BLAST/BLAST alignment of GI: 254781221 and GI: 254781180
>gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71
 Score = 28.5 bits (62), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 22 DEPKKLNPDQLCDAVCRLTLEEQKELQTKV 51
          +EP+K+  DQ+ +A+  L  EE+++LQ ++
Sbjct: 23 EEPQKVTVDQINNAIASLIPEERRDLQDRM 52