|ABO91808.1| phage terminase ATPase subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 606

 Score =  111 bits (277), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/458 (12%), Positives = 125/458 (27%), Gaps = 57/458 (12%)

Query: 68  NSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE 127
               N         I   R IG T   A   L       G  +   A +  Q       E
Sbjct: 165 REAKNDPALPRTRNILKSRQIGMTYYFAGEALEDAILTGGNQIFLSA-TRAQA------E 217

Query: 128 VSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHCSLGIDSKHYSTMCRTY 176
           V +       + +  +               +  +   +     S  +    Y  +    
Sbjct: 218 VFRSYICKIAQTFLGVTLTGNPIVLSNGAELIFCSTNSNSAQSRSGNVYIDEYFWIPNFE 277

Query: 177 SEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGK 236
                 + +   + +     +  +S   +               +R  +       L   
Sbjct: 278 RLSDVSSAMATQSHWRKTYFSTPSSKVHEAYRFWTGDRWKGTRPSRQAVDFPGEDDLRDG 337

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPS--FHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
                    D   R+ I       +  +    E +   Y  +  V       +F    + 
Sbjct: 338 GRIC----PDRQWRYVITVEDAIRLGCNLIDIEELKDEYPEE--VFDRLYLCRFIDDALS 391

Query: 295 SFIPLNIIEEALN--REPCPDPYAP-------LIMGCDIAEEGGDNTVVVL------RRG 339
            F   ++    ++  R     P  P       + +G D +    + T+VV+         
Sbjct: 392 VFKFQDMERAGVDPTRWEDYKPGRPDPFGRREVWLGYDPSRTRDNATLVVVAPPTVAGER 451

Query: 340 PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV-YRVL 398
             +     W   + +    +I+ + +K+R   + +D +  G    D L+ +   V + + 
Sbjct: 452 FRVLEKHYWRGLNFQYQAQEITRIAKKFRVTYLGVDVSGIGVGVFDLLKPVFKGVCHPIN 511

Query: 399 GQKRAVDLEFCRNRRTELHVKMADWLEFASLIN---HSGLIQNLKSLKSFIVPNTGELAI 455
               +         ++ L +KM D +E   +        +     ++K       G++  
Sbjct: 512 YSVES---------KSRLVLKMIDVVEANRIEWDCADRDIPLAFLAIKR-STTGGGQMTF 561

Query: 456 ESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSY 493
            + R       D    + +  A  P   D +  R  S+
Sbjct: 562 RAARDNVTGHADVFFAIAHAVANEP--LDTNRKRKSSW 597


>gi|294624257|ref|ZP_06702968.1| phage-related terminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292601451|gb|EFF45477.1| phage-related terminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 587

 Score =  111 bits (277), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/466 (10%), Positives = 113/466 (24%), Gaps = 46/466 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGA------ISAGRGIGKTTLNAWLVLWLMSTRPGIS 109
            E +E +    ++   +   + ++ +      I   R IG T   A   L    T     
Sbjct: 130 EEQIEQLTTAFVDGCFDYQRDWYRASNERTRIILKSRQIGATYYFAREALIDALTTGRNQ 189

Query: 110 VICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGI 164
           +   A+                E         +   F   +                   
Sbjct: 190 IFLSASKAQAHLFRGYMQQFVRETIDETLSGGDSIVFPNGAELFFLGTNARTAQGYHGNF 249

Query: 165 DSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFW 224
               +          +  + +  H  +     +  +S   +           +       
Sbjct: 250 YFDEFFWTYGFNELNKVASGMAMHKKWRKTYFSTPSSMAHEAYTFWTGERRNKGKPAAQR 309

Query: 225 IMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEV 284
           I                 +  D   R  ++    +       +    R     D     +
Sbjct: 310 IQIDVSHDA----LAGGRRCQDRAWRQIVNILDAQRRGCDLFDIDELREEYSPDAFANLL 365

Query: 285 CGQFPQQDIDSFIPLNIIEEALNREPC------------PDPYAPLIMGCDIAEEGGDNT 332
             +F      S  PL +++  +                 P     + +G D AE G    
Sbjct: 366 MCEFVDD-GASIFPLAMLQPCMVDSWIEWGQDYKPFAPRPYGDRAVWIGYDPAETGDTAG 424

Query: 333 VVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
           +VVL           +     +   D      +I  +  +Y    I ID    G+     
Sbjct: 425 LVVLAPPQQPGGKFRLLERIQFRGMDFAKQAAEIERITRRYWVTYIGIDTTGMGSGVAQL 484

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           ++    ++                  +T L +K  D +    L   +    + Q+L +++
Sbjct: 485 VKQFFPNLVTFSYSPE---------VKTRLVLKAFDVIHNGRLEFDAGWTDVAQSLMAIR 535

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
             +  +  +    + R +     D +  L +     P         
Sbjct: 536 KTMTASGRQSTFTAGRSEETGHADLAWALFHALQNEPLEGRTARNS 581


>gi|3337256|gb|AAC34148.1| terminase subunit [Enterobacteria phage 186]
          Length = 589

 Score =  111 bits (277), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 55/475 (11%), Positives = 119/475 (25%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  +
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRS 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
                +  +    +    ++ +           D            +        D    
Sbjct: 307 RIADRIEIDISHRALAGGQLCDDGQWRQIVTIEDALAGGCTLFDLDQLKRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMEEWEDFAPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D     + I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQADGIRKLTEKYSVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGIQPKSILEF 588


>gi|188577619|ref|YP_001914548.1| phage terminase, ATPase subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522071|gb|ACD60016.1| phage terminase, ATPase subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 533

 Score =  111 bits (277), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/434 (11%), Positives = 101/434 (23%), Gaps = 40/434 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-----ETQLKTTLWAEVSKWLSLLP 136
           I   R IG T   A   L    T     +   A+                E         
Sbjct: 108 ILKSRQIGATFYFAREALIDALTTGRNQIFLSASKAQAHLFRGYMQQFVRETIDETLSGG 167

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +   F   +                       +          +  + +  H  +     
Sbjct: 168 DSIVFPNGAELFFLGTNARTAQGYHGNFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYF 227

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S   +           +       I                 +  D   R  ++  
Sbjct: 228 STPSSMAHEAYTFWTGERRNKGKPAAQRIQIDVSHDA----LAGGRRCQDRAWRQIVNIL 283

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP------ 310
             +       +    R     D     +   F      S  PL +++  +          
Sbjct: 284 DAQRRGCDLFDIDELREEYSPDAFANLLMCDFVDD-GASIFPLAMLQPCMVDSWVEWGQD 342

Query: 311 ------CPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                  P     + +G D AE G    +VVL           +     +   D      
Sbjct: 343 YKPFAVRPYGDRAVWIGYDPAETGDTAGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAA 402

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I  +  +Y    I ID    G+     ++    ++                  +T L +
Sbjct: 403 EIERITRRYWVTYIGIDTTGMGSGVAQLVKQFFPNLVTFSYSPE---------VKTRLVL 453

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L   +    + Q+L +++  +  +  +    + R +     D +  L + 
Sbjct: 454 KAFDVIHNGRLEFDAGWTDVAQSLMAIRKTMTASGRQSTFSAGRSEETGHADLAWALFHA 513

Query: 476 FAENPPRSDMDFGR 489
               P         
Sbjct: 514 LQNEPLEGRTARNS 527


>gi|167553298|ref|ZP_02347048.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205322236|gb|EDZ10075.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 589

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/475 (11%), Positives = 117/475 (24%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALASGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFTPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEGIRRLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGMQPKSILEF 588


>gi|21232401|ref|NP_638318.1| phage-related terminase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|21114179|gb|AAM42242.1| phage-related terminase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
          Length = 594

 Score =  111 bits (276), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/434 (11%), Positives = 104/434 (23%), Gaps = 40/434 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-----ETQLKTTLWAEVSKWLSLLP 136
           I   R +G T   A   L    T     +   A+                E         
Sbjct: 169 ILKSRQVGATFYFAREALIDALTTGRNQIFLSASKAQAHLFRGYMQQFVRETIDETLSGG 228

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +   F   +                       +          +  + +  H  +     
Sbjct: 229 DSIVFPNGAELFFLGTNARTAQGYHGNFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYF 288

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S   +           ER              +S        +  D   R  ++  
Sbjct: 289 STPSSMAHEAYTFWTG----ERRNKGKPAAQRIQVDVSHDALAGGRRCQDRAWRQIVNIL 344

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP------ 310
             +       +    R     D     +  +F      S  PL +++  +          
Sbjct: 345 DAQRRGCDLFDIDELREEYSPDAFANLLMCEFVDD-GASIFPLAMLQPCMVDSWVEWGQD 403

Query: 311 ------CPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                  P     + +G D AE G    +VVL           +     +   D      
Sbjct: 404 YKPFAARPYGDRAVWIGYDPAETGDTAGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAA 463

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I  +  +Y    I ID    G+     ++    ++                  +T L +
Sbjct: 464 EIERITRRYWVTYIGIDTTGMGSGVAQLVKQFFPNLVTFSYSPE---------VKTRLVL 514

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L   +    + Q+L +++  +  +  +    + R +     D +  L + 
Sbjct: 515 KAFDVIHNGRLEFDAGWTDVAQSLMAIRKTMTASGRQSTFTAGRSEETGHADLAWALFHA 574

Query: 476 FAENPPRSDMDFGR 489
               P         
Sbjct: 575 LQNEPLEGRTARNS 588


>gi|301386048|ref|ZP_07234466.1| hypothetical protein PsyrptM_25573 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060830|ref|ZP_07252371.1| hypothetical protein PsyrptK_12639 [Pseudomonas syringae pv. tomato
           K40]
 gi|302129770|ref|ZP_07255760.1| hypothetical protein PsyrptN_00140 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 684

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 63/471 (13%), Positives = 128/471 (27%), Gaps = 62/471 (13%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMATHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D D  +  
Sbjct: 325 AAKDPWPSDKQISAGALCPDGQWR-KVITILDAIAGGCDLFDLEQLQLEY--DDDKFQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P P   +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
                +G++   + R       D +  +M+     P    ++ G+     Y
Sbjct: 552 -GTTASGQVTYSASRTDATGHADVAWAVMHALQYEP----LNTGKRRRSSY 597


>gi|194289059|ref|YP_002004966.1| bacteriophage p2 gpp capsid protein; terminase, atpase subunit
           [Cupriavidus taiwanensis LMG 19424]
 gi|193222894|emb|CAQ68899.1| bacteriophage P2 GPP capsid protein; Terminase, ATPase subunit
           [Cupriavidus taiwanensis LMG 19424]
          Length = 593

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/458 (10%), Positives = 110/458 (24%), Gaps = 40/458 (8%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS- 116
           FM+ +  +          E  +  + + R IG T   A        TR    +   A+  
Sbjct: 146 FMDSMFDYQRVWYEAGLVERIRNILKS-RQIGATWYFAREAFIDALTRGRNQIFLSASKA 204

Query: 117 ETQLKT---TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMC 173
           +  +       +A+ +  + L  +       +                  +    Y  + 
Sbjct: 205 QAHVFKHYIIQFAKDAAGVELKGDPLVLPNGATLYFLGTNARTAQSYHGNLYLDEYFWIQ 264

Query: 174 RTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRL 233
           R     +  + +  H  +     +  +S   +                   +        
Sbjct: 265 RFQELRKVASGMAIHAKWRQTYFSTPSSLAHEAYPFWSGALFNRGRRKDQHVQVDVSHAH 324

Query: 234 SGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQFPQQD 292
                +   +  D   R  +          +    +       SD      +   F    
Sbjct: 325 ----LQAGRRCADGQWRQVVTVEDAVRGGCNLF-DLEQLRREYSDADFENLLMCGFIDDT 379

Query: 293 IDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNTVVVL------ 336
              F    ++   ++     +              + +G D    GGD+  +V+      
Sbjct: 380 ASVFPLSMLMRCMVDSWEVWEDFRHWSPRPLGNREVWVGYDPNGGGGDSAALVVVAPPLV 439

Query: 337 -RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 +     +   D       +  + E+Y    I ID    G      +        
Sbjct: 440 PGGKFRVLEKHQFRGIDYEEQAAAVLKVCERYNVTYIGIDRTGVGDAVYKVVLKTRPEAQ 499

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGE 452
                          + +T L +K  D +    L   +       +  S++       G 
Sbjct: 500 GFTYS---------VDVKTGLVLKATDVISKGRLEFDAGWTDFAASFMSIRKTTTAAGGR 550

Query: 453 LAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRC 490
           +  ++ R +     D +   M+  A  P          
Sbjct: 551 VTYQAGRSEETSHADLAWACMHALAHEPIEGVTTTNTS 588


>gi|261340099|ref|ZP_05967957.1| terminase, ATPase subunit [Enterobacter cancerogenus ATCC 35316]
 gi|288318026|gb|EFC56964.1| terminase, ATPase subunit [Enterobacter cancerogenus ATCC 35316]
          Length = 589

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 61/479 (12%), Positives = 117/479 (24%), Gaps = 71/479 (14%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL + +    H +              I   R IG T   A   L       G
Sbjct: 142 FDQSFDYQLRWHKAGLEHRIRH------------ILKSRQIGATFYFARESLLRALKT-G 188

Query: 108 ISVICLANSETQLK-----TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
            + I L+ S+TQ          +A +                +  +      +     + 
Sbjct: 189 QNQIFLSASKTQAYVFRKYIIAFARLVDVDLSGDPIVIGNNGAELIFLGTNSNTAQSHNG 248

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +       +       +  + +   +       +  ++                  A  
Sbjct: 249 DLYVDEIFWIPNFQKLRKVASGMASQSHLRTTYFSTPST--------------LAHGAYP 294

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGII----------AR 272
           FW      R  S +   +            +     +       E  +            
Sbjct: 295 FWSGELFNRGRSNRDERVDIDISHQALAGGMLCGDGQWRQIVSIEDALAGGCTLFNLDQL 354

Query: 273 YGLDS-DVTRVEVCGQFPQQDIDSFIPLNIIEE---ALNREPCPDPY-------APLIMG 321
              +S D  R     +F       F    +      A+      +P+        P+ +G
Sbjct: 355 KQENSADDFRNLFMCEFVDDKASVFPFEELQRCMVDAMEEWEDFEPFADRPFNWRPVWIG 414

Query: 322 CDIAEEGGDNTV------VVLRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIID 375
            D +  G           +V      I     W   D       I  L EKY  D I ID
Sbjct: 415 YDPSHTGDSAGCAVLAPPLVAGGKFRILERHQWKGMDFAAQAEAIRALTEKYTVDYIGID 474

Query: 376 ANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS-- 433
           A   G      +         +               +T + +K  D +    L   +  
Sbjct: 475 ATGIGQGVYQLVRSFFPAARAIRYTPE---------MKTAMVLKAKDTIRRGCLEYDAGA 525

Query: 434 -GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
             + Q+  +++  +  +      E+ R + A   D +   M+     P  +        
Sbjct: 526 TDITQSFMAIRKTMTSSGRSATYEASRSEEASHADIAWATMHALLNEPLSAGSGMQSAS 584


>gi|320087122|emb|CBY96890.1| Terminase, ATPase subunit GpP [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 589

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 56/475 (11%), Positives = 117/475 (24%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALAGGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFAPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEAIRRLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGMQPKSILEF 588


>gi|261248365|emb|CBG26202.1| terminase, ATPase subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 589

 Score =  110 bits (275), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 55/475 (11%), Positives = 116/475 (24%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++      H +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLEHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALAGGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFAPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEGIRRLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGMQPKSILEF 588


>gi|109302915|ref|YP_654730.1| hypothetical protein F108p19 [Pasteurella phage F108]
 gi|73918076|gb|AAZ93654.1| unknown [Pasteurella phage F108]
          Length = 603

 Score =  110 bits (274), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 53/442 (11%), Positives = 120/442 (27%), Gaps = 44/442 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +     HC  + ++    + K      R IG T   A+  L          +   A S+ 
Sbjct: 162 LFDYQKHCRANKHHSVRNILK-----SRQIGATYYFAFEALEDAIFTGDNQIFLSA-SKR 215

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQ------SLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           Q        + K      +             +     A   +     S  +    Y+ +
Sbjct: 216 QA-EIFKTYIIKMARAYFDVELKGSPIILSNGAELHFLATNANTSQGNSGHVYGDEYAWI 274

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
                     + +  H  +     +  +S               E +  R  ++  +   
Sbjct: 275 RDFERFNTVSSAMATHKHWRETYFSTPSSKFHPSYAFWSGDMWKEGDPKRANVVFPSFEE 334

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
           L              +     D            + +  +Y              +    
Sbjct: 335 LRDG-GRFCPDGTWRYVITIEDALKGGAGVLFDIDALKQKYSKY--AFAQLFMCVWVDDA 391

Query: 293 IDSF-IPLNI---IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL------R 337
              F I   +   ++ A  ++  P+   P     +  G D A  G   + V++      +
Sbjct: 392 DSIFNIKKLLKCGVDIAKWKDHNPNDARPFGAREVWGGYDPAHSGDGASFVIVAPPALLK 451

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML-GYHVYR 396
               +   + W+    +    +I  L EKY    I IDA   G    + ++   G     
Sbjct: 452 EKYRVLARYQWNGLSYKYQAAQIKQLFEKYNMTYIGIDATGVGYGVYEQVKEFAGRKAVP 511

Query: 397 VLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
           ++    +         +TE+ +K+ D +E   +        ++ +   +K     +   +
Sbjct: 512 LVYNPES---------KTEMVLKVHDLVEHEQIEWDENERDIVPSFLMIKHTSTKSGNTM 562

Query: 454 AIESKRVKGAKSTDYSDGLMYT 475
              ++R    +  D    +   
Sbjct: 563 TFVAERTVKTQHADVFFAIANA 584


>gi|294634584|ref|ZP_06713119.1| terminase, ATPase subunit [Edwardsiella tarda ATCC 23685]
 gi|291092098|gb|EFE24659.1| terminase, ATPase subunit [Edwardsiella tarda ATCC 23685]
          Length = 588

 Score =  110 bits (274), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 56/469 (11%), Positives = 117/469 (24%), Gaps = 52/469 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGDLFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +            I+     G      + +      D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIV-TIEDALAGGCTLFDLDQLKRENSADD--F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP---------YAPLIMGCDIAEEGGDN 331
           +     +F       F    +    ++                  P+ +G D +  G   
Sbjct: 364 KNLFMCEFVDDKASVFPFEELQRCMVDALEAWTDVNPYADHPFDRPVWIGYDPSHTGDSA 423

Query: 332 TVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCD 385
             VVL           +     W   D  T    I  L EKYR D I IDA   G     
Sbjct: 424 GCVVLAPPAVPGGKFRMLERHQWKGMDFSTQAEAIRALTEKYRVDYIGIDATGIGQGVFQ 483

Query: 386 YLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQNLKSL 442
            +               A +L +    +T + +K  D +    L      + +  +  ++
Sbjct: 484 LVRE---------FYPAARELRYNPEVKTAMVLKAKDTIANGRLEYDVSYTDVTASFMAI 534

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
           +  +  +      ++ R   A   D +   M+     P  +        
Sbjct: 535 RKTMTASGRSTTYDASRSDEASHADLAWATMHALLNEPLTAGSGRPSSS 583


>gi|323186590|gb|EFZ71927.1| gp33 TerL protein [Escherichia coli 1357]
          Length = 503

 Score =  110 bits (274), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 68/507 (13%), Positives = 140/507 (27%), Gaps = 87/507 (17%)

Query: 3   RELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWG--------EKGTPLEGFSAPRSW 54
           + +  NPE    L     ++               WG        + G P+         
Sbjct: 26  QRIRQNPEILPVLKQFYRTNP--------AQFIIDWGMTTDPRNIDYGLPVTIPFLLFPK 77

Query: 55  QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLA 114
           Q E++  +     N  N    +         R +G +     L   L      + +   +
Sbjct: 78  QEEWIHWIMERWSNRENGITEK--------SREMGLSWTAIGLACSLCLFNKEMVIGFGS 129

Query: 115 NSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCR 174
             E  + +T   +   W +       F           W        + ++      + +
Sbjct: 130 RKEEYVDSTGDPKALFWKAR-----KFVETLPVEFRGSWSEKKHAPYMRVEFPETGAVIK 184

Query: 175 TYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS 234
             + +                  DEA+       L I   L+     R  I  S+   ++
Sbjct: 185 GEAGDNIG-----RGDRTTLYFVDEAAFL--QRPLLIDAALS--QTTRCRIDLSSVNGMN 235

Query: 235 GKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDID 294
             F +  +        F    R+    D  ++     +   +  +   E+   +      
Sbjct: 236 NPFAQKRH--SGKIPVFTFHWRSDPRKDDEWYHKECEKID-NPVIVAQELDLNYQASAEG 292

Query: 295 SFIPLNIIEEALNREPC--PDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKT- 351
             IP   ++ A++        P    +   D+A+EG D     LR G ++  + +WS   
Sbjct: 293 ILIPSEWVQAAVDAHIRLGIQPGGQRLGAMDVADEGRDKNACSLRYGILLNDVQEWSGKG 352

Query: 352 -DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY------------------ 392
            D+  +  K+ GL + +  D    D +  GA        +                    
Sbjct: 353 SDIYDSVVKVFGLCDDFGADEFRFDEDGLGAGVRGDARAINELREAEGICQITATPFRGS 412

Query: 393 ---------HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEF-----ASLINHSGLIQN 438
                     V    G+   ++ +F  N + +    +             +      I +
Sbjct: 413 GSVFHPENEAVPGDNGKPARLNKDFFVNAKAQGWWHLRKLFRNTFRALQGMEYDPDEIIS 472

Query: 439 LKSLKSFIVPNTGELAIE------SKR 459
           + S     + N   L +E      SK+
Sbjct: 473 ISS----TMENKDRLLMELSQPTWSKK 495


>gi|21243371|ref|NP_642953.1| phage-related terminase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108918|gb|AAM37489.1| phage-related terminase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 594

 Score =  110 bits (274), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 52/470 (11%), Positives = 105/470 (22%), Gaps = 57/470 (12%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
                 +Q                          I   R IG T   A   L    T   
Sbjct: 148 VDGCFDYQR-------DWYRAGNERTR------IILKSRQIGATFYFAREALIDALTTGR 194

Query: 108 ISVICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
             +   A+                E         +   F   +                 
Sbjct: 195 NQIFLSASKAQAHLFRGYMQQFVRETIDETLSGGDSIVFPNGAELFFLGTNARTAQGYHG 254

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
                 +          +  + +  H  +     +  +S   +           +     
Sbjct: 255 NFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYFSTPSSMAHEAYTFWTGERRNKGKPAA 314

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGI--DPSFHEGIIARYGLDSDVT 280
             I                 +  D   R  ++    +    D    E +   Y  D    
Sbjct: 315 QRIQIDVSHDA----LAGGRRCQDRAWRQIVNILDAQRRGCDLFDIEELREEYSPD--AF 368

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREP------------CPDPYAPLIMGCDIAEEG 328
              +   F      S  PL +++  +                 P     + +G D AE G
Sbjct: 369 ANLLMCDFVDD-GASIFPLAMLQPCMVDSWVEWGQDYKPFAARPYGDRAVWIGYDPAETG 427

Query: 329 GDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGAR 382
               +VVL           +     +   D      +I  +  +Y    I ID    G+ 
Sbjct: 428 DTAGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAAEIERITRRYWVTYIGIDTTGMGSG 487

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNL 439
               ++    ++                  +T L +K  D +    L   +    + Q+L
Sbjct: 488 VAQLVKQFFPNLVTFSYSPE---------VKTRLVLKAFDVIHNERLEFDAGWTDVAQSL 538

Query: 440 KSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
            +++  +  +  +    + R +     D +  L +     P         
Sbjct: 539 MAIRKTMTASGRQSTFTAGRSEETGHADLAWALFHALQNEPLEGRTARNS 588


>gi|84623266|ref|YP_450638.1| phage-related terminase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84367206|dbj|BAE68364.1| phage-related terminase [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 594

 Score =  110 bits (274), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/434 (11%), Positives = 101/434 (23%), Gaps = 40/434 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-----ETQLKTTLWAEVSKWLSLLP 136
           I   R IG T   A   L    T     +   A+                E         
Sbjct: 169 ILKSRQIGATFYFAREALIDALTTGRNQIFLSASKAQAHLFRGYMQQFVRETIDETLSGG 228

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +   F   +                       +          +  + +  H  +     
Sbjct: 229 DSIVFPNGAELFFLGTNARTAQGYHGNFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYF 288

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S   +           +       I                 +  D   R  ++  
Sbjct: 289 STPSSMAHEAYTFWTGERRNKGKPAAQRIQIDVSHDA----LAGGRRCQDRAWRQIVNIL 344

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP------ 310
             +       +    R     D     +   F      S  PL +++  +          
Sbjct: 345 DAQRRGCDLFDIDELREEYSPDAFANLLMCDFVDD-GASIFPLAMLQPCMVDSWVEWGQD 403

Query: 311 ------CPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                  P     + +G D AE G    +VVL           +     +   D      
Sbjct: 404 YKPFAVRPYGDRAVWIGYDPAETGDTAGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAA 463

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I  +  +Y    I ID    G+     ++    ++                  +T L +
Sbjct: 464 EIERITRRYWVTYIGIDTTGMGSGVAQLVKQFFPNLVTFSYSPE---------VKTRLVL 514

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L   +    + Q+L +++  +  +  +    + R +     D +  L + 
Sbjct: 515 KAFDVIHNGRLEFDAGWTDVAQSLMAIRKTMTASGRQSTFSAGRSEETGHADLAWALFHA 574

Query: 476 FAENPPRSDMDFGR 489
               P         
Sbjct: 575 LQNEPLEGRTARNS 588


>gi|318603823|emb|CBY25321.1| phage terminase, ATPase subunit [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 257

 Score =  110 bits (274), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 71/250 (28%), Gaps = 31/250 (12%)

Query: 262 DPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP------- 314
           D    + +       +   R     +F       F    +    ++     +        
Sbjct: 15  DRFDIDQLRRENS--AADFRNLFLCEFVDDKASVFPFEELQACMVDSLVEWEDFAPFAEQ 72

Query: 315 ---YAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVE 365
              Y P+ MG D +  G     VV+           I     W   D       I  L E
Sbjct: 73  PFNYHPVWMGYDPSHTGDSAGCVVMAPPWVPGGKFRILERHQWKGMDFADQAESIKKLTE 132

Query: 366 KYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLE 425
           KY  + I IDA   G      +               A ++ +    +T + +K  D + 
Sbjct: 133 KYNVEYIGIDATGIGQGVYQLVR---------NFFPAAREIRYSAEVKTNMVLKAKDLIT 183

Query: 426 FASLINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPR 482
              L      + +  +  +++  +  +      E+ R +     D +   M+     P  
Sbjct: 184 TGRLEYDISYTDITLSFMAIRKTMTASGRSATYEASRSEEVSHADLAWAAMHAMINEP-L 242

Query: 483 SDMDFGRCPS 492
           +  +    PS
Sbjct: 243 TAGNGNVTPS 252


>gi|168822412|ref|ZP_02834412.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205341123|gb|EDZ27887.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 589

 Score =  110 bits (274), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 55/475 (11%), Positives = 116/475 (24%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++      H +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLEHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALAGGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFAPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEGIRKLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGMQPKSILEF 588


>gi|41057355|ref|NP_958058.1| gp3 [Enterobacteria phage PsP3]
 gi|37548561|gb|AAN08365.1| gp3 [Enterobacteria phage PsP3]
          Length = 589

 Score =  109 bits (273), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 56/475 (11%), Positives = 117/475 (24%), Gaps = 55/475 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALAGGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFAPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEGIRRLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           S++  +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSAGSGMQPKSILEF 588


>gi|114046227|ref|YP_736777.1| hypothetical protein Shewmr7_0720 [Shewanella sp. MR-7]
 gi|113887669|gb|ABI41720.1| protein of unknown function DUF264 [Shewanella sp. MR-7]
          Length = 602

 Score =  109 bits (273), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 58/446 (13%), Positives = 119/446 (26%), Gaps = 53/446 (11%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   A              +   A S  Q       EV +   +   + +F
Sbjct: 176 ILKSRQIGATYYFAGEAFEQAVLTGDPQIFLSA-SRNQA------EVFRSYIVAIAQEFF 228

Query: 142 EMQSLS--------------LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGH 187
           E++                    +            +    Y  + +     +  + +  
Sbjct: 229 EIELTGNPMVLHTAHGDAELRFLSTNSKTAQSYHGHVYVDEYFWINKFDVLNKLASAMAT 288

Query: 188 HNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDD 247
           H  +     +  ++               +    R  +      +L          P   
Sbjct: 289 HKNWRKTYFSTPSTKAHAAYPFWTGDHWRQGKPEREEVEFPTFDQLRDGGRLC---PDKQ 345

Query: 248 WK-RFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNI----I 302
           W+    I+     G D    + +   Y  D           F       F   ++    +
Sbjct: 346 WRYVVTIEDALAGGCDLFDIDELREEYNGDD--FNNLFMCIFVDDADSVFKFSDLEKCMV 403

Query: 303 EEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKT 351
           + A  ++  P    P     + +G D +    + T+VV+           +     W   
Sbjct: 404 DAARWQDHKPAAPRPFGNREVWLGYDPSRTRDNATLVVVAPGEKKGEKFRVLEKHYWRGM 463

Query: 352 DLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRN 411
           +      +I  +  KYR   I +D    GA   D +  L            A  + +   
Sbjct: 464 NFSHHVAEIQKIYAKYRVTYIGVDTTGIGAGVFDSISTLYPR--------EATAIHYSVG 515

Query: 412 RRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDY 468
            +T L +KM D +E   +   +    +  +  S++       G +  ++ R       D 
Sbjct: 516 SKTRLVLKMIDVVEGGRIEWDASHKDIAMSCLSIRRTSTDGGGAITFKASRDNVTGHADV 575

Query: 469 SDGLMYTFAENPPRSDMDFGRCPSYQ 494
              + +     P   +       + Q
Sbjct: 576 FFAIAHAVINEPLNYEHKRTSSWAMQ 601


>gi|167991605|ref|ZP_02572704.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205329999|gb|EDZ16763.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
          Length = 590

 Score =  109 bits (272), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/463 (12%), Positives = 115/463 (24%), Gaps = 55/463 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL++     AH +              I   R IG T   +   L        
Sbjct: 142 FDQSFEYQLQWYRAGLAHRIRD------------ILKSRQIGATFYFSREALLRALKTGH 189

Query: 108 ISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQ-------SLSLHPAPWYSDVLHC 160
             +   A S+TQ    ++ E     + L +              +  +      +     
Sbjct: 190 NQIFLSA-SKTQAY--VFREYIIQFARLVDVDLTGDPIVIGNNGAKLIFLGTNSNTAQSH 246

Query: 161 SLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNA 220
           +  +       +       +  + +           +  ++               +  A
Sbjct: 247 NGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTYFSTPSTLAHGAYPFWSGELFNKGRA 306

Query: 221 NRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVT 280
           +    +  +    +     +             D            +        D    
Sbjct: 307 SAADRIEIDISHSALAGGLLCADGQWRQIVTIEDALAGGCTLFDLDQLRRENSDED---F 363

Query: 281 RVEVCGQFPQQDIDSFIPLNIIEEALNREPC-----------PDPYAPLIMGCDIAEEGG 329
           +     +F       F P   ++  +                P    P+ +G D +  G 
Sbjct: 364 KNLFMCEFVDDKASVF-PFEELQRCMVDVMETWEDFTPFADHPFGSRPVWIGYDPSHTGD 422

Query: 330 DNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGART 383
               VVL           +     W   D       I  L EKY  + I IDA   G   
Sbjct: 423 SAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQAEGIRRLTEKYNVEYIGIDATGLGLGV 482

Query: 384 CDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLK 440
              +               A  + +    +T + +K  D +    L   +    + Q+  
Sbjct: 483 FQLVR---------SFYPAARGIRYTPEMKTAMVLKAKDTIRRGCLEYDAGATDVTQSFM 533

Query: 441 SLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRS 483
           S++  +  +      E+ R + A   D +   M+     P  +
Sbjct: 534 SIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSA 576


>gi|58581337|ref|YP_200353.1| phage-related terminase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425931|gb|AAW74968.1| phage-related terminase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 594

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/434 (11%), Positives = 100/434 (23%), Gaps = 40/434 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS-----ETQLKTTLWAEVSKWLSLLP 136
           I   R IG T   A   L    T     +   A+                E         
Sbjct: 169 ILKSRQIGATFYFAREALIDALTTGRNQIFLSASKAQAHLFRGYMQQFVRETINETLSGG 228

Query: 137 NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAII 196
           +   F   +                       +          +  + +  H  +     
Sbjct: 229 DSIVFPNGAELFFLGTNARTAQGYHGNFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYF 288

Query: 197 NDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTR 256
           +  +S   +           +       I                 +  D   R  ++  
Sbjct: 289 STPSSMAHEAYTFWTGERRNKGKPAAQRIQIDVSHDA----LAGGRRCQDRAWRQIVNIL 344

Query: 257 TVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP------ 310
             +       +    R     D     +   F      S   L +++  +          
Sbjct: 345 DAQRRGCDLFDIDELREEYSPDAFANLLMCDFVDD-GASIFSLAMLQPCMVDSWVEWGQD 403

Query: 311 ------CPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
                  P     + +G D AE G    +VVL           +     +   D      
Sbjct: 404 YKPFAVRPYGDRAVWIGYDPAETGDTAGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAA 463

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I  +  +Y    I ID    G+     ++    ++                  +T L +
Sbjct: 464 EIERITRRYWVTYIGIDTTGMGSGVAQLVKQFFPNLVTFSYSPE---------VKTRLVL 514

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  D +    L   +    + Q+L +++  +  +  +    + R +     D +  L + 
Sbjct: 515 KAFDVIHNGRLEFDAGWTDVAQSLMAIRKTMTASGRQSTFSAGRSEETGHADLAWALFHA 574

Query: 476 FAENPPRSDMDFGR 489
               P         
Sbjct: 575 LQNEPLEGRTARNS 588


>gi|330874284|gb|EGH08433.1| hypothetical protein PSYMP_06646 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 684

 Score =  109 bits (271), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 62/460 (13%), Positives = 125/460 (27%), Gaps = 58/460 (12%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMATHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D D  +  
Sbjct: 325 NAKEPWPSDKQISAGALCPDGQWR-KVITILDAIAGGCDLFDLEQLQLEY--DDDKFQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P P   +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +G++   + R       D +  +M+     P  +D
Sbjct: 552 -GTTASGQVTYSASRTDATGHADVAWAVMHALQYEPLNTD 590


>gi|170023192|ref|YP_001719697.1| hypothetical protein YPK_0943 [Yersinia pseudotuberculosis YPIII]
 gi|169749726|gb|ACA67244.1| protein of unknown function DUF264 [Yersinia pseudotuberculosis
           YPIII]
          Length = 697

 Score =  109 bits (271), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/435 (11%), Positives = 106/435 (24%), Gaps = 40/435 (9%)

Query: 85  GRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL----KTTLWAEVSKWLSLLPNKHW 140
            R IG T   A+  L              A+    L        +A     + L  +   
Sbjct: 184 SRQIGATWYAAFEALEDAILTGNNQAFLSASRPQSLIFRRYIIKFAFELFGIELTGDPIV 243

Query: 141 FEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA 200
               +     +   +        +              +     +  H+      I+  +
Sbjct: 244 LSNGAELHFLSTNTNTAQGFCANVYIDEIFWQRGFTQLKNVAAAIATHSYLRRTYISTPS 303

Query: 201 SGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEG 260
           + T             +    R  +   +   + G    +       +     D      
Sbjct: 304 AKTHQAYPFWSGDEWRKGKKERENVTFPSFAEMQG--GVMCPDNHWRFITTIEDAIAGGA 361

Query: 261 IDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPY----- 315
                 E +    G             F       F   + +E+ L      + +     
Sbjct: 362 HILMDIEELREENGE--SAFNQLYMCLFVDTGDCVFR-FDQLEKCLVTVSNWEDHDVNAA 418

Query: 316 -----APLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLV 364
                  +  G D A  G   + V++           + H+  W     +    +I   +
Sbjct: 419 RPFGNREVWAGYDPARSGDTASFVLVAPPQADGEPFRVLHIETWHGFAFKYQVGRIKEYM 478

Query: 365 EKYRPDAIIIDANNTGARTCDYLEMLG-YHVYRVLGQKRAVDLEFCRNRRTELHVKMADW 423
            +Y    I ID+   G   C+ ++      V ++     + +          L +KM D 
Sbjct: 479 ARYNITHIGIDSTGIGGPVCELVQEFARREVTQIHYSPESKNR---------LVMKMIDL 529

Query: 424 LEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           +E   +   I    +  +  +++       G +   + R       D    + +     P
Sbjct: 530 VEHKRIAWDIEDKSIGASFMAIRHTTTKMGGAMTFVADRSADTGHADRFFAIAHAVINEP 589

Query: 481 --PRSDMDFGRCPSY 493
                    G    +
Sbjct: 590 INNERKRKSGWAKRF 604


>gi|186896884|ref|YP_001873996.1| hypothetical protein YPTS_3586 [Yersinia pseudotuberculosis PB1/+]
 gi|186699910|gb|ACC90539.1| protein of unknown function DUF264 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 595

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/473 (12%), Positives = 128/473 (27%), Gaps = 63/473 (13%)

Query: 39  GEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLV 98
           G +   LE F+       E +     +   + ++    + K      R IG T   A+  
Sbjct: 138 GIQQEELELFAG------ETLFFYQQYLRANKHHAIRNILK-----SRQIGATWYFAFEA 186

Query: 99  LWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS----------- 147
           L          +   A S  Q       EV +   +   + +F +               
Sbjct: 187 LEDAIMSGDPQIFLSA-SRAQA------EVFRSYIVNIAQQFFGVTLTGNPIRLSNGAEL 239

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
              +   +     S  +    Y  +          + +  H+ +     +  ++ T    
Sbjct: 240 RFLSTNKNTAQSYSGHLYCDEYLWVPNFAKLNEVASAMATHDKWRTTYFSTPSAKTHQGY 299

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
                    + +  R  I          +                ++     G + +  E
Sbjct: 300 PFWTGEEWKQGDKQRSKITFPEFD--EYRDGGRLCPDGQWRYVITLENAIDGGFNLADIE 357

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPYAPL------ 318
            +  +Y  D+    +     F       F   +++E+    +      D  AP       
Sbjct: 358 RLRNKYNRDT--FNMLYMCVFVDSGDSVF-KFHMLEKCGVDIEMWQDHDFSAPRPFGNRE 414

Query: 319 -IMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
              G D A  G  +T V++           +   F W   +     N+I  L ++Y    
Sbjct: 415 VWGGFDPARSGDTSTFVIIAPPQFEGERFRVLATFYWQGLNFNYQANQIKELFQRYNMTY 474

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLI 430
           I +D    G    + ++             R           +  L +KM D +E   L 
Sbjct: 475 IGVDITGIGNGVFELVQ---------NFAMRQAVAIHYGLESKNRLVMKMVDVIESQRLE 525

Query: 431 NHSG---LIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
             +    +  +  +++       G +   + R K     D    + +     P
Sbjct: 526 WDAEAKEIPASFLAIRRTSTAKGGGMTFVADRTKETGHADVFFAIAHAIDNEP 578


>gi|328952976|ref|YP_004370310.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453300|gb|AEB09129.1| hypothetical protein Desac_1270 [Desulfobacca acetoxidans DSM
           11109]
          Length = 466

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 75/454 (16%), Positives = 139/454 (30%), Gaps = 70/454 (15%)

Query: 51  PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISV 110
           P  WQ +F+                   +  +   R  GK+T  A L L      PG  +
Sbjct: 27  PDPWQQDFL--------------VSRPEQALLLCSRQSGKSTSAAALALHEALFHPGALI 72

Query: 111 ICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
           + L+ S  Q +  L+ + +     LP+         S     +       SL    +   
Sbjct: 73  LLLSPSLRQSQE-LFRKAAGLYQRLPHAPAACRT--SALRLEFDHGSRIISLPGQEETIR 129

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
                                   ++ DEA+  PD +   +   L    +       S P
Sbjct: 130 GFS-----------------EVRLLVIDEAALVPDELYYAVRPMLAV--SRGRLTALSTP 170

Query: 231 RRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
               G FY  + +  D W+R+ I       I   F      +  L +   R E   +F  
Sbjct: 171 AGKRGWFYHCYTEGGDQWQRYTIPATQCPRISADFL--AAEQRSLPAAWFRAEYFCEF-G 227

Query: 291 QDIDSFIPLNIIEEALNREPCP--------DPYAPLIMGCDIAEEGGDNTVVVLRRGP-- 340
           +  +   P ++++ A   +  P         P     +G D+ +    + + ++ R P  
Sbjct: 228 EAANQLFPAHLLQTAQCSQVSPLFAEITPSPPTGTFFIGLDLGQSQDYSALTIIHRSPAL 287

Query: 341 -----VIEHLFDWS-KTDLRTTNNKISGLVEK---YRPDAIIIDANNTGARTCDYLEMLG 391
                 + HL  +  +T       ++  L+++        +I+D    GA   D L   G
Sbjct: 288 PDPPCHLRHLQRFPLRTPYPDIVRQVRELLQQPQIGPNPLLIVDKTGVGAPVVDMLTQAG 347

Query: 392 YHVYRVLGQKRAVDLEFCRNRR---TELHVKMADWLEFA------SLINHSGLIQNLKSL 442
            + Y V         +  R+ R    +L   +   L+        +L     LI  L++ 
Sbjct: 348 MNPYAVTIHGGEAVSQNGRDLRLPQRDLIANLQVALQTGSLKLAPALPQLPLLIHELENF 407

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTF 476
               +  +G     +         D    L    
Sbjct: 408 -HLTISASGRERYAAGPD--GPHDDLVFSLALAL 438


>gi|289628558|ref|ZP_06461512.1| hypothetical protein PsyrpaN_26063 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648058|ref|ZP_06479401.1| hypothetical protein Psyrpa2_09957 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330870325|gb|EGH05034.1| hypothetical protein PSYAE_24348 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 684

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/460 (13%), Positives = 124/460 (26%), Gaps = 58/460 (12%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQSWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMATHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D    +  
Sbjct: 325 AAKDPWPSDKQISAGALCPDGQWR-KVITILDAIAGGCDLFDLEQLQLEYDEDK--FQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P P   +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +G++   + R       D +  +M+     P  +D
Sbjct: 552 -GTTASGQVTYSASRTDATGHADVAWAVMHALQYEPLNTD 590


>gi|333010190|gb|EGK29625.1| phage terminase large subunit domain protein [Shigella flexneri
           K-272]
 gi|333021147|gb|EGK40404.1| phage terminase large subunit domain protein [Shigella flexneri
           K-227]
          Length = 235

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 57/211 (27%), Gaps = 45/211 (21%)

Query: 313 DPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNKISGL-VEKYRPDA 371
           +P     +G D+A+ G D    V R G V+    +W   +     +          R   
Sbjct: 10  EPSGRKRIGFDVADSGTDKCANVYRHGSVVFWADEWKAKEDELLKSCQRTYQAALEREAD 69

Query: 372 IIIDANNTGARTCDYLEMLG----------YHVYRVLGQKRA------------VDLEFC 409
           I+ D+   GA        +             V        A             + +F 
Sbjct: 70  IVYDSIGVGASAGAKFSEINADRKSENAYARRVNYQRFNAGAGVHEPDDEYNGIPNKDFF 129

Query: 410 RNRRTELHVKMAD-------WLEFASLINHSGLIQ------------NLKSLKSFIVPNT 450
            N + +    +AD        +          LI                +         
Sbjct: 130 ANLKAQAWWLVADRFRNTFNAINNGEQYPVDELISIDSRCPLLEKLKLELTTPHRDFDRN 189

Query: 451 GELAIESKR---VKGAKSTDYSDGLMYTFAE 478
           G + +ESK+    +   S + +D  +  FA 
Sbjct: 190 GRVMVESKKDLAKREIPSPNVADAFIMAFAP 220


>gi|323188196|gb|EFZ73489.1| terminase, ATPase subunit [Escherichia coli RN587/1]
          Length = 594

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/470 (12%), Positives = 116/470 (24%), Gaps = 52/470 (11%)

Query: 55  QLEFMEVV--------DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
           Q E ++ +          H   +            I+  R IG T               
Sbjct: 137 QAEKLKQLFLDGLYPHQKHWYRAGLEHRIRD----INKSRQIGATMFFGREGFMDAVESG 192

Query: 107 GISVICLANSE--TQLKTTL--WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
              +   A+     Q +  +  +A  +         H     S                 
Sbjct: 193 RNQIFLSASKAQAHQFRQYIVDFAREADVELKGEVIHLPHNDSRMYFLGTNARTAQTYHG 252

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +    Y  + R     R    +     +     +  +S T +           +     
Sbjct: 253 NLYLDEYFWIHRFLELRRNAAGMASQKRWRQTYFSTPSSITHEAYKFWTGQLFNKGRPKS 312

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTR 281
             I      R               W++   ++    +G D    E +      +     
Sbjct: 313 EQIRLDISHRALSAGRLC---EDGQWRQIVTVEDAINQGYDLFDLEQLRLENSPEE--FA 367

Query: 282 VEVCGQFPQQDIDSFIPLNIIEEAL-NREPCPDPYAP----------LIMGCDIAEEGGD 330
                QF       F PL++++  + +     D Y P          + +G D A  G  
Sbjct: 368 NLFMCQFIDDTASVF-PLSMLQGCMVDSWEVWDDYKPFALRPLGERSVWVGYDPALSGDS 426

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
              VV+           +     W   D       I  + E+Y    I ID    G    
Sbjct: 427 AGCVVVAPPVIEGGKFRVIEKHQWHGMDFAAQAENIRKITERYNVTYIGIDVTGIGHGVH 486

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKS 441
             ++     V                  +  L +K  D +    L   +    L Q   +
Sbjct: 487 QLVKQFFPAVQAFSYSPE---------VKQRLVLKTLDVVRKHRLEFDAGWTDLAQAFMA 537

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
           ++  + P+  ++  E+ R +     D +   M+     P  S        
Sbjct: 538 IRKTLTPSGRQVTFEASRSEEVSHADLAWACMHAIINEPLESSGGANSGR 587


>gi|325926090|ref|ZP_08187451.1| hypothetical protein XPE_1415 [Xanthomonas perforans 91-118]
 gi|325928218|ref|ZP_08189424.1| hypothetical protein XPE_3475 [Xanthomonas perforans 91-118]
 gi|325541407|gb|EGD12943.1| hypothetical protein XPE_3475 [Xanthomonas perforans 91-118]
 gi|325543435|gb|EGD14857.1| hypothetical protein XPE_1415 [Xanthomonas perforans 91-118]
          Length = 587

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/468 (10%), Positives = 103/468 (22%), Gaps = 53/468 (11%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
                 +Q                          I   R IG T   A   L    T   
Sbjct: 141 VDGCFDYQR-------DWYRAGNERTR------IILKSRQIGATFYFAREALIDALTTGR 187

Query: 108 ISVICLANS-----ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
             +   A+                E         +   F   +                 
Sbjct: 188 NQIFLSASKAQAHLFRGYMQQFVRETIDETLSGGDSIVFPNGAELFFLGTNARTAQGYHG 247

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
                 +          +  + +  H  +     +  +S   +           +     
Sbjct: 248 NFYFDEFFWTYGFNELNKVASGMAMHKKWRKTYFSTPSSMAHEAYTFWTGERRNKGKPAA 307

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
             I                 +  D   R  ++    +       +    R     D    
Sbjct: 308 QRIQIDVSHDA----LAGGRRCQDRAWRQIVNILDAQRRGCDLFDIDELREEYSPDAFAN 363

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREP------------CPDPYAPLIMGCDIAEEGGD 330
            +   F      S  PL +++  +                 P     + +G D AE G  
Sbjct: 364 LLMCDFVDD-GASIFPLAMLQPCMVDSWVEWGQEYKPFAARPYGDRAVWIGYDPAETGDT 422

Query: 331 NTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
             +VVL           +     +   D      +I  +  +Y    I ID    G+   
Sbjct: 423 AGLVVLAPPQQPGGKFRLLERIQFRGMDFAKQAAEIERITRRYWVTYIGIDTTGMGSGVA 482

Query: 385 DYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKS 441
             ++    ++                  +T L +K  D +    L   +    + Q+L +
Sbjct: 483 QLVKQFFPNLVTFSYSPE---------VKTRLVLKAFDVIHNERLEFDAGWTDVAQSLMA 533

Query: 442 LKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGR 489
           ++  +  +  +    + R +     D +  L +     P         
Sbjct: 534 IRKTMTASGRQSTFTAGRSEETGHADLAWALFHALQNEPLEGRTARNS 581


>gi|330985172|gb|EGH83275.1| hypothetical protein PLA107_09108 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 684

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 62/460 (13%), Positives = 125/460 (27%), Gaps = 58/460 (12%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMATHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D D  +  
Sbjct: 325 AAKDPWPSDKQISAGALCPDGQWR-KVITILDAIAGGCDLFDLEQLQLEY--DDDKFQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P P   +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +G++   + R       D +  +M+     P  +D
Sbjct: 552 -GTTASGQVTYSASRTDATGHADVAWAVMHALQYEPLNTD 590


>gi|330967816|gb|EGH68076.1| hypothetical protein PSYAC_24858 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 774

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/460 (13%), Positives = 124/460 (26%), Gaps = 58/460 (12%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQSWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMAPHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D    +  
Sbjct: 325 AAKDPWPSDKQISAGALCPDGQWR-KVITILDAISGGCDLFDLEQLQLEYDEDK--FQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P     +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRLYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
               N+G++   + R       D +  +M+     P  +D
Sbjct: 552 -GTTNSGQVTYSASRTDATGHADVAWAIMHALQYEPLNTD 590


>gi|170023146|ref|YP_001719651.1| hypothetical protein YPK_0897 [Yersinia pseudotuberculosis YPIII]
 gi|169749680|gb|ACA67198.1| protein of unknown function DUF264 [Yersinia pseudotuberculosis
           YPIII]
          Length = 595

 Score =  108 bits (269), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 59/473 (12%), Positives = 127/473 (26%), Gaps = 63/473 (13%)

Query: 39  GEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLV 98
           G +   LE F+       E +     +   + ++    + K      R IG T   A+  
Sbjct: 138 GIQQEELELFAG------ETLFFYQQYLRANKHHAIRNILK-----SRQIGATWYFAFEA 186

Query: 99  LWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS----------- 147
           L          +   A S  Q       EV +   +   + +F +               
Sbjct: 187 LEDAIMSGDPQIFLSA-SRAQA------EVFRSYIVNIAQQFFGVTLTGNPIRLSNGAEL 239

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
              +   +     S  +    Y  +          + +  H+ +     +  ++ T    
Sbjct: 240 RFLSTNKNTAQSYSGHLYCDEYLWVPNFAKLNEVASAMATHDKWRTTYFSTPSAKTHQGY 299

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
                    + +  R  I          +                ++     G + +  E
Sbjct: 300 PFWTGEEWKQGDKQRSKITFPEFD--EYRDGGRLCPDGQWRYVITLEDAIDGGFNLADIE 357

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPYAPL------ 318
            +  +Y  D+    +     F       F   +++E+    +      D  AP       
Sbjct: 358 RLRNKYNRDT--FNMLYMCVFVDSGDSVF-KFHMLEKCGVDIEMWQDHDFSAPRPFGNRE 414

Query: 319 -IMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
              G D A  G  +T  ++           +   F W   +     N+I  L ++Y    
Sbjct: 415 VWGGFDPARSGDTSTFAIIAPPQFEGERFRVLVTFYWQGLNFNYQANQIKELFQRYNMTY 474

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLI 430
           I +D    G    + ++             R           +  L +KM D +E   + 
Sbjct: 475 IGVDITGIGNGVFELVQ---------NFAMRQAVAIHYGLESKNRLVMKMIDVIESQRIE 525

Query: 431 NHSG---LIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
             +    +  +  +++       G +   + R K     D    + +     P
Sbjct: 526 WDAEAKEIPASFLAIRRTSTAKGGGMTFVADRTKETGHADVFFAIAHAIDNEP 578


>gi|331017153|gb|EGH97209.1| hypothetical protein PLA106_13994 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 684

 Score =  108 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 62/460 (13%), Positives = 125/460 (27%), Gaps = 58/460 (12%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           M         +  NP     +  + + R +G T   A              V   A+   
Sbjct: 155 MYGYQKELFAAKQNPLTARIRNILKS-RQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ 213

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQSLS---------------LHPAPWYSDVLHCSLG 163
                  +E+ +   +   + WF ++                     +   S        
Sbjct: 214 -------SEIFRSYIIAFAQAWFGLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGH 266

Query: 164 IDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRF 223
           +    Y  +          + +  H  +     +  ++ +              RN+ R 
Sbjct: 267 VYVDEYFWIRDFEKLNTVASAMATHKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRK 324

Query: 224 WIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVE 283
                 P         +        K   I      G D    E +   Y  D D  +  
Sbjct: 325 AAKDPWPSDKQISAGALCPDGQWR-KVITILDAIAGGCDLFDLEQLQLEY--DDDKFQQL 381

Query: 284 VCGQFPQQDIDSFIPLNIIEEALNR----------EPCPDPYAPLIMGCDIAEEGGDNTV 333
              +F      +F  L  +E   +           +P P   +P+ +G D +    D T 
Sbjct: 382 FMCKFIDSSQSAF-SLADLERCYSDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATC 440

Query: 334 VVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           VV+           I     W     +    ++  L E++    I ID    G    D +
Sbjct: 441 VVIAPPLENGGKFRILEKHSWRGQSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLV 500

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                         RA  + +    +  L +K  D ++ + +   +    + Q   ++K 
Sbjct: 501 RD---------FYPRATSIHYSLETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR 551

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
                +G++   + R       D +  +M+     P  +D
Sbjct: 552 -GTTASGQVTYSASRTDATGHADVAWAVMHALQYEPLNTD 590


>gi|53717814|ref|YP_106800.1| phage terminase, ATPase subunit [Burkholderia pseudomallei K96243]
 gi|52208228|emb|CAH34159.1| phage terminase, ATPase subunit [Burkholderia pseudomallei K96243]
          Length = 589

 Score =  108 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 316

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 317 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|145639505|ref|ZP_01795109.1| putative phage gene [Haemophilus influenzae PittII]
 gi|145271296|gb|EDK11209.1| putative phage gene [Haemophilus influenzae PittII]
          Length = 629

 Score =  108 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/442 (11%), Positives = 114/442 (25%), Gaps = 44/442 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +     H   + ++    + K      R IG T   ++  L          +   A S+ 
Sbjct: 185 LFDYQKHIRANKHHDVRNILK-----SRQIGATYYFSFEALEDAIFSGDNQIFLSA-SKR 238

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQ------SLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           Q        + K                    +     +   +     S  +    Y+ +
Sbjct: 239 QA-EIFKNYIVKMAREYFGVELTGNPIILSNGAELHFLSTNKNTSQGNSGHVYGDEYAWI 297

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
                     + +  H  +     +  +S   +  +        + +  R  +       
Sbjct: 298 RDFQRFNDVASAMATHAKWRETYFSTPSSKFHESYSFWSGDNWRDGDPKRKNVPFPTFAE 357

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
           L      +       +     D            E +  RY              +    
Sbjct: 358 LRDG-GRLCPDGQWRYVVTIEDALKGGAGTLFNIEKLKQRYSKY--AFNQLYMCVWIDDA 414

Query: 293 IDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVLR------ 337
              F    +    ++ +  ++  P    P     +  G D A  G   + V++       
Sbjct: 415 DSIFTVHQLLKCGVDISKWKDFNPKADRPFGDREVWGGFDPAHSGDGASFVIIAPPALPS 474

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               +   + W+        N+I  L EKY    I IDA   G    + ++         
Sbjct: 475 EKYRVLARYQWNGLSYVYQANQIRALYEKYNMTYIGIDATGVGYGVYELVKE-------- 526

Query: 398 LGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
              +RA          +T + +K+ D +E   +        ++ +   +K     +   +
Sbjct: 527 -FARRAATAIIYNPESKTGMVLKVHDLVEHGQIEWSESELDIVPSFLMIKHQSTKSGNTM 585

Query: 454 AIESKRVKGAKSTDYSDGLMYT 475
              ++R    +  D    +   
Sbjct: 586 TFTAERTVKTQHADVFFAICNA 607


>gi|134288710|ref|YP_001111154.1| gp4, phage terminase, ATPase subunit [Burkholderia phage phiE12-2]
 gi|134132095|gb|ABO60770.1| gp4, phage terminase, ATPase subunit [Burkholderia phage phiE12-2]
          Length = 601

 Score =  108 bits (268), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 155 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 209

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 210 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 269

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 270 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 328

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 329 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 385

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 386 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 445

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 446 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 505

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 506 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 556

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 557 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 600


>gi|260582917|ref|ZP_05850701.1| terminase ATPase subunit [Haemophilus influenzae NT127]
 gi|260094017|gb|EEW77921.1| terminase ATPase subunit [Haemophilus influenzae NT127]
          Length = 593

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 62/437 (14%), Positives = 126/437 (28%), Gaps = 43/437 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET--QLKTTLWAEVSKW--LSLLPN 137
           I   R IG T   A        T     +   A+ +   Q ++ +     +   + L   
Sbjct: 168 ILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSYIVNYAKQTADVELKGE 227

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +  +      +        +       + + Y   +  + +     Y     +
Sbjct: 228 TIKLPNGAELIFLGTNSATAQSYHGNLYFDEVFWVPKFYVMRKVASGMAAQKMYRQTYFS 287

Query: 198 DEASGTPDVINLGILGFLTE--RNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
              +                    + +  I  S+    SGK           WK+     
Sbjct: 288 TPTTIAHPAYAFFSGKAFNRNRAKSEKIEIDISHENLKSGKLCADR-----QWKQIVSIY 342

Query: 256 RTVEGIDPSF-HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
             +EG    F  + +IA    +          QF   +  +F   ++    ++       
Sbjct: 343 DAMEGGCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEWHD 400

Query: 315 YAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
           Y P          + +G D A  G    +V++           + H   +   D  T  +
Sbjct: 401 YKPFYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQAS 460

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I    + Y    I+ID    G+     +               A  LE+  + + E+ +
Sbjct: 461 RIKQFCDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMAQGLEYNADLKNEMVL 511

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  + ++   L   S    ++ +  ++K   +  TG++   S R + A   D S  +M  
Sbjct: 512 KTQNLIQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDRSEDASHGDLSWAIMNC 570

Query: 476 FAENPPRSDMDFGRCPS 492
               P     D     S
Sbjct: 571 ILNVPYGLGGDVSSNKS 587


>gi|254192775|ref|ZP_04899210.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
 gi|254197102|ref|ZP_04903525.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
 gi|169649529|gb|EDS82222.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
 gi|169653844|gb|EDS86537.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
          Length = 601

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 155 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 209

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 210 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 269

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 270 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 328

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 329 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 385

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 386 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 445

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 446 VDDGAFRVLERHQFRGNDFEEQATAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 505

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 506 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 556

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 557 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 600


>gi|254183934|ref|ZP_04890525.1| putative terminase, ATPase subunit [Burkholderia pseudomallei 1655]
 gi|184214466|gb|EDU11509.1| putative terminase, ATPase subunit [Burkholderia pseudomallei 1655]
          Length = 589

 Score =  107 bits (267), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFAREAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 316

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 317 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 IDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|254197041|ref|ZP_04903465.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
 gi|169653784|gb|EDS86477.1| putative terminase, ATPase subunit [Burkholderia pseudomallei S13]
          Length = 576

 Score =  107 bits (267), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 130 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 184

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 185 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 244

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 245 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 303

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 304 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 360

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 361 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 420

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 421 VDDGAFRVLERHQFRGNDFEEQATAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 480

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 481 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 531

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 532 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 575


>gi|330939345|gb|EGH42730.1| hypothetical protein PSYPI_10145 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 650

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 60/437 (13%), Positives = 119/437 (27%), Gaps = 57/437 (13%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R +G T   A              V   A+          +E+ +   +   + WF
Sbjct: 177 ILKSRQVGLTYYFAGEAFMDAVLTGDNQVFLSASRAQ-------SEIFRSYIIAFAQAWF 229

Query: 142 EMQSLS---------------LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVG 186
            ++                     +   S        +    Y  +          + + 
Sbjct: 230 GLELTGNPIVLSKDGKPWAELRFLSTNSSTAQGHHGHVYVDEYFWIRDFEKLNTVASAMA 289

Query: 187 HHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLD 246
            H  +     +  ++ +              RN+ R       P         +      
Sbjct: 290 THKKWRKTYFSTPSAVSHQAYPFWQGEKF--RNSKRKAAKDPWPSDKQISAGALCPDGQW 347

Query: 247 DWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEAL 306
             K   I      G D    E +   Y  D D  +     +F      +F  L  +E   
Sbjct: 348 R-KVITILDAIAGGCDLFDLEQLQLEY--DDDKFQQLFMCKFIDSSQSAF-SLADLERCY 403

Query: 307 NR----------EPCPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSK 350
           +           +P P   +P+ +G D +    D T VV+           I     W  
Sbjct: 404 SDLSLWADFDPDDPRPYGNSPVWIGYDPSRTRDDATCVVIAPPLENGGKFRILEKHSWRG 463

Query: 351 TDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCR 410
              +    ++  L E++    I ID    G    D +              RA  + +  
Sbjct: 464 QSFKYQAEQVKKLTERFNVQHIGIDTTGIGYGVFDLVRD---------FYPRATSIHYSL 514

Query: 411 NRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTD 467
             +  L +K  D ++ + +   +    + Q   ++K      +G++   + R       D
Sbjct: 515 ETKNLLVLKAQDTIQGSRIEWDAGWNDIAQAFLTIKR-GTTASGQVTYSASRTDATGHAD 573

Query: 468 YSDGLMYTFAENPPRSD 484
            +  +M+     P  +D
Sbjct: 574 VAWAVMHALQYEPLNTD 590


>gi|238762068|ref|ZP_04623041.1| terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
 gi|238699796|gb|EEP92540.1| terminase, ATPase subunit [Yersinia kristensenii ATCC 33638]
          Length = 595

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 59/473 (12%), Positives = 128/473 (27%), Gaps = 63/473 (13%)

Query: 39  GEKGTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLV 98
           G +   LE F+       E +     +   + ++    + K      R IG T   ++  
Sbjct: 138 GIQQEELELFAG------ETLFFYQQYLRANKHHAIRNILK-----SRQIGATWYFSFEA 186

Query: 99  LWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS----------- 147
           L          +   A S  Q       EV +   +   + +F +               
Sbjct: 187 LEDAIISGNPQIFLSA-SRAQA------EVFRSYIVNIAQQFFGVTLTGNPIRLSNGAEL 239

Query: 148 LHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI 207
              +   +     S  +    Y  +          + +  H+ +     +  ++ T    
Sbjct: 240 RFLSTNKNTAQSYSGHLYCDEYLWVPNFAKLNEAASAMATHDKWRTTYFSTPSAKTHQGY 299

Query: 208 NLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHE 267
                    + +  R  I          +                ++     G + +  E
Sbjct: 300 PFWTGDEWKQGDKQRSKITFPEFD--EYRDGGRLCPDGQWRYVITLEDAIDGGFNLANIE 357

Query: 268 GIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEA---LNREPCPDPYAPL------ 318
            +  +Y  D+    +     F       F   +++E+    +      D  AP       
Sbjct: 358 RLRNKYNRDT--FNMLYMCVFVDSGDSVF-KFHMLEKCGVDIEMWQDHDFSAPRPFGNRE 414

Query: 319 -IMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDA 371
              G D A  G  +T V++           +   F W   +     N+I  L ++Y    
Sbjct: 415 VWGGFDPARSGDTSTFVIIAPPQFEGERFRVLATFYWQGLNFNYQANQIKELFQRYNMTY 474

Query: 372 IIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFC-RNRRTELHVKMADWLEFASLI 430
           I +D    G    + ++             R           +  L +KM D +E   + 
Sbjct: 475 IGVDITGIGNGVFELVQ---------NFAMRQAVAIHYGLESKNRLVMKMVDVIESQRIE 525

Query: 431 NHSG---LIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
             +    +  +  +++       G +   + R K     D    + +     P
Sbjct: 526 WDAEAKEIPASFLAIRRTSTAKGGGMTFVADRTKETGHADVFFAIAHAIDNEP 578


>gi|323527775|ref|YP_004229928.1| bacteriophage terminase ATPase subunit [Burkholderia sp. CCGE1001]
 gi|323384777|gb|ADX56868.1| bacteriophage terminase, ATPase subunit [Burkholderia sp. CCGE1001]
          Length = 588

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 52/452 (11%), Positives = 112/452 (24%), Gaps = 40/452 (8%)

Query: 55  QLEFMEVVDAHCLNSVNNPNP--EVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVIC 112
           Q   +E       +               I   R IG T   A   L          +  
Sbjct: 135 QDRLLEAFRDSLFDYQKVWLRNGHQRTRNILKSRQIGATWYFAREALADAIESGRNQIFL 194

Query: 113 LANS-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKH 168
            A+  +  +      + ++    + L  +      +++                      
Sbjct: 195 SASKAQAHVFRQYITQFARQAADVELTGDPIVLPNEAILYFLGTNARTAQSYHGNFYFDE 254

Query: 169 YSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTS 228
           Y  + R     +  + +  H+ +     +  +S   +         +    A    +   
Sbjct: 255 YFWVPRFKELNKVASGMAMHSHWRKTYFSTPSSIGHEAYTFWSGEHINRGRAKADRVHFE 314

Query: 229 NPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQ 287
              +   +         +D +  QI T             +       SD      +  Q
Sbjct: 315 VTHKALARGRLC-----EDAQWRQIVTVEDAARAGCNLFNLDELRREYSDEEYANLLMCQ 369

Query: 288 FPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVVL- 336
           F       F   N+    ++       Y P          + +G D A  G     VV+ 
Sbjct: 370 FIDDTASIFTLANLQRCMVDSWELWADYKPLAARPFAWHPVWVGYDPALSGDSAGCVVVA 429

Query: 337 -----RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                     +     W   D       I  + E+Y    + ID    G      ++   
Sbjct: 430 PPMVEGGPFRVLEKHQWRGLDFEAQAQSIKEITERYNVAYMAIDTTGIGQGVYQLVKQFY 489

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVP 448
             V                  +  L +K    +  A L   +    +     ++K  +  
Sbjct: 490 PRVVAFNYSPE---------VKGRLVLKGLSVVGNARLQFDAGWTDMAAAFMAIKKTVTA 540

Query: 449 NTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
           +   +  E+ R +     D +  +++  +  P
Sbjct: 541 SGRHVTYEAGRSEETGHADLAWAVLHAISNEP 572


>gi|238027334|ref|YP_002911565.1| phage terminase ATPase subunit [Burkholderia glumae BGR1]
 gi|237876528|gb|ACR28861.1| Phage terminase ATPase subunit [Burkholderia glumae BGR1]
          Length = 605

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 56/458 (12%), Positives = 117/458 (25%), Gaps = 43/458 (9%)

Query: 55  QLEFMEV-VDAHC--LNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI 111
           Q + ++  +        +    N  + +  I   R IG T   A   L       G + I
Sbjct: 153 QEQRLKEAIREQLIGHQNTWFENRHLRRRNILKSRQIGATFYFAHEALVRAL-ETGTNQI 211

Query: 112 CLANSETQLKT-TLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSK--- 167
            L+ S  Q      + +   W +         M+  +     +       +   +     
Sbjct: 212 FLSASRAQAYVFRSYIQKFAWSAAQVELTGDPMRLSNGAELIFLGTSSRTAQSYNGDLYF 271

Query: 168 -HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIM 226
             Y  +    +  +    +  H+   M   +  ++ T +              A+   + 
Sbjct: 272 DEYFWVSNFATLNKVAMGMATHSHLRMTHFSTPSTTTHEAYPFWTGAHFNRDRADDERVE 331

Query: 227 TSNPRRLSGKFYEIFNKPLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                       +        W++    +     G      E + +              
Sbjct: 332 IDISHTSLAPGRQC---GDGQWRQIVTAEDAVASGFTKLDLEDLRSTNS--PADFENLYM 386

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPDPYAP----------LIMGCDIAEEGGDNTVVV 335
            QF       F    +    ++         P          + +G D A  G     VV
Sbjct: 387 CQFVDDTSSVFAFRLVQACMVDSWDVWTDVKPLLDRPFGWKQVWIGYDPALTGDSAGCVV 446

Query: 336 L------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           +           +     W   D  T   KI  L ++Y    I ID    G      +  
Sbjct: 447 IAPPEQPNGKFRVLERHRWKGIDFETQAEKIRELTQRYHVTYIAIDTTGIGHGVHQLVRQ 506

Query: 390 LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFI 446
               V  +               +  L +K    +    L   +    L Q+  S++  +
Sbjct: 507 FFPRVVPINYSPE---------VKNRLVLKGMSVIGKKRLEFDAGMTDLAQSFLSIRRAM 557

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSD 484
            P+  ++   + R +     D +   ++     P    
Sbjct: 558 TPSGTKMTYTAARNEEIGHADLAWACLHALDNEPLEGA 595


>gi|260599032|ref|YP_003211603.1| Terminase, ATPase subunit [Cronobacter turicensis z3032]
 gi|260218209|emb|CBA33092.1| Terminase, ATPase subunit [Cronobacter turicensis z3032]
          Length = 590

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 55/472 (11%), Positives = 113/472 (23%), Gaps = 49/472 (10%)

Query: 48  FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG 107
           F     +QL +      H +              I   R IG T   +   L        
Sbjct: 142 FEESFDYQLRWHRAGLEHRIRD------------ILKSRQIGATFYFSREALLRALETGH 189

Query: 108 ISVICLANSETQL-----KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSL 162
             +   A S+TQ          +A                  +  +      +     + 
Sbjct: 190 NQIFLSA-SKTQAYVFREYIIQFARRVDVELSGDPIVIGNNGAKLIFLGTNSNTAQSHNG 248

Query: 163 GIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANR 222
            +       +       +  + +           +  ++           G L  +    
Sbjct: 249 DLYVDEIFWIPNFQRLRKVASGMASQKHLRSTYFSTPSTLGHGAFPFW-SGELFNKGRTS 307

Query: 223 FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRV 282
                      +     +        +   I+     G D    + +      +    R 
Sbjct: 308 AAERVDIDISHAALAGGMLCGDGQWRQIVTIEDALAGGCDLFDLDALKRENSAED--FRN 365

Query: 283 EVCGQFPQQDIDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAEEGGDNT 332
               +F       F    +    ++     +             P+ +G D +  G    
Sbjct: 366 LFMCEFVDDKASVFPFEELQRCMVDSLEEWEDFSPFAARPFGSRPVWIGYDPSHTGDSAG 425

Query: 333 VVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDY 386
            VVL           I     W   D  T    I  L EKY+ + I IDA   G      
Sbjct: 426 CVVLAPPVVSGGKFRILERHQWKGMDFATQAQAIRELTEKYQVEYIGIDATGIGQGVFQL 485

Query: 387 LEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLK 443
           +         +               +T + +K  D +    L   +    + Q+  +++
Sbjct: 486 VRAFWPAAREIRYSPE---------VKTAMVLKAKDTISRGCLEYDAGATDITQSFMAIR 536

Query: 444 SFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
             +  +      E+ R + A   D +   M+     P  +          ++
Sbjct: 537 KTMTSSGRSATYEASRSEEASHADVAWATMHALLNEPLTAGSGQASSSILEF 588


>gi|167619947|ref|ZP_02388578.1| phage terminase, ATPase subunit [Burkholderia thailandensis Bt4]
          Length = 589

 Score =  107 bits (266), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/464 (9%), Positives = 109/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +       +A  +  + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFARGAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 316

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 317 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +             + +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSP---------DVKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|53722089|ref|YP_111074.1| bacteriophage terminase, ATPase subunit [Burkholderia pseudomallei
           K96243]
 gi|52212503|emb|CAH38529.1| putative bacteriophage terminase, ATPase subunit [Burkholderia
           pseudomallei K96243]
          Length = 601

 Score =  107 bits (266), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/464 (9%), Positives = 107/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 155 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 209

Query: 116 S-ETQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +       +A  +  + L  +       +                       Y  
Sbjct: 210 KAQAHVFKQYITQFARGAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 269

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +              A    I      
Sbjct: 270 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFWSGAHANRGRAAADRIQI--DT 327

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                   +  +     +   +      G D    + +   Y  +       +  QF   
Sbjct: 328 SHEALVRGMLCEDAQWRQIVTVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 385

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 386 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 445

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 446 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 505

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 506 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 556

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 557 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 600


>gi|167916806|ref|ZP_02503897.1| bacteriophage terminase, ATPase subunit [Burkholderia pseudomallei
           112]
          Length = 589

 Score =  107 bits (266), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/464 (9%), Positives = 107/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +       +A  +  + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFARGAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +              A    I      
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFWSGAHANRGRAAADRIQI--DT 315

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                   +  +     +   +      G D    + +   Y  +       +  QF   
Sbjct: 316 SHEALVRGMLCEDAQWRQIVTVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|238025823|ref|YP_002910054.1| phage terminase, ATPase subunit [Burkholderia glumae BGR1]
 gi|237875017|gb|ACR27350.1| Phage terminase, ATPase subunit [Burkholderia glumae BGR1]
          Length = 589

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/464 (10%), Positives = 105/464 (22%), Gaps = 43/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            E +         + +     + K      R IG T   A              +   A+
Sbjct: 143 RESLFDYQKVWYRNGDQQTRNILK-----SRQIGATWYFAREAFVDALDTGRNQIFLSAS 197

Query: 116 SET----QLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
                  +     +A     + L  +       +                  +    Y  
Sbjct: 198 KAQAHVFKQYIVQFARDVADVELTGDPIILPNGATLYFLGTNSRTAQSYHGNLYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +        + +  H  + +   +  +S T +              A    I      
Sbjct: 258 VPKFRELNTVASGMAMHKRWRLTYFSTPSSTTHEAYAFWSGADANRGRAPGDRIQI--DT 315

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                   +  +     +   +      G D    E +  RY  D       +  QF   
Sbjct: 316 SHEALVRGMLGEDEQWRQVVTVLDAIEGGCDLFDLERLRRRYSAD--AFANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F    +    ++                     + +G D A  G    +VV+    
Sbjct: 374 SVSVFKLAELQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 --RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
                  +     +   D       I  +  +Y    I ID    G      +       
Sbjct: 434 VEGGTFRVLERHQFRGNDFEEQAAAIEQITRRYNVGYIAIDTTGMGQGVYQLVRKFYPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L      +K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVIRNGRLQFDAGWTDLAAAFMGIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
                + R +     D +   ++   +  P +  D       ++
Sbjct: 545 HATYTADRNEETGHADLAWACLHA-IDREPLAGGDINSSSFTEF 587


>gi|17981830|ref|NP_536821.1| terminase [Haemophilus phage HP2]
 gi|13752203|gb|AAK37798.1| orf16 [Haemophilus phage HP2]
 gi|309750513|gb|ADO80497.1| probable terminase, ATPase subunit [Haemophilus influenzae R2866]
          Length = 607

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 50/442 (11%), Positives = 114/442 (25%), Gaps = 44/442 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +     H   + ++    + K      R IG T   ++  L          +   A S+ 
Sbjct: 163 LFDYQKHIRANKHHDVRNILK-----SRQIGATYYFSFEALEDAIFSGDNQIFLSA-SKR 216

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQ------SLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           Q        + K                    +     +   +     S  +    Y+ +
Sbjct: 217 QA-EIFKNYIVKMAREYFGVELTGNPIILSNGAELHFLSTNKNTSQGNSGHVYGDEYAWI 275

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
                     + +  H  +     +  +S   +  +        + +  R  +       
Sbjct: 276 RDFQRFNDVASAMATHAKWRETYFSTPSSKFHESYSFWSGDNWRDGDPKRKNVPFPTFAE 335

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
           L      +       +     D            E +  RY              +    
Sbjct: 336 LRDG-GRLCPDGQWRYVVTIEDALKGGAGTLFNIEKLKQRYSKY--AFNQLYMCVWIDDA 392

Query: 293 IDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVLR------ 337
              F    +    ++ +  ++  P    P     +  G D A  G   + V++       
Sbjct: 393 DSIFTVHQLLKCGVDISKWKDFNPKADRPFGDREVWGGFDPAHSGDGASFVIIAPPALPS 452

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               +   + W+        N+I  L EKY    I IDA   G    + ++         
Sbjct: 453 EKYRVLARYQWNGLSYVYQANQIRALYEKYNMTYIGIDATGVGYGVYELVKE-------- 504

Query: 398 LGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
              +RA          +T + +K+ D +E   +        ++ +   +K     +   +
Sbjct: 505 -FARRAATAIIYNPESKTGMVLKVHDLVEHGQIEWSESELDIVPSFLMIKHQSTKSGNTM 563

Query: 454 AIESKRVKGAKSTDYSDGLMYT 475
              ++R    +  D    +   
Sbjct: 564 TFTAERTVKTQHADVFFAICNA 585


>gi|72537721|ref|YP_293751.1| phage terminase ATPase subunit [Burkholderia phage phi52237]
 gi|72398411|gb|AAZ72646.1| phage terminase ATPase subunit [Burkholderia phage phi52237]
          Length = 601

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 155 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 209

Query: 116 S-ETQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +       +A  +  + L  +       +                       Y  
Sbjct: 210 KAQAHVFKQYITQFARGAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 269

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 270 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 328

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 329 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 385

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 386 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 445

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 446 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 505

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 506 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 556

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 557 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 600


>gi|167821684|ref|ZP_02453364.1| phage terminase, ATPase subunit [Burkholderia pseudomallei 91]
 gi|254188172|ref|ZP_04894684.1| Putative ATPase subunit of terminase (gpP-like) [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157935852|gb|EDO91522.1| Putative ATPase subunit of terminase (gpP-like) [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 589

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/464 (9%), Positives = 108/464 (23%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTL---WAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +       +A  +  + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFARGAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +       G    R       +  +  
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFW-SGAHANRGRAAGERIQIDTS 316

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
             +     +            +      G D    + +   Y  +       +  QF   
Sbjct: 317 HEALVRGMLCEDAQWRQIV-TVLDAMAGGCDLFDIDELRREYSAEE--FANLLMCQFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|152994622|ref|YP_001339457.1| hypothetical protein Mmwyl1_0587 [Marinomonas sp. MWYL1]
 gi|150835546|gb|ABR69522.1| protein of unknown function DUF264 [Marinomonas sp. MWYL1]
          Length = 601

 Score =  106 bits (265), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 50/456 (10%), Positives = 122/456 (26%), Gaps = 41/456 (8%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMS-TRPGISVICLAN 115
           +       +      +P     +  + + R IG T   A+  L     T      +  + 
Sbjct: 157 KLFFPYQEYWYQRKLDPLTRRTRMILKS-RQIGATWYFAFEALDDAIRTGDNQLFLSSSR 215

Query: 116 SETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDS----KHYST 171
            + ++        +     +  K    +   +     + S     +              
Sbjct: 216 DQAEVFKAYIIAFAMQHFDVELKGQGVITLSNGAELRFLSTNSRTANSYHGHLYCDEVFW 275

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           M          + +  H  +   + +  ++ +     +       ++ A    +      
Sbjct: 276 MPDFVKLWDMASGMSSHKKWRRTLFSVPSATSHPAYEMWNGNNYNKKLAESKRVTFDISH 335

Query: 232 RLSGKFYEIFNKPLDDWKRF-QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQ 290
           +        +  P   W++   I+     G D    E +      D      +   ++  
Sbjct: 336 KN---LKGGWIGPDKMWRQIVTIEDAEEGGCDLFDIEQLRDENSTD--AFNNKYLCKWID 390

Query: 291 QDIDSFIPLNIIEEALNREP---------CPDPYAPLIMGCDIAEEGGDNT------VVV 335
                F    ++   ++ E           P    P+ +G D +    + +       + 
Sbjct: 391 DANSVFTLAKLLSCMVDTETWTDYHKDAGQPFGNRPVAIGYDPSRTTDNASLALLSIPLG 450

Query: 336 LRRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVY 395
                 +     W   + +    +I    EK+    I ID +  G    + +E     V 
Sbjct: 451 ASDPWRLLKKDSWRGVNFQWQAARIKEEKEKHNVKHIGIDVSGIGRGVFELVEQFYRRVT 510

Query: 396 RVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLIN---HSGLIQNLKSLKSFIVPNTGE 452
            +    +          +TEL +K  D +E            + Q    + +  V + G+
Sbjct: 511 PITYSVQT---------KTELVLKALDLIENGLFKFSAGDKEVAQAFMMI-TKKVTDNGQ 560

Query: 453 LAIESKRVKGAKSTDYSDGLMYTF-AENPPRSDMDF 487
           +   + R       D +  +M+ F  E         
Sbjct: 561 ITYVANRSNATGHADVAWAIMHAFNYEPIAPKRKTT 596


>gi|257142677|ref|ZP_05590939.1| putative ATPase subunit of terminase (gpP-like) protein
           [Burkholderia thailandensis E264]
          Length = 589

 Score =  106 bits (264), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/464 (9%), Positives = 106/464 (22%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 198 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 257

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +              A    I      
Sbjct: 258 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFWSGAHANRGRAAADRIQI--DT 315

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                   +  +     +   +      G +    + +   Y  +       +   F   
Sbjct: 316 SHEALVRGMLCEDAQWRQIVTVLDAMAGGCNLFDIDELRREYSAEE--FANLLMCHFIDD 373

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 374 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 433

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 434 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 493

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 494 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 544

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 545 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|83717940|ref|YP_439548.1| putative ATPase subunit of terminase (gpP-like) [Burkholderia
           thailandensis E264]
 gi|83651765|gb|ABC35829.1| Putative ATPase subunit of terminase (gpP-like) [Burkholderia
           thailandensis E264]
          Length = 601

 Score =  106 bits (264), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/464 (9%), Positives = 106/464 (22%), Gaps = 42/464 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 155 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 209

Query: 116 S-ETQLKTTLWAEVSKW---LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYST 171
             +  +      + ++    + L  +       +                       Y  
Sbjct: 210 KAQAHVFKQYITQFARAAADIELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEYFW 269

Query: 172 MCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR 231
           + +     +  + +  H  +     +  +S T +              A    I      
Sbjct: 270 VPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAYAFWSGAHANRGRAAADRIQI--DT 327

Query: 232 RLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQ 291
                   +  +     +   +      G +    + +   Y  +       +   F   
Sbjct: 328 SHEALVRGMLCEDAQWRQIVTVLDAMAGGCNLFDIDELRREYSAEE--FANLLMCHFIDD 385

Query: 292 DIDSFIPLNIIEEALNREPCPDPY-----------APLIMGCDIAEEGGDNTVVVL---- 336
            +  F   ++    ++                     + +G D A  G    +VV+    
Sbjct: 386 SLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPR 445

Query: 337 -RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHV 394
              G   +     +   D       I  + ++Y    I ID    G      +       
Sbjct: 446 VDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFPAA 505

Query: 395 YRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTG 451
             +               +T L +K    +    L   +    L     ++K  +  +  
Sbjct: 506 VALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTASGR 556

Query: 452 ELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +    + R       D +   ++     P           +  Y
Sbjct: 557 QATYTAGRTDETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 600


>gi|9628620|ref|NP_043485.1| hypothetical protein HP1p21 [Haemophilus phage HP1]
 gi|1722793|sp|P51718|VPP_BPHP1 RecName: Full=Probable terminase, ATPase subunit; AltName:
           Full=ORF16
 gi|1046243|gb|AAB09201.1| orf16 [Haemophilus phage HP1]
          Length = 607

 Score =  106 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/442 (11%), Positives = 115/442 (26%), Gaps = 44/442 (9%)

Query: 59  MEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET 118
           +     H  ++ ++    + K      R IG T   ++  L          +   A S+ 
Sbjct: 163 LFDYQKHIRSNKHHDVRNILK-----SRQIGATYYFSFEALEDAIFSGDNQIFLSA-SKR 216

Query: 119 QLKTTLWAEVSKWLSLLPNKHWFEMQ------SLSLHPAPWYSDVLHCSLGIDSKHYSTM 172
           Q        + K                    +     +   +     S  +    Y+ +
Sbjct: 217 QA-EIFKNYIVKMAREYFGVELTGNPIILSNGAELHFLSTNKNTSQGNSGHVYGDEYAWI 275

Query: 173 CRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRR 232
                 +   + +  H  +     +  +S   +  +        + +  R  +       
Sbjct: 276 RDFQRFDDVASAMATHEKWRETYFSTPSSKFHESYSFWSGDNWRDGDPKRKNVPFPTFAE 335

Query: 233 LSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQD 292
           L      +       +     D            E +  RY              +    
Sbjct: 336 LRDG-GRLCPDGQWRYVVTIEDALKGGADKLFNIEKLKQRYSKY--AFNQLYMCIWIDDA 392

Query: 293 IDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL------R 337
              F    +    ++ A  ++  P    P     +  G D A  G   + V++       
Sbjct: 393 DSIFNVKQLLKCGVDIAKWKDFNPKADRPFGDREVWGGFDPAHSGDGASFVIIAPPALPG 452

Query: 338 RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRV 397
               +   + W         N+I  L EKY    I IDA   G    + ++         
Sbjct: 453 EKYRMLARYQWHGLSYVYQANQIRALYEKYNMTYIGIDATGVGYGVYELVKE-------- 504

Query: 398 LGQKRAVDLEFC-RNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGEL 453
              +RA          +T + +K+ D +E   +        ++ +   +K     +   +
Sbjct: 505 -FARRAATAIIYNPESKTGMVLKVHDLVEHGQIEWSESELDIVPSFLMIKHQSTKSGNTM 563

Query: 454 AIESKRVKGAKSTDYSDGLMYT 475
              ++R    +  D    +   
Sbjct: 564 TFTAERTVKTQHADVFFAICNA 585


>gi|326782381|ref|YP_004322781.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
 gi|310003329|gb|ADO97726.1| terminase DNA packaging enzyme large subunit [Synechococcus phage
           S-ShM2]
          Length = 362

 Score =  106 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/371 (14%), Positives = 102/371 (27%), Gaps = 53/371 (14%)

Query: 2   SRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFMEV 61
                 N   E     +    +       F+ ++         L  F     +Q E ++ 
Sbjct: 11  PNLKKANTSIEFTNDQISEFAKCYNDPVYFIKNYVKIVSLDAGLIPFDM-YHFQEEMVQK 69

Query: 62  VDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLK 121
              +  N    P            R  GK+T+    +LW +     ++V  LAN     +
Sbjct: 70  FHDNRFNIAKLP------------RQSGKSTIVTSYLLWYVIFNDNVNVAILANKAATSR 117

Query: 122 TTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERP 181
             L   + +    LP                        SL +++        T S    
Sbjct: 118 EML-QRLQRSYENLP-----------KWLQQGIVQWNRGSLELENGSKIMAASTSS---- 161

Query: 182 DTFVGHHNTYGMAIINDEASGTP----DVINLGILGFLTER-NANRFWIMTSNPRRLSGK 236
                        I  DE +  P    D     +   ++   +     I T +   +  K
Sbjct: 162 ---SAVRGMSFNVIFLDEFAFVPNHIADEFFSSVYPTISSGKSTKVIIISTPHGMNMFYK 218

Query: 237 FYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSF 296
            +    +  +++   ++    V G D  +    IA         +VE   +F     D+ 
Sbjct: 219 LWHDSERKKNEYISTEVHWSEVPGRDAKWKAQTIANTSE--QQFKVEFECEFLGSV-DTL 275

Query: 297 IPLNIIEEALNREP-----------CPDPYAPLIMGCDIAE--EGGDNTVVVLRRGPVIE 343
           I  + +   +  +P                   ++  D+A    G  +  VV+    +  
Sbjct: 276 ISPSKLRTMVYNDPLVQNKGLSIYEHVQKDHNYVITVDVARGVSGDFSAFVVIDTTTIPY 335

Query: 344 HLFDWSKTDLR 354
            L    K +  
Sbjct: 336 KLVAKYKNNTI 346


>gi|167567112|ref|ZP_02360028.1| phage terminase, ATPase subunit [Burkholderia oklahomensis EO147]
          Length = 589

 Score =  106 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/467 (10%), Positives = 114/467 (24%), Gaps = 52/467 (11%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 SETQLKTTLWAEVSKWLSLLPNKHW------FEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
                       ++++     +             +                       Y
Sbjct: 198 KAQA--HVFKQYITQFARDAADVELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEY 255

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + +     +  + +  H  +     +  +S T +        F +  +ANR       
Sbjct: 256 FWVPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHE-----AYAFWSGAHANRGRAAGDR 310

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQF 288
            +  +     +     +D +  QI T             I       S       +  QF
Sbjct: 311 IQIDTSHEALVRGMLGEDAQWRQIVTVLDAMAGGCNLFDIDELRREYSAEEFANLLMCQF 370

Query: 289 PQQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDIAEEGGDNTVVVL- 336
               +  F   ++    ++                  +  + +G D A  G    +VV+ 
Sbjct: 371 IDDSLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGHREVWVGYDPALTGDSAGLVVVA 430

Query: 337 ---RRG--PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLG 391
                G    +     +   D       I  + ++Y    I ID    G      +    
Sbjct: 431 PPRVDGGAFRVLERHQFRGNDFEEQAAAIEAITQRYHVGYIAIDTTGMGQGVYQLVRKFF 490

Query: 392 YHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVP 448
                +               +T L +K    +    L   +    L  +  ++K  +  
Sbjct: 491 PAAVALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAASFMAIKQTMTA 541

Query: 449 NTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
           +  +    + R +     D +   ++       R  +  G   S  +
Sbjct: 542 SGRQATYTAGRSEETGHADLAWACLHA----IDREPLAGGGVNSSSF 584


>gi|68250195|ref|YP_249307.1| terminase, ATPase subunit [Haemophilus influenzae 86-028NP]
 gi|68058394|gb|AAX88647.1| terminase, ATPase subunit [Haemophilus influenzae 86-028NP]
          Length = 593

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 56/434 (12%), Positives = 119/434 (27%), Gaps = 37/434 (8%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET--QLKTTLWAEVSKW--LSLLPN 137
           I   R IG T   A        T     +   A+ +   Q ++ +     +   + L   
Sbjct: 168 ILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSYIVNYAKQTADVDLKGE 227

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +  +      +        +       + +     +  + +     Y     +
Sbjct: 228 TIKLPNGAELIFLGTNSATAQSYHGNLYFDEVFWVPKFDVMRKVASGMAAQKMYRQTYFS 287

Query: 198 DEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRT 257
              +                  A    I        + K  ++             D   
Sbjct: 288 TPTTIAHPAYAFFSGKAFNRNRAKSEKIEIDISH-ENLKSGKLCADRQWKQIVSIYDAME 346

Query: 258 VEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDPYAP 317
             G +    + +IA    +          QF   +  +F   ++    ++       Y P
Sbjct: 347 S-GCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEWHDYKP 403

Query: 318 ----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKIS 361
                     + +G D A  G    +V++           + H   +   D  T  ++I 
Sbjct: 404 FYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQASRIK 463

Query: 362 GLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMA 421
              + Y    I+ID    G+     +               A  LE+  + + E+ +K  
Sbjct: 464 QFCDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMAQGLEYNADLKNEMVLKTQ 514

Query: 422 DWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE 478
           + ++   L   S    ++ +  ++K   +  TG++   S R + A   D S  +M     
Sbjct: 515 NLIQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDRSEDASHGDLSWAIMNCILN 573

Query: 479 NPPRSDMDFGRCPS 492
            P     D     S
Sbjct: 574 VPYGLGGDVSSNKS 587


>gi|254449246|ref|ZP_05062694.1| fels-2 prophage protein [gamma proteobacterium HTCC5015]
 gi|198261159|gb|EDY85456.1| fels-2 prophage protein [gamma proteobacterium HTCC5015]
          Length = 593

 Score =  105 bits (262), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/469 (11%), Positives = 119/469 (25%), Gaps = 49/469 (10%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            E +         +  N         I   R IG T   A   +          +   A+
Sbjct: 143 EEELFDYQRVWYQAGKNHRNRN----ILKSRQIGATWFFAREAICDALETGKNKIFLSAS 198

Query: 116 SETQ------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
                     +   + AE    L   P +      +                  +    Y
Sbjct: 199 KAQAHIFRSYIVKFVLAETGIELKGDPIR--LPNGAELYFLGTNAQTAQGYHGDVYMDEY 256

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + R    ++  + +  H  +     +  ++ T +           +R      +    
Sbjct: 257 FWIGRFKEFKKVTSGMAMHKQWKRTYFSTPSALTHEAYPFWSGEDWKKRRPKDQRVDF-- 314

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV-TRVEVCGQF 288
                            D +  QI T             +       S    +  +  +F
Sbjct: 315 ---DVSHEALAKGALCPDKQWRQIVTVEDAIRGGCDLFDLDDLRQEYSHEEWQNLLMCEF 371

Query: 289 PQQDIDSFIPLNIIEEALNREP----------CPDPYAPLIMGCDIA---EEGGDNTVVV 335
               +  F    +    ++              P   +P+ +G D +   E+G    ++V
Sbjct: 372 MDDTLSVFPLPKLQACMIDSWIQWRDLKPFAAKPLGDSPVWVGYDPSSDSEQGDGAGLIV 431

Query: 336 LR------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM 389
           L       +   I         D     N I  L  +Y+ +   ID    GA   + +E 
Sbjct: 432 LSPSKSKSQKHRIIEKHRLRGMDYEAQANFILALRSRYQIEYCGIDTTGAGAAVAELVEK 491

Query: 390 LGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFI 446
               V R+               + ++ +K  + ++   L   +    L Q+  +++  +
Sbjct: 492 KLPCVRRLNYSPE---------LKAQMVMKTLNVIDHQRLEFDAGWSDLAQSFMAIRRAM 542

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
                 +   + R K     + +   M+     P     +       + 
Sbjct: 543 TDTGRRVTYIAGRRKDTGHAELAWATMHAIFNEPLEGPSEGASGSIIEI 591


>gi|300714692|ref|YP_003739495.1| terminase, ATPase [Erwinia billingiae Eb661]
 gi|299060528|emb|CAX57635.1| Probable terminase, ATPase subunit [Erwinia billingiae Eb661]
          Length = 512

 Score =  105 bits (262), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 56/467 (11%), Positives = 123/467 (26%), Gaps = 55/467 (11%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
            +E +  H             +  + + R IG +   A   L       G + I L+ S 
Sbjct: 63  VLESLFEH-QKRWYKQRERRNRFILKS-RQIGASWYFAREALLRAL-ETGTNQIFLSASR 119

Query: 118 TQLKTTLWAEVSKWLSLLP-------NKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYS 170
            Q     + +   +L+          ++      +         +     +  +      
Sbjct: 120 AQAFQ--FKKFIIFLARSIGVELKGGDEIILSNGATLYFLGTSAATAQSYTGDLYFDEAF 177

Query: 171 TMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNP 230
            +    +  +    +  H        +  +S   +                         
Sbjct: 178 WVANFLNLRKVAAGMATHVGLRRTYFSTPSSEEHEAFEFWSGKLFNNGRDK-------KE 230

Query: 231 RRLSGKFYEIFNKPL---DDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQ 287
           R      ++         D+  R  +  + V      F +    +     D         
Sbjct: 231 RADLDLSHKALKDGQLCADNIWRQIVTVQDVIDQGFPFIDLEEIQSENSPDEFDNLYRCI 290

Query: 288 FPQQDIDSFIPLNIIEEALNR----EPCPDPYAPL-------IMGCDIAEEGG--DNTVV 334
           F +Q   +F    +I   ++      P  +PYAP         +G D        D+  +
Sbjct: 291 FVKQGERAFNYNALINCGVDGYSGIWPDWNPYAPRPLGNRKVWIGYDPNGNSDKGDSAGL 350

Query: 335 VL-------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYL 387
           V+            +         +       I  L++ Y    I ID    GA     +
Sbjct: 351 VVLAPPLVPGGKFRVVERHQLRGMEFEEQAEFIKRLIKIYDVQHIDIDGTGIGAAVHQLV 410

Query: 388 EMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKS 444
                    V     A    +  + + +L +K    +        +    ++ +  +++ 
Sbjct: 411 ---------VKFFPAAQMHVYTPSVKRQLVLKAQMVIRAGRFEYDAGMMDIVSSFMTVRK 461

Query: 445 FIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
           F +   G  +  S R +G+   D +   M+     P  +D   G   
Sbjct: 462 F-ITQGGHTSYASDRKRGSSHGDLAWATMHALQNEPLGNDAGSGSDS 507


>gi|145636853|ref|ZP_01792518.1| terminase, ATPase subunit [Haemophilus influenzae PittHH]
 gi|145269934|gb|EDK09872.1| terminase, ATPase subunit [Haemophilus influenzae PittHH]
          Length = 593

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 64/438 (14%), Positives = 128/438 (29%), Gaps = 45/438 (10%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET--QLKTTLWAEVSKW--LSLLPN 137
           I   R IG T   A        T     +   A+ +   Q ++ +     +   + L   
Sbjct: 168 ILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSYIVNYAKQTADVDLKGE 227

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +  +      +        +       + +     +  + +     Y     +
Sbjct: 228 TIKLPNGAELIFLGTNSATAQSYHGNLYFDEVFWVPKFDVMRKVASGMAAQKMYRQTYFS 287

Query: 198 DEASGTPDVINLGILGFLTERN---ANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQID 254
              +           G    RN   + +  I  S+    SGK           WK+    
Sbjct: 288 TP-TTIAHPAYAFFSGKAFNRNRTKSEKIEIDISHENLKSGKLCADR-----QWKQIVSI 341

Query: 255 TRTVEGIDPSF-HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPD 313
              +EG    F  + +IA    +          QF   +  +F   ++    ++      
Sbjct: 342 YDAMEGGCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEWH 399

Query: 314 PYAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTN 357
            Y P          + +G D A  G    +V++           + H   +   D  T  
Sbjct: 400 DYKPFYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQA 459

Query: 358 NKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELH 417
           ++I    + Y    I+ID    G+     +               A  LE+  + + E+ 
Sbjct: 460 SRIKQFCDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMAQGLEYNADLKNEMV 510

Query: 418 VKMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMY 474
           +K  + ++   L   S    ++ +  ++K   +  TG++   S R + A   D S  +M 
Sbjct: 511 LKTQNLIQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDRSEDASHGDLSWAIMN 569

Query: 475 TFAENPPRSDMDFGRCPS 492
                P     D     S
Sbjct: 570 CILNVPYGLGGDVSSNKS 587


>gi|319775358|ref|YP_004137846.1| Terminase, ATPase subunit [Haemophilus influenzae F3047]
 gi|317449949|emb|CBY86161.1| Terminase, ATPase subunit [Haemophilus influenzae F3047]
          Length = 603

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 59/439 (13%), Positives = 122/439 (27%), Gaps = 47/439 (10%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I   R IG T   A        T     +   A+ +  L+   +  +  +     +    
Sbjct: 178 ILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSY--IVNYAKQTADVDLK 235

Query: 142 EMQSLSL------HPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
                              +        +       + +     +  + +     Y    
Sbjct: 236 GETIKLPNGAELTFLGTNSATAQSYHGNLYFDEVFWVPKFDVMRKVASGMAAQKMYRQTY 295

Query: 196 INDEASGTPDVINLGILGFLTE--RNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQI 253
            +   +                    + +  I  S+    SGK           WK+   
Sbjct: 296 FSTPTTIAHPAYAFFSGKAFNRNRAKSEKIEIDISHENLKSGKLCADR-----QWKQIVS 350

Query: 254 DTRTVEGIDPSF-HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCP 312
               +EG    F  + +IA    +          QF   +  +F   ++    ++     
Sbjct: 351 IYDAMEGGCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEW 408

Query: 313 DPYAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTT 356
             Y P          + +G D A  G    +V++      R    + H   +   D  T 
Sbjct: 409 HDYKPFYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVERGDYRVLHKQTFHGMDYETQ 468

Query: 357 NNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTEL 416
            ++I    + Y    I+ID    G+     +                  LE+  + + E+
Sbjct: 469 ASRIKQFCDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMVQGLEYNADLKNEM 519

Query: 417 HVKMADWLEFASL---INHSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLM 473
            +K  + ++   L      + ++ +  ++K   +  TG++   S R + A   D S  +M
Sbjct: 520 VLKTQNLIQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDRSEDASHGDLSWAIM 578

Query: 474 YTFAENPPRSDMDFGRCPS 492
                 P     D     S
Sbjct: 579 NCILNVPYGLGGDVSSNKS 597


>gi|238920988|ref|YP_002934503.1| hypothetical protein NT01EI_3118 [Edwardsiella ictaluri 93-146]
 gi|238870557|gb|ACR70268.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 595

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 60/475 (12%), Positives = 115/475 (24%), Gaps = 61/475 (12%)

Query: 55  QLEFMEVV--------DAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRP 106
           Q E ++ V          H   +            I+  R IG T   A           
Sbjct: 137 QAEKLKQVFLEGLYPHQKHWYRAGLEHRIRD----INKSRQIGATMFFAQEGFVDAVETG 192

Query: 107 GISVICLANSETQ----------LKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSD 156
              +   A+               +     E+   +  LP+                   
Sbjct: 193 RNQIFLSASKAQAHQFRQYIIDFARDAADVELKGEVIHLPHNDG-----RMYFLGTNART 247

Query: 157 VLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLT 216
                  +    Y  + R     R    +     +     +  +S   +           
Sbjct: 248 AQTYHGNLYLDEYFWIYRFLELRRNAAGMASQKRWRQTYFSTPSSINHEAYKFWAGLLFN 307

Query: 217 ERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLD 276
              A    I      R +     +            I+    +G D    + +   Y  +
Sbjct: 308 RGRAKSEHIRLDLSHR-ALAAGRLCEDGQWRQIV-TIEDAIRQGYDLFDIDQLRLEYSPE 365

Query: 277 SDVTRVEVCGQFPQQDIDSFIPLNIIEEAL-NREPCPDPYAP----------LIMGCDIA 325
                     QF       F PL++++  + +     D Y P          + +G D A
Sbjct: 366 E--FANLFMCQFIDDTESVF-PLSLLQGCMVDSWAVWDDYKPFALRPLGERSVWVGYDPA 422

Query: 326 EEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNT 379
             G     VV+           +     W   D       I  +  +Y    I ID    
Sbjct: 423 LTGDSAGCVVVAPPVVEGGKFRVIEKHQWHGMDFAAQAENIRKITGRYNVTYIGIDVTGI 482

Query: 380 GARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLI 436
           G      ++     V                  +  L +K  D +    L   +    L 
Sbjct: 483 GHGVHQLVKQFFPAVQAFSYSPE---------VKQRLVLKTLDVVRKHRLEFDAGWTDLA 533

Query: 437 QNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP 491
           Q+  +++  + P+  ++  ++ R +     D +   M+     P  S        
Sbjct: 534 QSFMAIRKTLTPSGRQVTFQASRSEEVSHADLAWACMHAIINEPLESSGGANSWR 588


>gi|55163155|emb|CAH61098.1| large terminase subunit [Yersinia enterocolitica subsp. palearctica
           Y11]
          Length = 202

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 63/202 (31%), Gaps = 20/202 (9%)

Query: 300 NIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDL 353
              + A   E  P  Y P+ MG D +  G     VV+           I     W   D 
Sbjct: 7   EWEDFAPFAE-QPFNYHPVWMGYDPSHTGDSAGCVVMAPPWVPGGKFRILERHQWKGMDF 65

Query: 354 RTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRR 413
                 I  L EKY  + I IDA   G      +               A ++ +    +
Sbjct: 66  ADQAESIKKLTEKYNVEYIGIDATGIGQGVYQLVR---------NFFPAAREIRYSAEVK 116

Query: 414 TELHVKMADWLEFASLINH---SGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSD 470
           T + +K  D +    L      + +  +  +++  +  +      E+ R +     D + 
Sbjct: 117 TNMVLKAKDLITTGRLEYDISYTDITLSFMAIRKTMTASGRSATYEASRSEEVSHADLAW 176

Query: 471 GLMYTFAENPPRSDMDFGRCPS 492
             M+     P  +  +    PS
Sbjct: 177 AAMHAMINEP-LTAGNGNVTPS 197


>gi|145630909|ref|ZP_01786686.1| terminase, ATPase subunit [Haemophilus influenzae R3021]
 gi|144983569|gb|EDJ91037.1| terminase, ATPase subunit [Haemophilus influenzae R3021]
          Length = 593

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 61/437 (13%), Positives = 125/437 (28%), Gaps = 43/437 (9%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSET--QLKTTLWAEVSKW--LSLLPN 137
           I   R IG T   A        T     +   A+ +   Q ++ +     +   + L   
Sbjct: 168 ILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSYIVNYAKQTADVDLKGE 227

Query: 138 KHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
                  +  +      +        +       + +     +  + +     Y     +
Sbjct: 228 TIKLPNGAELIFLGTNSATAQSYHGNLYFDEVFWVPKFDVMRKVASGMAAQKMYRQTYFS 287

Query: 198 DEASGTPDVINLGILGFLTE--RNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDT 255
              +                    + +  I  S+    SGK           WK+     
Sbjct: 288 TPTTIAHPAYAFFSGKAFNRNRAKSEKIEIDISHENLKSGKLCADR-----QWKQIVSIY 342

Query: 256 RTVEGIDPSF-HEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP 314
             +EG    F  + +IA    +          QF   +  +F   ++    ++       
Sbjct: 343 DAMEGGCNLFNIDDLIAENSKEE--FEQLFLCQFADDNSSAFKFSDLQLCQVDSLEEWHD 400

Query: 315 YAP----------LIMGCDIAEEGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNN 358
           Y P          + +G D A  G    +V++           + H   +   D  T  +
Sbjct: 401 YKPFYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVEGGDYRVLHKQTFHGMDYETQAS 460

Query: 359 KISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHV 418
           +I    + Y    I+ID    G+     +               A  LE+  + + E+ +
Sbjct: 461 RIKQFCDDYNVTRIVIDKTGMGSGVYQEVR---------KFYPMAQGLEYNADLKNEMVL 511

Query: 419 KMADWLEFASLINHS---GLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYT 475
           K  + ++   L   S    ++ +  ++K   +  TG++   S R + A   D S  +M  
Sbjct: 512 KTQNLIQKRRLKFDSGDNDIVSSFMTVKK-RITGTGKITYVSDRSEDASHGDLSWAIMNC 570

Query: 476 FAENPPRSDMDFGRCPS 492
               P     D     S
Sbjct: 571 ILNVPYGFGGDVSSNKS 587


>gi|134288784|ref|YP_001111035.1| gp4, phage terminase, ATPase subunit [Burkholderia phage phiE202]
 gi|134131997|gb|ABO60745.1| gp4, phage terminase, ATPase subunit [Burkholderia phage phiE202]
          Length = 589

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/466 (9%), Positives = 106/466 (22%), Gaps = 46/466 (9%)

Query: 56  LEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLAN 115
            + +         + +     + K      R IG T   A   L          +   A+
Sbjct: 143 RDSLFDYQKVWYRNGDQRTRNILK-----SRQIGATWYFAREALVDALDTDRNQIFLSAS 197

Query: 116 SETQLKTTLWAEVSKWLSLLPNKHW------FEMQSLSLHPAPWYSDVLHCSLGIDSKHY 169
                       ++++     +             +                       Y
Sbjct: 198 KAQA--HVFKQYITQFARDAADVELTGDPIILPSGATLYFLGTNARTAQSYHGNFYFDEY 255

Query: 170 STMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSN 229
             + +     +  + +  H  +     +  +S T +       G    R       +  +
Sbjct: 256 FWVPKFRELNKVASGMAMHKRWRKTYFSTPSSVTHEAFAFW-SGAHANRGRAAGERIQID 314

Query: 230 PRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFP 289
               +     +            +      G +    + +   Y  +       +   F 
Sbjct: 315 TSHEALVRGMLCEDAQWRQIV-TVLDAMAGGCNLFDIDELRREYSAEE--FANLLMCHFI 371

Query: 290 QQDIDSFIPLNIIEEALNREPCPDP-----------YAPLIMGCDIAEEGGDNTVVVL-- 336
              +  F   ++    ++                  +  + +G D A  G    +VV+  
Sbjct: 372 DDSLSVFKLSDLQRCMVDSWEEWADDFSPLLLRPFGHREVWVGYDPALTGDSAGLVVVAP 431

Query: 337 ---RRG-PVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGY 392
                G   +     +   D       I  + ++Y    I ID    G      +     
Sbjct: 432 PRVDDGAFRVLERHQFRGNDFEEQAAAIEAITQRYNVGYIAIDTTGMGQGVYQLVRKFFP 491

Query: 393 HVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHS---GLIQNLKSLKSFIVPN 449
               +               +T L +K    +    L   +    L     ++K  +  +
Sbjct: 492 AAVALNYSPE---------VKTRLVLKGQSVVRNGRLQFDAGWTDLAAAFMAIKQTMTAS 542

Query: 450 TGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQY 495
             +    + R +     D +   ++     P           +  Y
Sbjct: 543 GRQATYTAGRTEETGHADLAWACLHAIDREPLAGGGIHSSSFTEFY 588


>gi|209694587|ref|YP_002262515.1| terminase, ATPase subunit [Aliivibrio salmonicida LFI1238]
 gi|208008538|emb|CAQ78711.1| terminase, ATPase subunit [Aliivibrio salmonicida LFI1238]
          Length = 590

 Score =  104 bits (259), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/454 (11%), Positives = 120/454 (26%), Gaps = 55/454 (12%)

Query: 57  EFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANS 116
           E +        N++      + K      R IG T   +   L          +   A S
Sbjct: 147 ESLFEYQHVMRNNIKQRIRNILK-----SRQIGATYYFSGEALEDAILTGDNQIFLSA-S 200

Query: 117 ETQLKTTLWAEVSKWLSLLPNKHWFEMQSLS-----------LHPAPWYSDVLHCSLGID 165
             Q       EV +   +   K + +++                 +            + 
Sbjct: 201 RAQA------EVFRSYIIAIGKEFLDIELTGNPITLSNGAELRFLSTNSKTAQSYHGHVY 254

Query: 166 SKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWI 225
              Y  + +     +  + +  H  +     +  +S               +  A+R  +
Sbjct: 255 VDEYFWIPKFDELNKLASAMATHKKWRKTYFSTPSSKMHQAYPFWTGDSWKKGKASREKL 314

Query: 226 MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVC 285
                                      I+     G D    + +   Y +D         
Sbjct: 315 EFPTFAEFRD--GGRLCDDKQWRYVVTIEDAANGGCDLFDIDELREEYSVDD--FNNLFM 370

Query: 286 GQFPQQDIDSFIPLNI----IEEALNREPCPDPYAP-----LIMGCDIAEEGGDNTVVVL 336
             F    +  F   ++    ++ A  ++  P    P     + +G D +    +  +VV+
Sbjct: 371 CMFVDGSLSVFKFSDLEKGMVDAAHWQDFKPKNKQPFEHREVWLGYDPSRTRDNACLVVV 430

Query: 337 R------RGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEML 390
                      +     W   + +   ++I  + ++Y+   I +D    G    D +   
Sbjct: 431 APPAVVVEKFRVLEKHYWKGLNFQYHVSEIDKVFKRYKVTYIGVDTTGIGGGVWDLISKK 490

Query: 391 GYHVYRVLGQKRAVDLEFCRNR-RTELHVKMADWLEFASLINHSG---LIQNLKSLKSFI 446
                      R        N  +  L +KM D +E   L   +    +     S+K   
Sbjct: 491 ---------YPREAHAIHYSNENKNRLVMKMIDVVEANRLQFDAEHKDIAMAFMSIKRVP 541

Query: 447 VPNTGELAIESKRVKGAKSTDYSDGLMYTFAENP 480
             +   +  +++R +     D    + +     P
Sbjct: 542 TSSGNAMTFKAERNQTTGHADAFWAISHAIINEP 575


>gi|194444881|ref|YP_002043300.1| hypothetical protein SNSL254_A4364 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194403544|gb|ACF63766.1| putative conserved hypothetical protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 589

 Score =  104 bits (259), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 60/477 (12%), Positives = 118/477 (24%), Gaps = 70/477 (14%)

Query: 58  FMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE 117
           F+E    + L           +  I   R IG T   A   L          +   A S+
Sbjct: 141 FLEQSFDYQLEWWRAGLAHRIR-HILKSRQIGATFYFAREALLQALKTGHNQIFLSA-SK 198

Query: 118 TQLKTTLWAEVSKWLSLLPNKHWFEMQSLSL----------HPAPWYSDVLHCSLGIDSK 167
           TQ          K++     +   E+    +                +     +  +   
Sbjct: 199 TQAY-----VFRKYIIAFARQAGVELTGDPIVLGNNGAELMFLGTNANTAQSHNGDLYVD 253

Query: 168 HYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMT 227
               +      +R    +           +  +S                  A  FW   
Sbjct: 254 EIFWIPNFQKLKRVAGGMSSQEHLRTTYFSTPSS--------------LAHGAYPFWSGE 299

Query: 228 SNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR----------YGLDS 277
              +  S     +            +     +       E  +A+             +S
Sbjct: 300 QFNKGRSDTSERVDIDISHAALAKGVACPDGQWRQIVTIEDALAKGCTLFNIDTLKRENS 359

Query: 278 -DVTRVEVCGQFPQQDIDSFIPLNIIEEALNREPCPDP----------YAPLIMGCDIAE 326
            D  R     +F       F    +    ++     +           + P+ +G D + 
Sbjct: 360 VDEFRNLFMCEFVDDKASVFPFEELQRCMVDSLEKWEDYAPFADRPFGHRPVWIGYDPSL 419

Query: 327 EGGDNTVVVL------RRGPVIEHLFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTG 380
            G     VV+           I     W   D       I  L +KY  + I IDA   G
Sbjct: 420 RGDSAGCVVIAPPVVAGGKFRILERHQWKGMDFAQQAESIRELTQKYTVEYIGIDATGLG 479

Query: 381 ARTCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINH---SGLIQ 437
                 +               A ++ +    +T + +K  D +    L      + + Q
Sbjct: 480 QGVFQLVR---------SFYPAAREIRYTPEMKTAMVLKAKDTIRRGCLEYDVSATDITQ 530

Query: 438 NLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCPSYQ 494
           +  S++  +  +      E+ R + A   D +   M+