Query         gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 68
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:43:09 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781221.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1tlha_ a.150.1.1 (A:) Anti-si  26.8      21  0.0015   15.2   3.6   42   17-58     38-79  (89)
  2 d1ijwc_ a.4.1.2 (C:) HIN recom  12.0      47  0.0034   13.3   2.1   18   23-40      2-19  (47)
  3 d1mxaa1 d.130.1.1 (A:1-102) S-   7.8      69   0.005   12.4   2.4   17   27-43     13-29  (102)
  4 d1zavu1 a.108.1.1 (U:1-30) Rib   7.2      74  0.0054   12.3   3.7   28   27-54      1-28  (30)
  5 d1l0ba2 c.15.1.3 (A:1705-1801)   6.7      46  0.0033   13.4  -0.1   21   11-31     23-43  (97)
  6 d1nexa1 a.157.1.1 (A:116-185)    5.7      86  0.0063   11.9   0.8   42    4-45     17-67  (70)
  7 d2p02a1 d.130.1.1 (A:38-147) S   5.1      98  0.0071   11.6   2.4   17   27-43     13-29  (110)
  8 d3cx5d2 f.23.11.1 (D:261-307)    4.8   1E+02  0.0076   11.5   1.5   17    1-17      9-25  (47)
  9 d1sgwa_ c.37.1.12 (A:) Putativ   4.5      67  0.0049   12.5  -0.4   22    4-25    132-153 (200)
 10 d1oxxk2 c.37.1.12 (K:1-242) Gl   4.0 1.1E+02  0.0077   11.4   0.3   23    4-26    147-169 (242)

No 1  
>d1tlha_ a.150.1.1 (A:) Anti-sigma factor AsiA {Bacteriophage T4 [TaxId: 10665]}
Probab=26.77  E-value=21  Score=15.24  Aligned_cols=42  Identities=31%  Similarity=0.464  Sum_probs=36.8

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             363236811188899999998652888999999998899999
Q gi|254781221|r   17 GCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEH   58 (68)
Q Consensus        17 gcgladepkklnpdqlcdavcrltleeqkelqtkvnqryeeh   58 (68)
                      --|+..+-+.+|.-..-.-+-|||-++.+++-...|+-||.-
T Consensus        38 E~G~r~~G~eft~~sFrqm~~~Lt~~er~elie~FneG~~di   79 (89)
T d1tlha_          38 EIGVTHEGRKLNQNSFRKIVSELTQEDKKTLIDEFNEGFEGV   79 (89)
T ss_dssp             HTTCEETTEECCHHHHHHHHHSSCHHHHHHHHHHCHHHHHHH
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             847885418888867999998789888999999997677899


No 2  
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}
Probab=11.96  E-value=47  Score=13.32  Aligned_cols=18  Identities=17%  Similarity=0.231  Sum_probs=14.0

Q ss_pred             CCCCCCHHHHHHHHHHHH
Q ss_conf             811188899999998652
Q gi|254781221|r   23 EPKKLNPDQLCDAVCRLT   40 (68)
Q Consensus        23 epkklnpdqlcdavcrlt   40 (68)
                      -|++|+++|+..|.-.+.
T Consensus         2 R~~~lt~~q~~~a~~l~~   19 (47)
T d1ijwc_           2 RPRAINKHEQEQISRLLE   19 (47)
T ss_dssp             CCCSSCHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             888599999999999998


No 3  
>d1mxaa1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
Probab=7.81  E-value=69  Score=12.44  Aligned_cols=17  Identities=24%  Similarity=0.526  Sum_probs=11.1

Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             88899999998652888
Q gi|254781221|r   27 LNPDQLCDAVCRLTLEE   43 (68)
Q Consensus        27 lnpdqlcdavcrltlee   43 (68)
                      -.||.+||.+----|.+
T Consensus        13 GHPDKicDqISDaIlD~   29 (102)
T d1mxaa1          13 GHPDKIADQISDAVLDA   29 (102)
T ss_dssp             TSHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             99747999888999999


No 4  
>d1zavu1 a.108.1.1 (U:1-30) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
Probab=7.17  E-value=74  Score=12.27  Aligned_cols=28  Identities=29%  Similarity=0.507  Sum_probs=21.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8889999999865288899999999889
Q gi|254781221|r   27 LNPDQLCDAVCRLTLEEQKELQTKVNQR   54 (68)
Q Consensus        27 lnpdqlcdavcrltleeqkelqtkvnqr   54 (68)
                      .|-+|...|.-.||..|-.||-.+....
T Consensus         1 m~~eeiv~aiekltvaelaelvk~ledk   28 (30)
T d1zavu1           1 MTIDEIIEAIEKLTVSELAELVKKLEDK   28 (30)
T ss_dssp             CCHHHHHHHHHHSBHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9799999999996199999999998766


No 5  
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=6.65  E-value=46  Score=13.38  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=16.9

Q ss_pred             HHHHHHCCCCCCCCCCCCHHH
Q ss_conf             999983363236811188899
Q gi|254781221|r   11 TLLSLCGCGLADEPKKLNPDQ   31 (68)
Q Consensus        11 tllslcgcgladepkklnpdq   31 (68)
                      -++.+||.....+|+-+..++
T Consensus        23 ~mv~lCGAsVvk~~~~l~~~~   43 (97)
T d1l0ba2          23 RMLQLCGASVVKELPLLTRDT   43 (97)
T ss_dssp             HHHHHTTCEEECSSSCGGGCC
T ss_pred             HHHHHCCCEEECCHHHCCCCC
T ss_conf             999981964346863448788


No 6  
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=5.67  E-value=86  Score=11.91  Aligned_cols=42  Identities=19%  Similarity=0.265  Sum_probs=24.5

Q ss_pred             HHHHHHHH------HHHHHCCCCCCCCCCCCHHHHHHHHH---HHHHHHHH
Q ss_conf             89999999------99983363236811188899999998---65288899
Q gi|254781221|r    4 KKVLIAST------LLSLCGCGLADEPKKLNPDQLCDAVC---RLTLEEQK   45 (68)
Q Consensus         4 kkvliast------llslcgcgladepkklnpdqlcdavc---rltleeqk   45 (68)
                      -.++.|+.      |+.+|-.-+|+--|.-.|.++.....   -.|.||..
T Consensus        17 ~~li~AAnyL~I~~Ll~l~c~~vA~~ikgkt~eeiR~~f~I~~D~t~eEe~   67 (70)
T d1nexa1          17 YEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEA   67 (70)
T ss_dssp             HHHHHHHHHHTCHHHHHHHHHHHHHHHTTCCHHHHHHHHTCCCCCCHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHH
T ss_conf             999999987095789999999999998259999999995999999988897


No 7  
>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
Probab=5.12  E-value=98  Score=11.61  Aligned_cols=17  Identities=29%  Similarity=0.741  Sum_probs=11.1

Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             88899999998652888
Q gi|254781221|r   27 LNPDQLCDAVCRLTLEE   43 (68)
Q Consensus        27 lnpdqlcdavcrltlee   43 (68)
                      =.||.+||.+----|.+
T Consensus        13 GHPDKicDqISDailD~   29 (110)
T d2p02a1          13 GHPDKICDQISDAVLDA   29 (110)
T ss_dssp             TSHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             99767999877599899


No 8  
>d3cx5d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=4.76  E-value=1e+02  Score=11.47  Aligned_cols=17  Identities=35%  Similarity=0.432  Sum_probs=11.1

Q ss_pred             CHHHHHHHHHHHHHHHC
Q ss_conf             91789999999999833
Q gi|254781221|r    1 MTIKKVLIASTLLSLCG   17 (68)
Q Consensus         1 mtikkvliastllslcg   17 (68)
                      |.+|-.+|.|.+..+++
T Consensus         9 mg~K~~~i~s~l~~~~~   25 (47)
T d3cx5d2           9 LGLKTVIILSSLYLLSI   25 (47)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             89899999999999999


No 9  
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}
Probab=4.51  E-value=67  Score=12.48  Aligned_cols=22  Identities=36%  Similarity=0.450  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             8999999999983363236811
Q gi|254781221|r    4 KKVLIASTLLSLCGCGLADEPK   25 (68)
Q Consensus         4 kkvliastllslcgcgladepk   25 (68)
                      ++|.||..+++-.-.=+.|||-
T Consensus       132 qrv~ia~al~~~~~llllDEPt  153 (200)
T d1sgwa_         132 RRVQLASTLLVNAEIYVLDDPV  153 (200)
T ss_dssp             HHHHHHHHTTSCCSEEEEESTT
T ss_pred             HHHHHHHHHHCCCCEEEECCCC
T ss_conf             8899999886499899986862


No 10 
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=4.03  E-value=1.1e+02  Score=11.42  Aligned_cols=23  Identities=30%  Similarity=0.303  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             89999999999833632368111
Q gi|254781221|r    4 KKVLIASTLLSLCGCGLADEPKK   26 (68)
Q Consensus         4 kkvliastllslcgcgladepkk   26 (68)
                      .+|-||..|..-...=++|||--
T Consensus       147 QRvaiARaL~~~P~llllDEPt~  169 (242)
T d1oxxk2         147 QRVALARALVKDPSLLLLDEPFS  169 (242)
T ss_dssp             HHHHHHHHHTTCCSEEEEESTTT
T ss_pred             HHHHHHHHHHHCCCCEEECCCCC
T ss_conf             58998757760466145447866


Done!