RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Score = 32.0 bits (71), Expect = 0.028 Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 59 SHMEHLSENLASVVEAPLTEEERD 82 S +E L +NLA V E PL D Sbjct: 283 SSLEQLEQNLALVEEGPLEPAVVD 306 >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Length = 89 Score = 31.8 bits (72), Expect = 0.030 Identities = 13/64 (20%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Query: 1 MYAHKYTKERIDNI--LASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQ 58 M Y++E + L S G SL Q G+ V+ W+ + + + Sbjct: 1 MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSA 60 Query: 59 SHME 62 + E Sbjct: 61 AVSE 64 >d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Length = 93 Score = 30.8 bits (70), Expect = 0.060 Identities = 8/45 (17%), Positives = 21/45 (46%) Query: 8 KERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKR 52 +I + G ++L+++ + +G++ F+ WV E + Sbjct: 37 SRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDA 81 >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Score = 30.8 bits (68), Expect = 0.067 Identities = 16/94 (17%), Positives = 32/94 (34%), Gaps = 6/94 (6%) Query: 38 FHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRL 97 F + Q +++K +E +E L + L A E+ I +E K Sbjct: 3 FSQELTQREANVKKVHEN-----LEELQKKLDHTSFA-HKEDRDRLEAQIAQKEQEQKAK 56 Query: 98 QWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQ 131 E +++ +N + E++ Q Sbjct: 57 LAEYDQKVQNEFDARERAEREREAARGDAAAEKQ 90 >d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 241 Score = 28.9 bits (64), Expect = 0.22 Identities = 13/74 (17%), Positives = 29/74 (39%), Gaps = 4/74 (5%) Query: 28 CKKHGVTVVSFHGWVKQDREDLEKR--YEQAKQSHMEHLSENLASVVEAPLTEEERDHPQ 85 K V S V +L K+ E+ + +E++ + + E +EEE + Sbjct: 167 DKFESKGVKSVRARVTNIINELPKKITVEKFRDLLLEYMKKEYPEMTEYVFSEEEL--AE 224 Query: 86 AIKLRELRMKRLQW 99 ++++ + W Sbjct: 225 INRIKDTKFGTWDW 238 >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Score = 26.8 bits (58), Expect = 0.97 Identities = 7/49 (14%), Positives = 18/49 (36%), Gaps = 15/49 (30%) Query: 59 SHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRN 107 + M+ L N+ S + L+E+ + ++ + + Y Sbjct: 310 TTMDQLKTNIES-LHLELSEDV-------------LAEIE-AVHQVYTY 343 >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Score = 26.1 bits (56), Expect = 1.4 Identities = 7/25 (28%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Query: 59 SHMEHLSENLASV-VEAPLTEEERD 82 S+ E L EN+ ++ V L+ Sbjct: 290 SNAEQLMENIGAIQVLPKLSSSIVH 314 >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Score = 25.7 bits (55), Expect = 2.1 Identities = 4/26 (15%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 57 KQSHMEHLSENLASVVEAPLTEEERD 82 + L +N+ + + L++E+ Sbjct: 278 GAKRADQLIDNIKT-ADVTLSQEDIS 302 >d1dc1a_ c.52.1.11 (A:) Restriction endonuclease BsobI {Bacillus stearothermophilus [TaxId: 1422]} Length = 319 Score = 24.5 bits (53), Expect = 4.4 Identities = 10/51 (19%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 91 ELRMKRLQWELEKRYRN-VYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLK 140 E K + W + ++R +Y VS+ +K+ +D+ + K + Sbjct: 177 ETFAKGISWTINGKHRTLMYNITVSLVKKN-VDICLFNCEPEIYTPQKVHQ 226 >d1sfea2 c.55.7.1 (A:12-92) Ada DNA repair protein {Escherichia coli [TaxId: 562]} Length = 81 Score = 23.9 bits (51), Expect = 6.9 Identities = 6/53 (11%), Positives = 19/53 (35%) Query: 30 KHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERD 82 + G+ + +L++ + A + + + + V A L + + Sbjct: 21 ERGICAILLGDDDATLISELQQMFPAADNAPADLMFQQHVREVIASLNQRDTP 73 >d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Length = 278 Score = 23.8 bits (50), Expect = 7.4 Identities = 4/38 (10%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Query: 24 LSQSCKKHGVTVVSFH---GWVKQDREDLEKRYEQAKQ 58 L++ + H + ++ + + +D + + + K Sbjct: 51 LAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKG 88 >d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Length = 501 Score = 23.8 bits (51), Expect = 8.5 Identities = 8/38 (21%), Positives = 14/38 (36%), Gaps = 10/38 (26%) Query: 47 EDLEKRYEQAKQSH-MEHLSENLASVVEAPLTEEERDH 83 DL+ +A Q H + +E L E ++ Sbjct: 4 NDLKLTLSKAGQEHLLRFWNE---------LEEAQQVE 32 >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Score = 23.7 bits (50), Expect = 9.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 29 KKHGVTVVSFHGWVKQDREDLE 50 GV VSF W K D E++ Sbjct: 185 DSRGVWPVSFSDWEKLDAEEVS 206 >d1g5ma_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Score = 23.4 bits (50), Expect = 9.9 Identities = 5/48 (10%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 66 ENLASVVEAPLTEEERDHPQAIKLREL--RMKRLQWELEKRYRNVYGN 111 + E + P+ + + +++ + +RYR + Sbjct: 24 RGYEWDAGDDVEENRTEAPEGTESEVVHLALRQAGDDFSRRYRGDFAE 71 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.267 0.0421 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 580,435 Number of extensions: 25516 Number of successful extensions: 104 Number of sequences better than 10.0: 1 Number of HSP's gapped: 104 Number of HSP's successfully gapped: 31 Length of query: 162 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 83 Effective length of database: 1,322,926 Effective search space: 109802858 Effective search space used: 109802858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.4 bits)