BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781219|ref|YP_003065632.1| hypothetical protein CLIBASIA_05630 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781219|ref|YP_003065632.1| hypothetical protein CLIBASIA_05630 [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 410 bits (1053), Expect = e-116, Method: Compositional matrix adjust. Identities = 200/200 (100%), Positives = 200/200 (100%) Query: 1 MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGL 60 MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGL Sbjct: 1 MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGL 60 Query: 61 KTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKK 120 KTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKK Sbjct: 61 KTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKK 120 Query: 121 SVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTT 180 SVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTT Sbjct: 121 SVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTT 180 Query: 181 CFTLQFVVNPSEAELLEKVA 200 CFTLQFVVNPSEAELLEKVA Sbjct: 181 CFTLQFVVNPSEAELLEKVA 200 >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 23.9 bits (50), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 19/46 (41%), Gaps = 11/46 (23%) Query: 55 AKENGLKTVTEVCPK-----------PKDITYSLSHFIEGLIESER 89 A NGLK+++E C K P D + + H + ER Sbjct: 110 AGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPER 155 >gi|254781079|ref|YP_003065492.1| diguanylate cyclase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 23.9 bits (50), Expect = 2.2, Method: Compositional matrix adjust. Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 17/104 (16%) Query: 99 LAVAKVVSDELLHDKLNKILKKSVRNYSRDS---------GHLNRDVIFHS------RYA 143 L + + LL ILK+ +Y+R S G LN S + + Sbjct: 71 LVIISITISLLLGYISGSILKELFISYNRISQLSRIDCLSGLLNHSAFISSLGSYNEKLS 130 Query: 144 LIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFV 187 ++ + D++K+I FG+P I+ L+D++ T FV Sbjct: 131 IVFFDIDYFKQINDNFGHPVG--DKVIAFLSDQLVVVFGTPMFV 172 >gi|254780627|ref|YP_003065040.1| chromosomal replication initiation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 23.5 bits (49), Expect = 2.7, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 59 GLKTVTEVCPKPKDITYSLSHFIEGLIESERSKIT 93 G +T++ V P D + S FIEG S R +T Sbjct: 146 GKQTISPVFGSPLDSRFVFSTFIEG--SSNRVALT 178 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 22.3 bits (46), Expect = 5.7, Method: Compositional matrix adjust. Identities = 9/38 (23%), Positives = 21/38 (55%) Query: 73 ITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELL 110 + +L+H + +++ ER+K+ ++ + L V S L Sbjct: 199 VDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCL 236 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 21.6 bits (44), Expect = 9.7, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Query: 22 DKWCEALYS----PESYSNTYREQKLRDKI 47 D CE S P+S++NTY++ + ++ I Sbjct: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEII 573 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.135 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 131,432 Number of Sequences: 1233 Number of extensions: 5281 Number of successful extensions: 25 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 13 length of query: 200 length of database: 328,796 effective HSP length: 70 effective length of query: 130 effective length of database: 242,486 effective search space: 31523180 effective search space used: 31523180 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)