RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781220|ref|YP_003065633.1| hypothetical protein
CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62]
         (130 letters)



>gnl|CDD|181607 PRK08999, PRK08999, hypothetical protein; Provisional.
          Length = 312

 Score = 37.2 bits (87), Expect = 0.001
 Identities = 18/80 (22%), Positives = 26/80 (32%), Gaps = 6/80 (7%)

Query: 13  EANYEFLSAVN--PRMGIEPESNYEVEV-IEKLERALKTSKKLIHFRDRTIRTHILEDLI 69
            AN   + A+       I PE        + +LERAL    +LI  R   +       L 
Sbjct: 118 PANQPIVRALRLPDTYLITPEGEDGDAAFLARLERALAAGIRLIQLRAPQLPPAAYRALA 177

Query: 70  EEVNRIIVLAKAHKRRLELK 89
                   L +    +L L 
Sbjct: 178 RAALG---LCRRAGAQLLLN 194


>gnl|CDD|178239 PLN02632, PLN02632, phytoene synthase.
          Length = 334

 Score = 27.4 bits (61), Expect = 1.1
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 9/51 (17%)

Query: 24  PRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNR 74
           P MGI PES    E +     AL  + +L         T+IL D+ E+  R
Sbjct: 181 PVMGIAPESKASTESVYNAALALGIANQL---------TNILRDVGEDARR 222


>gnl|CDD|162307 TIGR01341, aconitase_1, aconitate hydratase 1.  This model
           represents one form of the TCA cycle enzyme aconitate
           hydratase, also known as aconitase and citrate
           hydro-lyase. It is found in bacteria, archaea, and
           eukaryotic cytosol. It has been shown to act also as an
           iron-responsive element binding protein in animals and
           may have the same role in other eukaryotes.
          Length = 876

 Score = 26.7 bits (59), Expect = 1.9
 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 4/40 (10%)

Query: 70  EEVNRII---VLAKAHKRRLELKIFEDNEVWRLLDEARED 106
           +E+   +   V  +  K+  E  IFE NE W  +     D
Sbjct: 577 KEIAAYVNMAVKPEMFKKEYE-NIFEGNERWNSIKTPSGD 615


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 25.9 bits (56), Expect = 3.3
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 54  HFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCE 108
           H+  R  + H     IE+ N       AH++ LE+KI E   + RL  E RE  E
Sbjct: 425 HYGGRVDKDHAERARIEKEN-------AHRKALEMKILEKKRIERLEREERERLE 472


>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit;
           Provisional.
          Length = 288

 Score = 25.8 bits (56), Expect = 3.6
 Identities = 17/82 (20%), Positives = 43/82 (52%), Gaps = 9/82 (10%)

Query: 2   GQLKQYYLEEIEA-NYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTI 60
           GQ+++  +  I A   E L    P  G++P++   +E+++  E   ++ + ++      +
Sbjct: 148 GQMRRVAIAGILAMEPEVLVLDEPTAGLDPKA--RIEMMQLFESIHQSGQTVV------L 199

Query: 61  RTHILEDLIEEVNRIIVLAKAH 82
            TH+++D+ +  + + +L K H
Sbjct: 200 VTHLMDDVADYADYVYLLEKGH 221


>gnl|CDD|178133 PLN02518, PLN02518, pheophorbide a oxygenase.
          Length = 539

 Score = 25.6 bits (56), Expect = 4.0
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 22/85 (25%)

Query: 34  YEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFED 93
           Y V ++E L+ ++ T  +L+                    R +VL K   +  E   F+D
Sbjct: 92  YPVSLVEDLDPSVPTPFQLL-------------------GRDLVLWKDPNQG-EWVAFDD 131

Query: 94  NEVWRL--LDEAREDCEGCENCSEH 116
               RL  L E R D  G   CS H
Sbjct: 132 KCPHRLAPLSEGRIDENGHLQCSYH 156


>gnl|CDD|131231 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flavodoxin)
           oxidoreductase, homodimeric.  This model represents a
           single chain form of pyruvate:ferredoxin (or flavodoxin)
           oxidoreductase. This enzyme may transfer electrons to
           nitrogenase in nitrogen-fixing species. Portions of this
           protein are homologous to gamma subunit of the four
           subunit pyruvate:ferredoxin (flavodoxin) oxidoreductase.
          Length = 1165

 Score = 25.1 bits (55), Expect = 5.3
 Identities = 9/30 (30%), Positives = 11/30 (36%), Gaps = 11/30 (36%)

Query: 105 EDCEGCENCSE-----------HPDQEHKE 123
            DC GC NC +            P  E +E
Sbjct: 739 LDCTGCGNCVDICPAKEKALVMQPLAEQRE 768


>gnl|CDD|182885 PRK10991, fucI, L-fucose isomerase; Provisional.
          Length = 588

 Score = 25.0 bits (55), Expect = 6.1
 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 83  KRRLELKIFEDNEVWRLLDEAREDC-EGCENCSEH 116
           +RR++ KI+++ E+   L  A+++C EG +  +E 
Sbjct: 212 RRRIDQKIYDEEELEMALAWAKKNCKEGEDENAEQ 246


>gnl|CDD|179078 PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta;
           Reviewed.
          Length = 791

 Score = 24.8 bits (55), Expect = 6.2
 Identities = 9/14 (64%), Positives = 10/14 (71%)

Query: 63  HILEDLIEEVNRII 76
            I EDL+EEV RI 
Sbjct: 454 EIEEDLVEEVARIY 467


>gnl|CDD|184220 PRK13663, PRK13663, hypothetical protein; Provisional.
          Length = 493

 Score = 24.8 bits (55), Expect = 6.4
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 65  LEDLIEEVNRIIVLAKAH----KRRLELKIFEDNEVWRLLDEARE 105
           L++L ++V  +I +        K R +L I  D +V RL+D+ RE
Sbjct: 59  LQELKDQVEIVIAINANDIERNKIRGDLGITYDQDVLRLIDDFRE 103


>gnl|CDD|149448 pfam08388, GIIM, Group II intron, maturase-specific domain.  This
          region is found mainly in various bacterial and
          archaeal species, but a few members of this family are
          expressed by fungal and chlamydomonal species. It has
          been implicated in the binding of intron RNA during
          reverse transcription and splicing.
          Length = 80

 Score = 24.8 bits (55), Expect = 6.6
 Identities = 9/24 (37%), Positives = 16/24 (66%), Gaps = 3/24 (12%)

Query: 56 RDRTIRTHI---LEDLIEEVNRII 76
          R+ T R++     E+LI+++N II
Sbjct: 9  RELTRRSNKGLSQEELIKKLNPII 32


>gnl|CDD|184800 PRK14714, PRK14714, DNA polymerase II large subunit; Provisional.
          Length = 1337

 Score = 24.7 bits (54), Expect = 7.7
 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 5/35 (14%)

Query: 40   EKLERALKTSKKL-----IHFRDRTIRTHILEDLI 69
            +K++  L+ ++K+         +R I  H + DLI
Sbjct: 1209 DKMDAQLELARKIRAVDEHDVAERVINYHFIPDLI 1243


>gnl|CDD|178562 PLN02981, PLN02981, glucosamine:fructose-6-phosphate
           aminotransferase.
          Length = 680

 Score = 24.3 bits (53), Expect = 8.4
 Identities = 14/31 (45%), Positives = 16/31 (51%)

Query: 12  IEANYEFLSAVNPRMGIEPESNYEVEVIEKL 42
           I  NYE L     R G   ES+ + EVI KL
Sbjct: 124 IITNYEVLKETLLRHGFTFESDTDTEVIPKL 154


>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
           ligase; Reviewed.
          Length = 453

 Score = 24.2 bits (53), Expect = 9.0
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 54  HFRDRTIRTHILEDLIEEVNRIIVLAK 80
           HF D+T     L+ L+ E   I +L K
Sbjct: 407 HFADKTALIARLKALLAEHQVITILVK 433


>gnl|CDD|178849 PRK00082, hrcA, heat-inducible transcription repressor;
           Provisional.
          Length = 339

 Score = 24.4 bits (54), Expect = 9.1
 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 71  EVNRIIVLAKAHKRRLELKIFEDNEV-WRLLDEARED 106
           + N +  L+   + R  L + E+ +V  +LLDE+ E 
Sbjct: 238 KANLLNYLSDLERLRSLLDLLEEKQVLLQLLDESEEA 274


>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ.  The
           ATP-dependent DNA helicase RecQ of E. coli is about 600
           residues long. This model represents bacterial proteins
           with a high degree of similarity in domain architecture
           and in primary sequence to E. coli RecQ. The model
           excludes eukaryotic and archaeal proteins with RecQ-like
           regions, as well as more distantly related bacterial
           helicases related to RecQ.
          Length = 591

 Score = 24.3 bits (53), Expect = 9.7
 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 8/41 (19%)

Query: 79  AKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQ 119
            +  +R   L+ F +NEV        E C  C+NC + P  
Sbjct: 366 TQTCRRAYILRYFGENEV--------EPCGNCDNCLDPPKS 398


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0672    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 2,205,124
Number of extensions: 135179
Number of successful extensions: 384
Number of sequences better than 10.0: 1
Number of HSP's gapped: 383
Number of HSP's successfully gapped: 64
Length of query: 130
Length of database: 5,994,473
Length adjustment: 83
Effective length of query: 47
Effective length of database: 4,201,009
Effective search space: 197447423
Effective search space used: 197447423
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (23.5 bits)