BLAST/PSIBLAST alignment of GI: 254781221 and GI: 315122558 at iteration 1
>gi|315122558|ref|YP_004063047.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71
>gi|313495960|gb|ADR52559.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71
 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 58/71 (81%), Gaps = 3/71 (4%)

Query: 1  MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57
          M  K  LIASTL++   L GC LADEPKKLNPDQ+CDA+C LT ++Q+ELQ+KV+++YEE
Sbjct: 1  MKTKTFLIASTLITSGLLAGCDLADEPKKLNPDQICDAICNLTTKQQEELQSKVDKKYEE 60

Query: 58 HLTKGAKLSSD 68
          HL  GAK+SSD
Sbjct: 61 HLKTGAKISSD 71