RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology. Length = 240 Score = 29.9 bits (68), Expect = 0.27 Identities = 13/49 (26%), Positives = 21/49 (42%) Query: 12 DNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH 60 + I SF L + + KK G +S ++ + +RYEQ Q Sbjct: 177 ELITLSFDDPLDVLRHLKKTGANGLSSGRTSRKQLKAFLERYEQEFQPD 225 >gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed. Length = 1066 Score = 28.5 bits (65), Expect = 0.73 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Query: 8 KERIDNILASFSG--GLSLSQSCKKHGV 33 KER D IL + G L+L+ + GV Sbjct: 80 KERPDAILPTMGGQTALNLAVELAESGV 107 >gnl|CDD|179979 PRK05257, PRK05257, malate:quinone oxidoreductase; Validated. Length = 494 Score = 28.6 bits (65), Expect = 0.73 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 7/57 (12%) Query: 36 VSFHGWVKQDREDLEKRYEQAKQSH----MEHLSENLASVVE-APLTEEERDHPQAI 87 +SF W + + L+KRYE K + ME SE+ A + E APL E RD Q + Sbjct: 115 MSF-VWGEDNVAFLKKRYEALKANPLFAGMEF-SEDPAQIKEWAPLMMEGRDPSQKV 169 >gnl|CDD|181833 PRK09413, PRK09413, IS2 repressor TnpA; Reviewed. Length = 121 Score = 28.6 bits (63), Expect = 0.73 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 5 KYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDRE 47 + T+E+I + SF G+++S ++HGV W KQ +E Sbjct: 13 RTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQE 55 >gnl|CDD|177791 PLN00200, PLN00200, argininosuccinate synthase; Provisional. Length = 404 Score = 28.2 bits (63), Expect = 0.94 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 14 ILASFSGGLSLS----QSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQS 59 ++ ++SGGL S + +G VV F V Q E+LE +AK S Sbjct: 8 VVLAYSGGLDTSVILKWLRENYGCEVVCFTADVGQGIEELEGLEAKAKAS 57 >gnl|CDD|178444 PLN02852, PLN02852, ferredoxin-NADP+ reductase. Length = 491 Score = 27.4 bits (61), Expect = 1.7 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Query: 23 SLSQSCKKHGVTVVSFHGWVKQDREDLEKR 52 L + + GV VV F GW K D EK Sbjct: 439 GLLELLESRGVRVVPFSGWEKIDSA--EKE 466 >gnl|CDD|162321 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit. In several thermophilic species (Methanobacterium thermoautotrophicum, Methanococcus jannaschii, Aquifex aeolicus), the large subunit appears split, at different points, into two separate genes. Length = 1050 Score = 27.3 bits (61), Expect = 1.9 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 8/63 (12%) Query: 8 KERIDNILASFSG------GLSLSQS--CKKHGVTVVSFHGWVKQDREDLEKRYEQAKQS 59 KER D IL +F G + L +S +K+GV V+ + ED E E K+ Sbjct: 79 KERPDAILPTFGGQTALNLAVELEESGVLEKYGVEVLGTPVEAIKKAEDRELFREAMKEI 138 Query: 60 HME 62 Sbjct: 139 GEP 141 >gnl|CDD|185096 PRK15174, PRK15174, Vi polysaccharide export protein VexE; Provisional. Length = 656 Score = 26.6 bits (58), Expect = 3.4 Identities = 15/67 (22%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Query: 44 QDREDLEKRYEQAKQSHM-EHLSENLASVVE----APLTEEERDHPQAIKLRELRMKRLQ 98 + E + + Y QA+ SH+ + E L ++ L E D + R+ ++R + Sbjct: 369 SEAESVFEHYIQARASHLPQSFEEGLLALDGQISAVNLPPERLDWAWEVAGRQSGIERDE 428 Query: 99 WELEKRY 105 WE ++ Sbjct: 429 WERRAKW 435 >gnl|CDD|182206 PRK10044, PRK10044, ferrichrome outer membrane transporter; Provisional. Length = 727 Score = 25.9 bits (57), Expect = 4.5 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Query: 100 ELEKRYRNVYGNHVSVEQKHTIDLKPLMDR-------VQHSIQSK 137 E + R+VYG V ++ H ++ ++D V +QSK Sbjct: 337 ENKTSQRSVYGYGVCSDKGHYLNRGYVVDDEKLQNFSVDTQLQSK 381 >gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome]. Length = 555 Score = 25.7 bits (56), Expect = 5.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 48 DLEKRYEQAKQSHMEHLSENLASVVEAPLTEEE 80 D ++RY K + H + N+ VV P +EEE Sbjct: 113 DYDERYFHGKPQNSFHKAVNIPDVVVFPRSEEE 145 >gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed. Length = 462 Score = 25.9 bits (58), Expect = 5.4 Identities = 14/57 (24%), Positives = 24/57 (42%), Gaps = 13/57 (22%) Query: 9 ERIDNILASFSGGLSLSQSCKKHGVTVVSFHGW--------VKQDREDLEKRYEQAK 57 E + ++ +GG+ KK+ V ++ G V+ ED E+ Y AK Sbjct: 85 EWKNGVVNRLTGGVEGL--LKKNKVDII--RGEAKLVDPNTVRVMTEDGEQTY-TAK 136 >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter. This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. Length = 2272 Score = 25.7 bits (56), Expect = 5.4 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 10/85 (11%) Query: 38 FHGWVKQDREDLEKRY------EQAKQ----SHMEHLSENLASVVEAPLTEEERDHPQAI 87 F G +Q RE+ R+ E+A Q SH + A P E E Sbjct: 1286 FAGGAQQKRENANLRHPCSGPTEKAGQTPQASHTCSPGQPAAHPEGQPPPEPEDPGVPLN 1345 Query: 88 KLRELRMKRLQWELEKRYRNVYGNH 112 L ++ +Q L KR+++ +H Sbjct: 1346 TGARLILQHVQALLVKRFQHTIRSH 1370 >gnl|CDD|180670 PRK06722, PRK06722, exonuclease; Provisional. Length = 281 Score = 25.8 bits (56), Expect = 5.5 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Query: 24 LSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDH 83 LS C H V K+ R DL+K QA + EH ++V + L E + H Sbjct: 105 LSHDCTLHSVECPCME---KERRIDLQKFVFQAYEELFEHTPSLQSAVEQLGLIWEGKQH 161 >gnl|CDD|183073 PRK11281, PRK11281, hypothetical protein; Provisional. Length = 1113 Score = 25.6 bits (57), Expect = 6.2 Identities = 11/63 (17%), Positives = 25/63 (39%), Gaps = 7/63 (11%) Query: 42 VKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWEL 101 K++ E L+++ QA + L ++ + E L L +++L+ L Sbjct: 78 QKEETEQLKQQLAQAPAK-LRQAQAELEALKDDNDEETRET------LSTLSLRQLESRL 130 Query: 102 EKR 104 + Sbjct: 131 AQT 133 >gnl|CDD|161769 TIGR00216, ispH_lytB, (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming). Escherichia coli LytB protein had been found to regulate the activity of RelA (guanosine 3',5'-bispyrophosphate synthetase I), which in turn controls the level of a regulatory metabolite. It is involved in penicillin tolerance and the stringent response. Length = 280 Score = 25.4 bits (56), Expect = 7.5 Identities = 8/31 (25%), Positives = 13/31 (41%) Query: 22 LSLSQSCKKHGVTVVSFHGWVKQDREDLEKR 52 L ++ HG + RE+LEK+ Sbjct: 57 LEDLDEVAAGDTVIIRAHGVPPEVREELEKK 87 >gnl|CDD|149431 pfam08366, LLGL, LLGL2. This domain is found in lethal giant larvae homolog 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn. It has been identified in eukaryotes and tends to be found together with WD repeats (pfam00400). Length = 105 Score = 25.4 bits (56), Expect = 7.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 18 FSGGLSLSQSCKKHGVTVV 36 FSGG+ + +H +TV+ Sbjct: 33 FSGGMPRASYGDRHCITVM 51 >gnl|CDD|129409 TIGR00309, V_ATPase_subD, H(+)-transporting ATP synthase, vacuolar type, subunit D. Although this ATPase can run backwards, using a proton gradient to synthesize ATP, the primary biological role is to acidify some compartment, such as yeast vacuole (a lysosomal homolog) or the interior of a prokaryote. Length = 209 Score = 25.2 bits (55), Expect = 7.9 Identities = 16/78 (20%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Query: 48 DLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRN 107 + +R + K + L E ++ ++EA + P A+ + L + ++E++ + +N Sbjct: 41 QILERAKDIKNKMEQKLKEAISDLIEA----QSVMGPFAVWIAALSVVTARFEVDMKSKN 96 Query: 108 VYGNHVSVEQKHTIDLKP 125 + G V V + I K Sbjct: 97 IMGVVVPVFDSYEIRRKV 114 >gnl|CDD|152883 pfam12449, DUF3684, Protein of unknown function (DUF3684). This domain family is found in eukaryotes, and is typically between 1072 and 1090 amino acids in length. Length = 1082 Score = 25.4 bits (56), Expect = 8.1 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 65 SENLASVVE--APLTEEERDHPQAIKLRELRMKRL 97 S L+S+VE A + D A+KLR+L ++R Sbjct: 1043 SPPLSSLVEEEARIGAVASDQRPAVKLRKLILERS 1077 >gnl|CDD|114743 pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators. Length = 489 Score = 25.3 bits (56), Expect = 8.5 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Query: 49 LEKRYEQAKQSH----MEHLSENLASVVE-APLTEEERDHPQAI 87 L+KRYE KQ+ ME SE+ + E PL E RD + I Sbjct: 126 LKKRYEALKQNPLFEGME-YSEDPEKIKEWVPLMMEGRDPDEPI 168 >gnl|CDD|177902 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme. Length = 668 Score = 25.1 bits (55), Expect = 9.0 Identities = 8/29 (27%), Positives = 21/29 (72%) Query: 10 RIDNILASFSGGLSLSQSCKKHGVTVVSF 38 +++ I A+ G L+L+ C+++G+ +++F Sbjct: 451 KVETIRANVVGTLTLADVCRENGLLMMNF 479 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.267 0.0672 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,556,268 Number of extensions: 150233 Number of successful extensions: 349 Number of sequences better than 10.0: 1 Number of HSP's gapped: 349 Number of HSP's successfully gapped: 45 Length of query: 162 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,136,185 Effective search space: 314350060 Effective search space used: 314350060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (24.3 bits)