RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|183180 PRK11530, PRK11530, hypothetical protein; Provisional. Length = 183 Score = 27.7 bits (62), Expect = 0.62 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 9/70 (12%) Query: 1 MTI--KKVLIASTLLSLCGCGLADEPKKLNPD--QLCDAVCRLTLEEQK-ELQTKVNQRY 55 MT ++L+ +LL L GC E ++++ L + +LT + E Q ++N Sbjct: 1 MTTRYLRLLLLGSLLLLAGCAQQSEVRQMHNSVSTLNQEMTQLTQQAVAIEQQNRLNA-- 58 Query: 56 EEHLTKGAKL 65 + T G L Sbjct: 59 --NSTSGVYL 66 >gnl|CDD|184628 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 437 Score = 26.7 bits (59), Expect = 1.5 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Query: 21 ADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYE 56 A + + + RL LE QKE+ K YE Sbjct: 343 AYMEGQEPDEVKTKRMNRL-LELQKEITFKKALSYE 377 >gnl|CDD|182941 PRK11067, PRK11067, outer membrane protein assembly factor YaeT; Provisional. Length = 803 Score = 26.2 bits (58), Expect = 1.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 1 MTIKKVLIASTLLS 14 M +KK+LIAS L S Sbjct: 1 MAMKKLLIASLLFS 14 >gnl|CDD|183320 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional. Length = 307 Score = 25.1 bits (56), Expect = 3.9 Identities = 8/35 (22%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Query: 27 LNPDQLCDAV--CRLTLEEQKELQTKVNQRYEEHL 59 L D + RLT E+ + + +R E + Sbjct: 55 LPLDIP-EPFLDARLTPSEKARILELIERRINERI 88 >gnl|CDD|151756 pfam11315, Med30, Mediator complex subunit 30. Med30 is a metazoan-specific subunit of Mediator, having no homologues in yeasts. Length = 150 Score = 25.2 bits (55), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 20 LADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 EP+ LC A + L+E++EL KV Q+ ++ Sbjct: 89 YVGEPESAKETSLCSAELKKVLQERRELIEKVKQKNQQ 126 >gnl|CDD|179310 PRK01622, PRK01622, OxaA-like protein precursor; Validated. Length = 256 Score = 24.7 bits (54), Expect = 5.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 41 LEEQKELQTKVNQRYEEH 58 LE+QKE Q ++ + Y+ Sbjct: 113 LEKQKEYQKEMMELYKSG 130 >gnl|CDD|150410 pfam09731, Mitofilin, Mitochondrial inner membrane protein. Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence rich in positive-charged and hydroxylated residues and a membrane anchor domain. In addition, it has three centrally located coiled coil domains. Length = 561 Score = 24.3 bits (53), Expect = 6.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 30 DQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAKLSS 67 DQL + L EE++EL+ + ++ EE L+K + Sbjct: 241 DQLSKKLAELKAEEEEELERALKEKREELLSKLEEELL 278 >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase. Length = 215 Score = 24.1 bits (52), Expect = 7.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 41 LEEQKELQTKVNQRYEEHLTKGAKLSSD 68 ++E +E KV YE L+K L+ D Sbjct: 132 IKESEEKLAKVLDVYEARLSKSKYLAGD 159 >gnl|CDD|149496 pfam08457, Sfi1, Sfi1 spindle body protein. This is a family of fungal spindle pole body proteins that play a role in spindle body duplication. They contain binding sites for calmodulin-like proteins called centrins which are present in microtubule-organising centres. Length = 576 Score = 24.3 bits (53), Expect = 8.0 Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 38 RLTLEEQKELQTKVNQRYEEHLTKGA 63 + +E KEL+ + Q +EE L + + Sbjct: 94 KAKAKEIKELEQRAVQFHEEKLIRRS 119 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.131 0.371 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 978,991 Number of extensions: 43697 Number of successful extensions: 111 Number of sequences better than 10.0: 1 Number of HSP's gapped: 111 Number of HSP's successfully gapped: 18 Length of query: 68 Length of database: 5,994,473 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,151,761 Effective search space: 149401069 Effective search space used: 149401069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.2 bits)