RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|36653 KOG1440, KOG1440, KOG1440, CDP-diacylglycerol synthase [Lipid transport and metabolism]. Length = 432 Score = 29.1 bits (65), Expect = 0.29 Identities = 9/33 (27%), Positives = 14/33 (42%) Query: 28 NPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 +L D + LT E+Q L K+ +R Sbjct: 400 GVSKLLDQILTLTPEQQLNLFEKLQRRLSSKGK 432 >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.. Length = 401 Score = 28.1 bits (63), Expect = 0.58 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 17 GCGLADEPKKLNPDQLCDAVCRLT 40 G G A +P++L ++L A+ RL Sbjct: 347 GAGPALDPRELTAERLAAALRRLL 370 >gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.. Length = 377 Score = 25.8 bits (57), Expect = 2.5 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 28 NPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 +P+ L +A+ RL + L +R E + Sbjct: 330 DPEALAEAILRLLADPWLRLGRAARRRVAERFS 362 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.131 0.371 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 710,236 Number of extensions: 25816 Number of successful extensions: 53 Number of sequences better than 10.0: 1 Number of HSP's gapped: 53 Number of HSP's successfully gapped: 6 Length of query: 68 Length of database: 6,263,737 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,420,986 Effective search space: 157208594 Effective search space used: 157208594 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.4 bits)