RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >gnl|CDD|144936 pfam01527, Transposase_8, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family. Length = 75 Score = 33.8 bits (78), Expect = 0.024 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 5 KYTKERIDNILA-SFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLE 50 +Y++E + S G S+S+ ++HGV+ + + W K+ R L Sbjct: 6 RYSEEFKARAVKESLEPGASVSELAREHGVSPATLYKWRKKYRGGLL 52 >gnl|CDD|31483 COG1292, BetT, Choline-glycine betaine transporter [Cell envelope biogenesis, outer membrane]. Length = 537 Score = 33.3 bits (76), Expect = 0.029 Identities = 13/52 (25%), Positives = 16/52 (30%) Query: 33 VTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHP 84 V + S +KQD D +KR E V P EE Sbjct: 486 VMMFSLIKDLKQDYADRKKRLEALMSPPRLRAGLRFKGDVAEPAMEEVAAEL 537 >gnl|CDD|33644 COG3854, SpoIIIAA, ncharacterized protein conserved in bacteria [Function unknown]. Length = 308 Score = 29.6 bits (66), Expect = 0.44 Identities = 15/67 (22%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Query: 66 ENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRN--VYGNHVSVEQKHTIDL 123 E + S++ + + ++ P L E+R+ R+ LE + VY +++ V ++ DL Sbjct: 4 EEIFSILPEKIRQILKEIPDRNNLEEVRI-RVNRPLEAIFPGQPVYLSYIGVTKE---DL 59 Query: 124 KPLMDRV 130 + ++R+ Sbjct: 60 QKTLNRL 66 >gnl|CDD|36824 KOG1611, KOG1611, KOG1611, Predicted short chain-type dehydrogenase [General function prediction only]. Length = 249 Score = 28.7 bits (64), Expect = 0.69 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 23 SLSQSCKKHGVTVVSFH-GWVKQD 45 SLS K + VVS H GWV+ D Sbjct: 184 SLSVDLKDDHILVVSIHPGWVQTD 207 >gnl|CDD|37011 KOG1800, KOG1800, KOG1800, Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism]. Length = 468 Score = 26.9 bits (59), Expect = 2.7 Identities = 11/39 (28%), Positives = 17/39 (43%) Query: 19 SGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAK 57 S L + GV VVS+ W K D +++ + K Sbjct: 413 SSSAGLEALLESRGVRVVSWSDWEKIDAKEVARGKGTGK 451 >gnl|CDD|146611 pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence. Length = 175 Score = 26.4 bits (59), Expect = 3.5 Identities = 6/27 (22%), Positives = 10/27 (37%) Query: 82 DHPQAIKLRELRMKRLQWELEKRYRNV 108 D P+ I+ + + R R V Sbjct: 101 DLPEVIEFKRRLLPEAGARPPARRRYV 127 >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+. ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2. This subfamily consists of eukaryotic and bacterial ME. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 279 Score = 26.4 bits (59), Expect = 3.6 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Query: 12 DNILASF-SGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLAS 70 D I+++ GLS ++ KK + +V G + +DR+DL + + E ++L Sbjct: 42 DLIVSAMVREGLSEEEARKK--IWLVDSKGLLTKDRKDLTPFKKPFARKDEEKEGKSLLE 99 Query: 71 VVEA 74 VV+A Sbjct: 100 VVKA 103 >gnl|CDD|34129 COG4449, COG4449, Predicted protease of the Abi (CAAX) family [General function prediction only]. Length = 827 Score = 26.6 bits (58), Expect = 3.8 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 19/50 (38%) Query: 63 HLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNH 112 H S +L V+ P TEE LQWE+ Y VY ++ Sbjct: 388 HFSFSLPKVIRDPFTEE-----------------LQWEIP--YYQVYAHN 418 >gnl|CDD|36479 KOG1265, KOG1265, KOG1265, Phospholipase C [Lipid transport and metabolism]. Length = 1189 Score = 26.5 bits (58), Expect = 3.8 Identities = 14/51 (27%), Positives = 23/51 (45%) Query: 51 KRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWEL 101 KR + + E L + V+E EE+ +A + E +M RL E+ Sbjct: 1138 KRLAEKQSKRQEQLVKKHLEVLEQLAEEEKALDAEAEQEYEEQMARLPAEV 1188 >gnl|CDD|39661 KOG4460, KOG4460, KOG4460, Nuclear pore complex, Nup88/rNup84 component [Nuclear structure, Intracellular trafficking, secretion, and vesicular transport]. Length = 741 Score = 26.2 bits (57), Expect = 4.7 Identities = 21/107 (19%), Positives = 44/107 (41%), Gaps = 11/107 (10%) Query: 42 VKQDREDLEKRYEQAKQSH--MEHLSENLASVVEA---PLTEEERDHPQAIKLRELRMKR 96 +++ E L RYE+AK+ + + + L + L++ ERD + ++L +++ Sbjct: 614 LREMAERLADRYEEAKEKQEDLMNRMKKLLHSFHSELPVLSDAERDFKKELQLIPDQLRH 673 Query: 97 LQWELE------KRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSK 137 L +E + + +S K T L + SI + Sbjct: 674 LGNAIETVTMKKDKQQQHMEKVLSALPKPTYILSAYQRKCIQSILKE 720 >gnl|CDD|33124 COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 297 Score = 25.7 bits (56), Expect = 5.8 Identities = 6/29 (20%), Positives = 11/29 (37%) Query: 80 ERDHPQAIKLRELRMKRLQWELEKRYRNV 108 E D P+ I+ ++ + R V Sbjct: 120 EVDLPEVIEFKKKLLAERGATPPAHRRLV 148 >gnl|CDD|32499 COG2352, Ppc, Phosphoenolpyruvate carboxylase [Energy production and conversion]. Length = 910 Score = 25.6 bits (56), Expect = 6.3 Identities = 19/82 (23%), Positives = 31/82 (37%), Gaps = 3/82 (3%) Query: 45 DREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRE---LRMKRLQWEL 101 D E E+ ++Q ++ + LA L + ++I LR + LQ EL Sbjct: 816 DPELGERLFDQIREEYQLTRKVVLAITGHDELLADNPWLAESIALRNPYLDPLNVLQVEL 875 Query: 102 EKRYRNVYGNHVSVEQKHTIDL 123 KR R E + + L Sbjct: 876 LKRSRQSKRGDPDPEVERALLL 897 >gnl|CDD|36751 KOG1538, KOG1538, KOG1538, Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]. Length = 1081 Score = 25.8 bits (56), Expect = 6.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 87 IKLRELRMKRLQWELEKRYRN 107 I++R+LR L ELE+R + Sbjct: 609 IRVRDLRYLELISELEERKKR 629 >gnl|CDD|36801 KOG1588, KOG1588, KOG1588, RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification]. Length = 259 Score = 25.8 bits (56), Expect = 6.5 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 5/74 (6%) Query: 21 GLSLSQSCKKHGVTV-VSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEE 79 G SL + ++ G + + G ++ ++ E R EHL+E L ++E Sbjct: 117 GNSLKRLEEETGCKIMIRGRGSMRDKAKEEELR----GDPGYEHLNEPLHVLIETEAPPA 172 Query: 80 ERDHPQAIKLRELR 93 E A L E++ Sbjct: 173 EAYARLAYALEEIK 186 >gnl|CDD|31648 COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 397 Score = 25.6 bits (56), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Query: 2 YAHKYTKERIDNILASFSGGLSLSQSCKKHG 32 + K+ + +IL G SLS++ + Sbjct: 88 APNPKLKQVLTSILEELESGKSLSEALAQLP 118 >gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]. Length = 721 Score = 25.6 bits (56), Expect = 7.2 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Query: 47 EDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIK--LRELRMKR 96 EDLE+ E+ +Q+ +E L++ ++ E L EEE Q +K +R +KR Sbjct: 230 EDLEELAEEKRQALIETLADVDETLAEMFLEEEEPS-AQQLKAAIRRATIKR 280 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,871,399 Number of extensions: 89085 Number of successful extensions: 287 Number of sequences better than 10.0: 1 Number of HSP's gapped: 287 Number of HSP's successfully gapped: 58 Length of query: 162 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,405,363 Effective search space: 334807588 Effective search space used: 334807588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (24.5 bits)