BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Score = 333 bits (855), Expect = 7e-94, Method: Compositional matrix adjust. Identities = 162/162 (100%), Positives = 162/162 (100%) Query: 1 MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH 60 MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH Sbjct: 1 MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH 60 Query: 61 MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT 120 MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT Sbjct: 61 MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT 120 Query: 121 IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD 162 IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD Sbjct: 121 IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD 162 >gi|254781188|ref|YP_003065601.1| hypothetical protein CLIBASIA_05475 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 61.6 bits (148), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 54/155 (34%), Positives = 83/155 (53%), Gaps = 10/155 (6%) Query: 6 YTKERIDNILASFSGGLSLSQSCKKHGVTVVS-FHGWVKQDREDLEKRYEQAKQSHMEHL 64 Y+ E IL + G +L +K G+ S F+ W+K+D + L++ Y +A Q ++ L Sbjct: 21 YSPELFAGILDQVANGKALGHVLRKVGMPKYSTFYRWIKKDLK-LQEAYTEALQCRLDLL 79 Query: 65 SENLASVVEAPLTEEERDHPQAI-KLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDL 123 +E L T EE +P K+R+ + + + LEK YG VSVE KHTIDL Sbjct: 80 AEELLEEPAP--TAEELANPVFYSKMRDRKQRMGTFLLEKLSNQKYGPRVSVESKHTIDL 137 Query: 124 KPLMDRVQHSIQSKGLKPV---KALDKQTEKPLEL 155 +P ++R++ K LKP+ + K TEKPLE+ Sbjct: 138 RPAIERLRE--HYKHLKPIDSERIPHKSTEKPLEI 170 >gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 27.3 bits (59), Expect = 0.13, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 5 KYTKERIDNILASFSGGL-SLSQSCKKHGVTVVSFHGW 41 ++ R ++A+ GGL SL ++C+ + +TV F W Sbjct: 32 RWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69 >gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.1 bits (48), Expect = 2.7, Method: Compositional matrix adjust. Identities = 18/73 (24%), Positives = 29/73 (39%), Gaps = 8/73 (10%) Query: 35 VVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEER-----DHPQAIKL 89 V+ G + L R+ AK S + H + S+V ++E+E D P Sbjct: 24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNA 83 Query: 90 RELR---MKRLQW 99 ++ M RL W Sbjct: 84 KDSYHKLMIRLSW 96 >gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 21.9 bits (45), Expect = 5.7, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 6 YTKERIDNILASFSGGLSLSQ 26 +T ERID + +S GLS SQ Sbjct: 3 WTVERIDKLKKFWSEGLSASQ 23 >gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 293 Score = 21.6 bits (44), Expect = 6.7, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 123 LKPLMDRVQHSIQSKGLKPVKA 144 +KP +D++ SI+S P+KA Sbjct: 141 VKPFLDKLGVSIKSVKSSPMKA 162 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 21.6 bits (44), Expect = 8.7, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 2 YAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFH 39 +A+ Y R I++SF+ + S KK G +FH Sbjct: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597 >gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 21.6 bits (44), Expect = 8.7, Method: Compositional matrix adjust. Identities = 11/43 (25%), Positives = 18/43 (41%) Query: 9 ERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEK 51 ERI ++ + LS +C T+ F+ + D EK Sbjct: 95 ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.129 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,784 Number of Sequences: 1233 Number of extensions: 3851 Number of successful extensions: 16 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 15 length of query: 162 length of database: 328,796 effective HSP length: 67 effective length of query: 95 effective length of database: 246,185 effective search space: 23387575 effective search space used: 23387575 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 35 (18.1 bits)