RPSBLAST alignment of GI: 254781215 and protein with PDBid: 3cpe

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Length = 592
 Score = 59.4 bits (143), Expect = 2e-09
 Identities = 65/400 (16%), Positives = 118/400 (29%), Gaps = 57/400 (14%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
            +  R +GKTT+ A  +   +      +V  LA+  +     L     + + LLP+    
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD-RTKQAIELLPDF--- 238

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 L P     +     L   S              PD   G+       I  ++ +
Sbjct: 239 ------LQPGIVEWNKGSIELDNGSS------IGAYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF---------- 251
             P+  +  +       +  R  I+ +        FY+I+   ++    F          
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSV 343

Query: 252 -QIDTRTVEGIDPSF