RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781219|ref|YP_003065632.1| hypothetical protein CLIBASIA_05630 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >d1k8ta_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis [TaxId: 1392]} Length = 509 Score = 31.5 bits (71), Expect = 0.058 Identities = 14/68 (20%), Positives = 24/68 (35%) Query: 93 TEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFY 152 T+ + + + L+ I + S +DSG + S + YL D+Y Sbjct: 356 TDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKESVKKIAGYLSDYY 415 Query: 153 KEIKHTFG 160 H F Sbjct: 416 NSANHIFS 423 >d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Score = 29.5 bits (65), Expect = 0.19 Identities = 9/49 (18%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPS 191 A+I+ LE + H +G P +++ + L+ E + Sbjct: 8 AVIKVLEA--WGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEEVG 54 >d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Score = 28.4 bits (62), Expect = 0.39 Identities = 7/43 (16%), Positives = 14/43 (32%), Gaps = 2/43 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQ 185 AL+ L D + FG + + + + I + Sbjct: 6 ALLSRLRD--HGVGKVFGVVGREAASILFDEVEGIDFVLTRHE 46 >d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Score = 27.6 bits (60), Expect = 0.73 Identities = 9/48 (18%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNP 190 A+++ LE +G P+ LS + + +E + F Sbjct: 9 AVMKILES--WGADTIYGIPSGTLSSLMDAMGEEENNVKFLQVKHEEV 54 >d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Score = 27.6 bits (60), Expect = 0.76 Identities = 7/33 (21%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELAD 175 ++ LE + ++ FG P + L D Sbjct: 10 LVVSQLEA--QGVRQVFGIPGAKIDKVFDSLLD 40 >d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Score = 27.7 bits (60), Expect = 0.81 Identities = 7/43 (16%), Positives = 13/43 (30%), Gaps = 2/43 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQ 185 L + I FGNP P + + ++ + Sbjct: 6 TTYELLRR--QGIDTVFGNPGSNALPFLKDFPEDFRYILALQE 46 >d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Score = 27.2 bits (59), Expect = 0.91 Identities = 6/45 (13%), Positives = 12/45 (26%), Gaps = 2/45 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFV 187 L L+ + FG P D + ++ + Sbjct: 8 YLFERLKQ--VNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE 50 >d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Score = 27.0 bits (59), Expect = 1.2 Identities = 5/47 (10%), Positives = 12/47 (25%), Gaps = 2/47 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVN 189 + + + FG P A+ P + + + Sbjct: 9 IFNEMMSR--QNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQG 53 >d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Score = 26.4 bits (57), Expect = 1.6 Identities = 9/45 (20%), Positives = 12/45 (26%), Gaps = 2/45 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFV 187 L+ L D H FG P D + + D Sbjct: 8 YLLDRLTD--CGADHLFGVPGDYNLQFLDHVIDSPDICWVGCANE 50 >d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Score = 26.3 bits (57), Expect = 1.7 Identities = 7/41 (17%), Positives = 10/41 (24%), Gaps = 2/41 (4%) Query: 143 ALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFT 183 L L +KH F D + L + Sbjct: 7 YLAERLVQ--IGLKHHFAVAGDYNLVLLDNLLLNKNMEQVY 45 >d2g39a2 c.124.1.2 (A:224-497) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Length = 274 Score = 25.2 bits (55), Expect = 3.8 Identities = 10/36 (27%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 137 IFHSRY--ALIRYLEDFYKEIKHTFGNPADALSPHI 170 H Y L+ Y E + HT +AL+ H+ Sbjct: 228 CVHPSYQAPLLDYFEAACAKGGHTPHLLREALAWHL 263 >d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum [TaxId: 1050]} Length = 201 Score = 25.2 bits (55), Expect = 4.4 Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Query: 95 KFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLE 149 K P+ VA + + + +V + DV IRYLE Sbjct: 74 KIVPMRVA---KEFSIAEGDPDPRGMTVVGLDGEVAGTVSDVWVDRSEPQIRYLE 125 >d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Length = 346 Score = 25.0 bits (55), Expect = 4.6 Identities = 7/34 (20%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Query: 147 YLEDFYKEIKHTFGNPADALSPHISELADEIHTT 180 ++E+ YKE ++ + ++ EI T Sbjct: 9 FIENMYKECH----YETQIINKRLHDIELEIKET 38 >d2ffja1 e.50.1.1 (A:7-288) Hypothetical protein AF1104 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 282 Score = 24.5 bits (53), Expect = 6.3 Identities = 17/73 (23%), Positives = 30/73 (41%) Query: 105 VSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPAD 164 ++L+ +++ LK NYS + + H R I +ED Y E+K A Sbjct: 18 DDEDLISQCVDESLKILAENYSSRPINAHLATRIHRRVYEILGVEDPYAEVKARANEVAR 77 Query: 165 ALSPHISELADEI 177 + P E+ + Sbjct: 78 QVLPLAKEIVEGS 90 >d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 Score = 24.5 bits (53), Expect = 6.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 164 DALSPHISELADEIH 178 DAL+P IS+ E H Sbjct: 13 DALAPVISKETVEFH 27 >d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 84 Score = 23.8 bits (51), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 164 DALSPHISELADEIH 178 AL PHIS +E+H Sbjct: 13 GALEPHISGQINELH 27 >d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 86 Score = 23.8 bits (51), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 164 DALSPHISELADEIH 178 AL P+IS E+H Sbjct: 13 SALEPYISGEIMELH 27 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0689 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 775,340 Number of extensions: 37266 Number of successful extensions: 156 Number of sequences better than 10.0: 1 Number of HSP's gapped: 156 Number of HSP's successfully gapped: 37 Length of query: 200 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 119 Effective length of database: 1,295,466 Effective search space: 154160454 Effective search space used: 154160454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)