RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] (130 letters) >gnl|CDD|73367 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl) thiazole phosphate to yield thiamine phosphate. TenI is a enzymatically inactive regulatory protein involved in the regulation of several extracellular enzymes. This superfamily also contains other enzymatically inactive proteins with unknown functions.. Length = 196 Score = 31.7 bits (72), Expect = 0.060 Identities = 12/59 (20%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Query: 28 IEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRL 86 I +++E +E ALK L+ R++ + +L+E + L + + L Sbjct: 4 ITDRRLDGEDLLEVVEAALKGGVTLVQLREKDLSA---RELLELARALRELCRKYGVPL 59 >gnl|CDD|145623 pfam02581, TMP-TENI, Thiamine monophosphate synthase/TENI. Thiamine monophosphate synthase (TMP) (EC:2.5.1.3) catalyses the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl)thiazole phosphate to yield thiamine phosphate. This Pfam family also includes the regulatory protein TENI. Length = 180 Score = 29.4 bits (67), Expect = 0.30 Identities = 11/50 (22%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 37 EVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRL 86 +++E +E ALK ++ R++ + +L+E R+ L + + L Sbjct: 13 DLLEVVEEALKGGVTIVQLREKDLDD---RELLELAERLRALCRKYGVPL 59 >gnl|CDD|30402 COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]. Length = 304 Score = 29.4 bits (66), Expect = 0.31 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Query: 18 FLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIV 77 F +VN M + ++E I + ++ K + R R + I D+ EV+ + Sbjct: 200 FKESVNELMDAALDPE-DLEKIRAIILSVPGVKGVHDLRTRKSGSRIFIDVHIEVDPDLS 258 Query: 78 LAKAHK--RRLELKI 90 L +AH+ +E +I Sbjct: 259 LEEAHEIADEVEKRI 273 >gnl|CDD|30701 COG0352, ThiE, Thiamine monophosphate synthase [Coenzyme metabolism]. Length = 211 Score = 28.3 bits (63), Expect = 0.66 Identities = 14/69 (20%), Positives = 28/69 (40%), Gaps = 7/69 (10%) Query: 18 FLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIV 77 L V R I V+++E +E ALK + R++ + E+ + ++ Sbjct: 7 RLYLVTDRPLIYDG----VDLLEWVEAALKGGVTAVQLREKDLSD---EEYLALAEKLRA 59 Query: 78 LAKAHKRRL 86 L + + L Sbjct: 60 LCQKYGVPL 68 >gnl|CDD|144653 pfam01138, RNase_PH, 3' exoribonuclease family, domain 1. This family includes 3'-5' exoribonucleases. Ribonuclease PH contains a single copy of this domain, and removes nucleotide residues following the -CCA terminus of tRNA. Polyribonucleotide nucleotidyltransferase (PNPase) contains two tandem copies of the domain. PNPase is involved in mRNA degradation in a 3'-5' direction. The exosome is a 3'-5' exoribonuclease complex that is required for 3' processing of the 5.8S rRNA. Three of its five protein components contain a copy of this domain. A hypothetical protein from S. pombe appears to belong to an uncharacterized subfamily. This subfamily is found in both eukaryotes and archaebacteria. Length = 128 Score = 27.5 bits (62), Expect = 1.1 Identities = 15/60 (25%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Query: 10 EEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIR--THILED 67 E+ YE + S E+E+ ++RAL+ S L + IR +L D Sbjct: 47 GELTVEYEEKPFASGERPEGRPSEREIELSRLIDRALRPSFPLEGYPRWEIRIDITVLSD 106 >gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 26.7 bits (59), Expect = 1.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 60 IRTHILEDLIEEVNRIIVLAKAH 82 + THI+ED+ N++ VL K Sbjct: 184 LSTHIVEDVESLCNQVAVLNKGK 206 >gnl|CDD|144351 pfam00718, Polyoma_coat, Polyomavirus coat protein. Length = 296 Score = 26.6 bits (59), Expect = 1.9 Identities = 11/24 (45%), Positives = 12/24 (50%), Gaps = 6/24 (25%) Query: 11 EIEANYEFLSAVNPRMGIEPESNY 34 EIEA +L NPRMG Y Sbjct: 21 EIEA---YL---NPRMGQPDPEQY 38 >gnl|CDD|30058 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology). But L-HYDs differ by having an L-enantio specificity and by lacking activity on possible natural substrates such as dihydropyrimidines. Allantoinase catalyzes the hydrolytic cleavage of the five-member ring of allantoin (5-ureidohydantoin) to form allantoic acid.. Length = 447 Score = 26.4 bits (58), Expect = 2.7 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Query: 69 IEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEARED-----CEGC 110 +E + RI++LAK RL + E L+ EAR + E C Sbjct: 216 VEAIQRILLLAKETGCRLHIVHLSSAEAVPLIREARAEGVDVTVETC 262 >gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 173 Score = 26.1 bits (58), Expect = 3.0 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Query: 24 PRMGIEPESNYEV-EVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAH 82 P G++PES E E++ +L++ KT + +HILE+ +R+ +L Sbjct: 122 PTSGLDPESRREFWELLRELKKEGKTI---------LLSSHILEEAERLCDRVAILNNGR 172 >gnl|CDD|114218 pfam05482, Serendipity_A, Serendipity locus alpha protein (SRY-A). The Drosophila serendipity alpha (sry alpha) gene is specifically transcribed at the blastoderm stage, from nuclear cycle 11 to the onset of gastrulation, in all somatic nuclei. SRY-A is required for the cellularisation of the embryo and is involved in the localisation of the actin filaments just prior to and during plasma membrane invagination. Length = 549 Score = 25.6 bits (56), Expect = 4.5 Identities = 18/71 (25%), Positives = 25/71 (35%), Gaps = 11/71 (15%) Query: 18 FLSAVNPRMGIEPESNYEVEVI-----------EKLERALKTSKKLIHFRDRTIRTHILE 66 L V PR E N +VE I +LER + L R H L+ Sbjct: 46 HLPEVAPRWEAEGGINIDVETIFLCLTQVVTCITQLERTINIEGTLAAGATPMTRLHFLD 105 Query: 67 DLIEEVNRIIV 77 + + R+ V Sbjct: 106 RIDWCLRRLQV 116 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 25.5 bits (56), Expect = 4.8 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Query: 21 AVNPRMGI--EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRII 76 A++P + + EP + + +L LK K +TI TH L+ L+E +R+I Sbjct: 150 AMDPDILLLDEPTAGLDPAGRRELLELLKKLKA----EGKTIIIVTHDLDLLLELADRVI 205 Query: 77 VLAKAH 82 VL Sbjct: 206 VLEDGK 211 >gnl|CDD|36487 KOG1273, KOG1273, KOG1273, WD40 repeat protein [General function prediction only]. Length = 405 Score = 25.3 bits (55), Expect = 5.3 Identities = 11/36 (30%), Positives = 22/36 (61%) Query: 36 VEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEE 71 V+ I+++ + K +I+ DR IRT+ + D+ +E Sbjct: 196 VQAIKQIIVSRKGRFLIINTSDRVIRTYEISDIDDE 231 >gnl|CDD|31761 COG1573, COG1573, Uracil-DNA glycosylase [DNA replication, recombination, and repair]. Length = 202 Score = 25.0 bits (54), Expect = 6.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Query: 95 EVWRLLDEAREDCEGCENCSEHPDQEH 121 E LL+E RE+ E C C D+ Sbjct: 5 EAAELLEELREEIEACRRCPLLKDRTP 31 >gnl|CDD|37251 KOG2040, KOG2040, KOG2040, Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism]. Length = 1001 Score = 24.9 bits (54), Expect = 6.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 77 VLAKAHKRRLELKIFEDNEVWRLLDE 102 VL +A KR++ L++ ED + LDE Sbjct: 438 VLDRAAKRQINLRLVEDGTIGVSLDE 463 >gnl|CDD|63887 cd03556, L-fucose_isomerase, L-fucose isomerase (FucIase); FucIase converts L-fucose, an aldohexose, to its ketose form, which prepares it for aldol cleavage (similar to the isomerization of glucose during glycolysis). L-fucose (or 6-deoxy-L-galactose) is found in blood group determinants as well as in various oligo- and polysaccharides, and glycosides in mammals, bacteria and plants.. Length = 584 Score = 25.0 bits (54), Expect = 6.2 Identities = 12/41 (29%), Positives = 25/41 (60%) Query: 84 RRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKED 124 RR++ +I++ E + L +E+C+ E+ +E DQ+ +E Sbjct: 209 RRMDEEIYDPEEYEKALAWTKENCKEGEDENEKNDQKKREQ 249 >gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]. Length = 245 Score = 24.9 bits (54), Expect = 6.8 Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 8/58 (13%) Query: 29 EPESNYEVEVIEKLE---RALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHK 83 EP S ++ K + LK + + F +HI++++ +R+IVL K Sbjct: 159 EPTSGLDIRTRRKFHDFIKQLKNEGRAVIFS-----SHIMQEVEALCDRVIVLHKGEV 211 >gnl|CDD|36198 KOG0980, KOG0980, KOG0980, Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]. Length = 980 Score = 25.0 bits (54), Expect = 7.1 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 65 LEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCE 108 LE+L EE R I + LE E E R E RE+ E Sbjct: 349 LENLKEEARRRIEQYENQLLALEG---ELQEQQREAQENREEQE 389 >gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]. Length = 293 Score = 24.5 bits (53), Expect = 8.2 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 9/59 (15%) Query: 23 NPRMGIEPESNYEV-EVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAK 80 P G++PES E+ E++ +L + + L THILE+ E +R+I+L Sbjct: 162 EPTSGLDPESRREIWELLRELAKEGGVTILLS--------THILEEAEELCDRVIILND 212 >gnl|CDD|33811 COG4053, COG4053, Uncharacterized protein conserved in archaea [Function unknown]. Length = 244 Score = 24.6 bits (53), Expect = 8.8 Identities = 26/100 (26%), Positives = 39/100 (39%), Gaps = 29/100 (29%) Query: 37 EVIEKLERALKT--SKKLIHF-------RDRTIRTHILEDLIEEVNRIIVLAKAHKRRLE 87 ++ E +E+ +K SK I D I + + E+L+E+VN+ I Sbjct: 23 KLNELVEKEIKKLLSKLGIKATLSNITGDDIVITSFVEENLLEKVNKAIF---------- 72 Query: 88 LKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYA 127 EV R E +D G SE PD + YA Sbjct: 73 -------EVLRKYAEGFDDLRG---ISEDPDGAGEGLSYA 102 >gnl|CDD|73385 cd04723, HisA_HisF, Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF). The ProFAR isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''- phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene. The Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4- carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.. Length = 233 Score = 24.4 bits (53), Expect = 9.8 Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 59 TIRTHILEDLIEEVNRI-IVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGC 110 T+ + ED + + +VL+ + LK + LL + E Sbjct: 110 TLPSDDDEDRLAALGEQRLVLSLDFRGGQLLKPTDFIGPEELLRRLAKWPEEL 162 >gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus. Length = 379 Score = 24.1 bits (53), Expect = 9.9 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 46 LKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKI 90 K+ ++L + +I D +E+ RI+ +AK R ++ I Sbjct: 87 YKSKEELEKALEEGALINI--DSFDELERILEIAKELGRVAKVGI 129 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0594 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,641,620 Number of extensions: 81325 Number of successful extensions: 343 Number of sequences better than 10.0: 1 Number of HSP's gapped: 342 Number of HSP's successfully gapped: 63 Length of query: 130 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 47 Effective length of database: 4,470,190 Effective search space: 210098930 Effective search space used: 210098930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.1 bits)