RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >2w5v_A Alkaline phosphatase; psychrophiles, cold adaptation, hydrolase; HET: SEP; 1.78A {Antarctic bacterium TAB5} PDB: 2w5w_A* 2w5x_A* 2iuc_A 2iuc_B Length = 375 Score = 29.4 bits (64), Expect = 0.23 Identities = 8/31 (25%), Positives = 11/31 (35%) Query: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQ 31 M +KK++ L L C K P Sbjct: 1 MKLKKIVFTLIALGLFSCKTTSVLVKNEPQL 31 >1rrv_A Glycosyltransferase GTFD; GT-B, rossmann fold; HET: DVV TYD; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Score = 28.1 bits (61), Expect = 0.48 Identities = 6/30 (20%), Positives = 12/30 (40%) Query: 17 GCGLADEPKKLNPDQLCDAVCRLTLEEQKE 46 G G+A + + L A+ + E + Sbjct: 345 GIGVAHDGPTPTFESLSAALTTVLAPETRA 374 >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} Length = 446 Score = 27.8 bits (62), Expect = 0.64 Identities = 6/9 (66%), Positives = 7/9 (77%) Query: 1 MTIKKVLIA 9 M IK +LIA Sbjct: 4 MEIKSILIA 12 >3iaa_A CALG2; glycosyltransferase, calicheamicin, TDP, enediyne, TR; HET: TYD; 2.50A {Micromonospora echinospora} Length = 416 Score = 26.7 bits (58), Expect = 1.2 Identities = 7/23 (30%), Positives = 10/23 (43%) Query: 17 GCGLADEPKKLNPDQLCDAVCRL 39 G G +K + D L AV + Sbjct: 356 GLGAVLPGEKADGDTLLAAVGAV 378 >2p6p_A Glycosyl transferase; GT-B family, X-RAY-diffraction,urdamycina- biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Score = 26.7 bits (57), Expect = 1.3 Identities = 5/23 (21%), Positives = 11/23 (47%) Query: 17 GCGLADEPKKLNPDQLCDAVCRL 39 G +A P + + + + D+ L Sbjct: 322 GAAIALLPGEDSTEAIADSCQEL 344 >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Score = 26.4 bits (57), Expect = 1.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 17 GCGLADEPKKLNPDQLCDAVCRL 39 G G P +L P + +AV RL Sbjct: 341 GLGSVLRPDQLEPASIREAVERL 363 >3h74_A Pyridoxal kinase; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Length = 282 Score = 25.9 bits (56), Expect = 2.0 Identities = 7/25 (28%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Query: 1 MTIKKVLIASTLLSLCGCGL-ADEP 24 M++ +L+A L ++ G L + P Sbjct: 1 MSLSTMLVAEDLSAVGGISLSSALP 25 >2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Score = 25.6 bits (54), Expect = 2.6 Identities = 5/21 (23%), Positives = 9/21 (42%) Query: 1 MTIKKVLIASTLLSLCGCGLA 21 M +K L+ + +L C Sbjct: 1 MVFRKSLLKLAVFALGACVAF 21 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.131 0.371 Gapped Lambda K H 0.267 0.0673 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 511,571 Number of extensions: 16864 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 14 Length of query: 68 Length of database: 5,693,230 Length adjustment: 38 Effective length of query: 30 Effective length of database: 4,771,958 Effective search space: 143158740 Effective search space used: 143158740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.2 bits)