RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781215|ref|YP_003065628.1| putative phage terminase,
large subunit [Candidatus Liberibacter asiaticus str. psy62]
         (511 letters)



>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative
           initiation, ATP-binding, DNA- binding, hydrolase,
           nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB:
           3ezk_A*
          Length = 592

 Score = 59.4 bits (143), Expect = 2e-09
 Identities = 65/400 (16%), Positives = 118/400 (29%), Gaps = 57/400 (14%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
            +  R +GKTT+ A  +   +      +V  LA+  +     L     + + LLP+    
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD-RTKQAIELLPDF--- 238

Query: 142 EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEAS 201
                 L P     +     L   S              PD   G+       I  ++ +
Sbjct: 239 ------LQPGIVEWNKGSIELDNGSS------IGAYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEIFNKPLDDWKRF---------- 251
             P+  +  +       +  R  I+ +        FY+I+   ++    F          
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSV 343

Query: 252 -QIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLNIIEEALNREP 310
            +      +  D  +   I    G      R E    F +    + I    +      E 
Sbjct: 344 KERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAF-EGTSGTLISGMKLAVMDFIEV 402

Query: 311 C-----------PDPYAPLIMGCDIAEEGGDNTVV-----VLRRGPVIEHLFDWSKTDLR 354
                       P+P    I   D +E  G +        V         +   +     
Sbjct: 403 TPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHL 462

Query: 355 TTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEM-LGYHVYRVLGQKRAVDLEFCRNRR 413
              + +   + +Y    + I+ N+TG      L M L Y    V+      DL   + +R
Sbjct: 463 ILPDIVMRYLVEYNECPVYIELNSTGVSVAKSLYMDLEYE--GVICDSY-TDLGMKQTKR 519

Query: 414 TELHV--KMADWLEFASL-INHSGLIQNLKSLKSFIVPNT 450
           T+      + D +E   L I+H   IQ     ++F     
Sbjct: 520 TKAVGCSTLKDLIEKDKLIIHHRATIQ---EFRTFSEKGV 556


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 43.4 bits (102), Expect = 1e-04
 Identities = 80/555 (14%), Positives = 136/555 (24%), Gaps = 243/555 (43%)

Query: 23  EIKLSFSNFVLHFFPWGEKGTPLEGF-SAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGA 81
           E+   F  +V       + G   +        ++  ++E  D H L +      +     
Sbjct: 59  ELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQEND---TT 115

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLL----PN 137
           +   + + K  + A   +         S   L  +  +    L A       +       
Sbjct: 116 LVKTKELIKNYITA--RIMAKRPFDKKSNSALFRAVGEGNAQLVA-------IFGGQGNT 166

Query: 138 KHWF-EMQSL-SLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAI 195
             +F E++ L   +      D++  S    ++  S + RT              T G+ I
Sbjct: 167 DDYFEELRDLYQTYH-VLVGDLIKFS----AETLSELIRT-----TLDAEKVF-TQGLNI 215

Query: 196 IN--DEASGTPDV-------INLGILGFL-------TERNANRFWIMTSNP----RRLSG 235
           +   +  S TPD        I+  ++G +       T        ++   P      L G
Sbjct: 216 LEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVT------AKLLGFTPGELRSYLKG 269

Query: 236 -----------------KFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSD 278
                                      D W+              SF      R      
Sbjct: 270 ATGHSQGLVTAVAIAET----------DSWE--------------SFFV--SVR------ 297

Query: 279 VTRVEV-------CGQ-FPQQDIDSFIPLNIIEEAL-NREPCPDPYAPLIM----GCDIA 325
              + V       C + +P     + +P +I+E++L N E  P P     M         
Sbjct: 298 -KAITVLFFIGVRCYEAYPN----TSLPPSILEDSLENNEGVPSP-----MLSISNLTQE 347

Query: 326 --------------EE---------GGDNTVV------------VLR------------- 337
                                    G  N VV             LR             
Sbjct: 348 QVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRI 407

Query: 338 ----RGPVIEHLF---------DWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTC 384
               R     + F               L   ++ I    +    + +  +A        
Sbjct: 408 PFSERKLKFSNRFLPVASPFHSHL----LVPASDLI---NKDLVKNNVSFNAK------- 453

Query: 385 DYLEMLGYHVY--------RVLGQK---RAVDLEFCRNRRTELHVKMADW---LEF-ASL 429
                +   VY        RVL      R VD          L V    W    +F A+ 
Sbjct: 454 ----DIQIPVYDTFDGSDLRVLSGSISERIVDC------IIRLPV---KWETTTQFKAT- 499

Query: 430 INH---------SGL 435
             H         SGL
Sbjct: 500 --HILDFGPGGASGL 512



 Score = 34.1 bits (78), Expect = 0.078
 Identities = 91/534 (17%), Positives = 140/534 (26%), Gaps = 228/534 (42%)

Query: 103 STRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSL------SLHPAPWYSD 156
           STRP      L  S   L+  L         L+P   +F    L       L P P  ++
Sbjct: 5   STRP------LTLSHGSLEHVL---------LVPTASFFIASQLQEQFNKIL-PEP--TE 46

Query: 157 VLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASG-TPDVINLGILG-- 213
                   D +  +        E    F+G+      +++     G    V+NL  L   
Sbjct: 47  ----GFAADDEPTT------PAELVGKFLGYV----SSLVEPSKVGQFDQVLNL-CLTEF 91

Query: 214 ---FL-----------------TERNANRFWI--------MTSNPRR------L-----S 234
              +L                 T     +  I        M   P        L      
Sbjct: 92  ENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGE 151

Query: 235 GKF--YEIF----NKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYG--LDSDVTR-VEVC 285
           G      IF    N   DD+  F+ + R +          +I      L   +   ++  
Sbjct: 152 GNAQLVAIFGGQGN--TDDY--FE-ELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAE 206

Query: 286 GQFPQQDIDSFIPLNIIEEALNREPCPD-PY---A----PLI--------------MGCD 323
             F Q        LNI+E   N    PD  Y        PLI              +G  
Sbjct: 207 KVFTQG-------LNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFT 259

Query: 324 IAEEGGDNTVVVLRR----------GPVI----------EHLFDWSKTDLRTTNNKISGL 363
             E         LR           G V           E  F   +  +         L
Sbjct: 260 PGE---------LRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITV-------L 303

Query: 364 ----VEKYR-------PDAIIIDA--NNTGARTCDYLEMLGYHVYRVLGQKRAVD--LEF 408
               V  Y        P +I+ D+  NN G  +     ML   +   L Q+  V   +  
Sbjct: 304 FFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSP----ML--SI-SNLTQE-QVQDYVNK 355

Query: 409 C-----RNRRTELHVKMADWLEFASLINHSGLIQNLKSLKSFIVPNTGE------LAIES 457
                   ++  + +         SL+N           K+ +V  +G       L +  
Sbjct: 356 TNSHLPAGKQ--VEI---------SLVN---------GAKNLVV--SGPPQSLYGLNLTL 393

Query: 458 KRVKGAKSTDYSDGLMYTFAENPPRSDMDFGRCP-------SYQYEGVDLLIER 504
           ++ K     D S      F+E   +    F   P              DL+ + 
Sbjct: 394 RKAKAPSGLDQSR---IPFSERKLKFSNRF--LPVASPFHSHLLVPASDLINKD 442


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
           acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 1688

 Score = 35.2 bits (80), Expect = 0.038
 Identities = 66/304 (21%), Positives = 100/304 (32%), Gaps = 95/304 (31%)

Query: 265 FHEGIIARYGLDSDVTRVEVCGQFPQQDI--------------------DSFIPLNIIEE 304
           +++ I A+YG       V    Q  +QD+                    D+ IP   I E
Sbjct: 518 YYQSIYAKYGAKGSTLIVVPFNQGSKQDVEALIEFIYDTEKNGGLGWDLDAIIPFAAIPE 577

Query: 305 A---LNREPCPDPYAPLI--------MGCDIAEEG--GDNT---VVVLRRGPVIEH---- 344
               L        +A  I        MGC   ++   G  T    V+L   P   H    
Sbjct: 578 QGIELEHIDSKSEFAHRIMLTNILRMMGCVKKQKSARGIETRPAQVILPMSP--NHGTFG 635

Query: 345 ---LFDWSKTDLRTTNNK-----------ISGLVEKYRPDAIIIDANN--------TGAR 382
              ++  SK  L T  N+           + G +  +     ++ ANN         G R
Sbjct: 636 GDGMYSESKLSLETLFNRWHSESWANQLTVCGAIIGWTRGTGLMSANNIIAEGIEKMGVR 695

Query: 383 TCDYLEMLGYHVYRVLGQKRAVDLEFCRNRRTELHVKMADWLEFASLINHSGLIQNLKSL 442
           T    EM     + +LG      +E C+         MAD       +N  G +Q +  L
Sbjct: 696 TFSQKEM----AFNLLGLLTPEVVELCQKSPV-----MAD-------LN--GGLQFVPEL 737

Query: 443 KSFIVPNTGELAIESKRVKGAKSTDY----------SDGLMYTFAENPPRSD--MDFGRC 490
           K F      EL +E+  V+ A S +           S    Y   E  PR++  +DF   
Sbjct: 738 KEFTAKLRKEL-VETSEVRKAVSIETALEHKVVNGNSADAAYAQVEIQPRANIQLDFPEL 796

Query: 491 PSYQ 494
             Y+
Sbjct: 797 KPYK 800


>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia
           coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E*
           1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*
          Length = 334

 Score = 31.1 bits (69), Expect = 0.64
 Identities = 15/119 (12%), Positives = 31/119 (26%), Gaps = 3/119 (2%)

Query: 82  ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWF 141
           I A  G+G   L   L  +L+  +P     C      QL           L+    K+  
Sbjct: 29  IQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTL 88

Query: 142 ---EMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIIN 197
               ++ ++              + +      T     +  +          + +A   
Sbjct: 89  GVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATRE 147


>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4;
           ketosynthase, acyltransferase, phosphopantetheine; 2.59A
           {Saccharopolyspora erythraea}
          Length = 915

 Score = 30.5 bits (68), Expect = 0.84
 Identities = 24/123 (19%), Positives = 36/123 (29%), Gaps = 20/123 (16%)

Query: 289 PQQDID-SFIPLNIIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEH--- 344
           P   +D S   + ++      +P                  G N  V++   P  EH   
Sbjct: 383 PTPHVDWSSGGVALLAGN---QPWRRGERTRRAAVSAFGISGTNAHVIVEEAPEREHRET 439

Query: 345 -----------LFDWSKTDLRTTNNKISGLVEKYRPDAIIIDANNTGARTCDYLEMLGYH 393
                      +   S   LR    +I+ L+E  RPDA +       A T    E     
Sbjct: 440 TAHDGRPVPLVVSARSTAALRAQAAQIAELLE--RPDADLAGVGLGLATTRARHEHRAAV 497

Query: 394 VYR 396
           V  
Sbjct: 498 VAS 500


>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein
           COOC; Zn-bound dimer, nickel binding protein, ATPase;
           1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A*
           3kje_A 3kji_A*
          Length = 254

 Score = 30.7 bits (68), Expect = 0.86
 Identities = 32/262 (12%), Positives = 75/262 (28%), Gaps = 32/262 (12%)

Query: 81  AISAGRGIGKTTLNAWLVLWLMSTRPGISVICL-ANSETQLKTTLWAEVSKWLSLLPNKH 139
           A++   G+GKTT+ A L+  +        +  +  + ++ L  TL   + +  ++ P   
Sbjct: 4   AVAGKGGVGKTTVAAGLIKIM--ASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIE 61

Query: 140 WFE------MQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGM 193
             +           L   P     L             +     ++         N++  
Sbjct: 62  MKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLG 121

Query: 194 AIINDEASGTPDVINLGILGFLTERNANRF-----WIMTSNPRRLSGKFYEIFNKPLDDW 248
           ++++       + + + +   +              I    P   S          +   
Sbjct: 122 SVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNS----------IKTG 171

Query: 249 KRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN--IIEEAL 306
              +   +    +       +I +    +      +    P+  I   IP N   IE +L
Sbjct: 172 LNIE---KLAGDLGIKKVRYVINKV--RNIKEEKLIKKHLPEDKILGIIPYNELFIELSL 226

Query: 307 NREPCPDPYAPLIMG-CDIAEE 327
             E       P  +   DI ++
Sbj