Query gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 70 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 07:43:36 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781222.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam07051 OCIA Ovarian carcino 63.3 5.8 0.00015 21.0 2.3 23 29-51 19-41 (111) 2 KOG3811 consensus 36.9 15 0.00038 18.9 0.9 27 30-56 218-247 (434) 3 KOG1517 consensus 35.3 23 0.00059 17.9 1.7 14 42-55 480-493 (1387) 4 pfam03299 TF_AP-2 Transcriptio 26.1 25 0.00063 17.7 0.6 27 30-56 15-44 (207) 5 COG5119 Uncharacterized protei 21.6 25 0.00064 17.7 -0.1 12 43-54 77-88 (119) 6 KOG3388 consensus 19.0 26 0.00067 17.6 -0.4 47 7-54 50-104 (136) 7 COG3074 Uncharacterized protei 13.7 1.3E+02 0.0033 14.0 2.2 31 24-56 45-75 (79) 8 COG0350 Ada Methylated DNA-pro 12.5 29 0.00074 17.4 -1.6 16 45-67 137-152 (168) 9 TIGR03490 Mycoplas_LppA mycoid 11.2 53 0.0014 16.0 -0.6 17 1-17 239-255 (541) 10 TIGR00589 ogt methylated-DNA-[ 10.5 43 0.0011 16.5 -1.3 16 45-67 51-66 (80) No 1 >pfam07051 OCIA Ovarian carcinoma immunoreactive antigen (OCIA). This family consists of several ovarian carcinoma immunoreactive antigen (OCIA) and related eukaryotic sequences. The function of this family is unknown. Probab=63.25 E-value=5.8 Score=20.99 Aligned_cols=23 Identities=35% Similarity=0.634 Sum_probs=19.9 Q ss_pred CCHHHHHHCHHHHHHHHHHHHHH Q ss_conf 20144210489999999988888 Q gi|254781222|r 29 PMTKKYKITKEEHRVFSECHRIR 51 (70) Q Consensus 29 pmtkkykitkeehrvfsechrir 51 (70) |-..-|..|.||-+|+-||.+.- T Consensus 19 ~~~~~y~~t~EE~~vlrEC~~ES 41 (111) T pfam07051 19 PPAMPYIFTEEERKVLRECNEES 41 (111) T ss_pred CCCCCCCCCHHHHHHHHHHHHHH T ss_conf 99667645999999999998766 No 2 >KOG3811 consensus Probab=36.92 E-value=15 Score=18.88 Aligned_cols=27 Identities=37% Similarity=0.541 Sum_probs=15.8 Q ss_pred CHHHHHHCHHHHHH-H--HHHHHHHHHHHH Q ss_conf 01442104899999-9--998888876332 Q gi|254781222|r 30 MTKKYKITKEEHRV-F--SECHRIRALRGF 56 (70) Q Consensus 30 mtkkykitkeehrv-f--sechriralrgf 56 (70) -|-|||+|-+|-|- . -||-.--+|-|| T Consensus 218 stSKYkVTVaEvqRRlspPEcLNaSlLggv 247 (434) T KOG3811 218 STSKYKVTVAEVQRRLSPPECLNASLLGGV 247 (434) T ss_pred CCCCEEEEHHHHHHHCCCHHHHHHHHHHHH T ss_conf 655135679999750398655125766555 No 3 >KOG1517 consensus Probab=35.30 E-value=23 Score=17.86 Aligned_cols=14 Identities=43% Similarity=0.570 Sum_probs=11.2 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999888887633 Q gi|254781222|r 42 RVFSECHRIRALRG 55 (70) Q Consensus 42 rvfsechriralrg 55 (70) -..|.|||+|||+= T Consensus 480 VLLSQvHRlRAL~L 493 (1387) T KOG1517 480 VLLSQVHRLRALVL 493 (1387) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999899999999 No 4 >pfam03299 TF_AP-2 Transcription factor AP-2. Probab=26.13 E-value=25 Score=17.73 Aligned_cols=27 Identities=37% Similarity=0.529 Sum_probs=13.0 Q ss_pred CHHHHHHCHHHHH--HH-HHHHHHHHHHHH Q ss_conf 0144210489999--99-998888876332 Q gi|254781222|r 30 MTKKYKITKEEHR--VF-SECHRIRALRGF 56 (70) Q Consensus 30 mtkkykitkeehr--vf-sechriralrgf 56 (70) -|.|||+|-+|-| ++ .||-..-+|-|+ T Consensus 15 stsKYkVTV~Ev~RRls~PE~LNaSlLgg~ 44 (207) T pfam03299 15 STSKYKVTVAEVQRRLSPPECLNASLLGGV 44 (207) T ss_pred CCCEEEEEHHHHHHCCCCHHHCCHHHHHHH T ss_conf 875056559999870188112038888888 No 5 >COG5119 Uncharacterized protein, contains ParB-like nuclease domain [General function prediction only] Probab=21.60 E-value=25 Score=17.70 Aligned_cols=12 Identities=42% Similarity=0.908 Sum_probs=9.7 Q ss_pred HHHHHHHHHHHH Q ss_conf 999988888763 Q gi|254781222|r 43 VFSECHRIRALR 54 (70) Q Consensus 43 vfsechriralr 54 (70) .|+-|||.+|-. T Consensus 77 aFgGCHRl~A~d 88 (119) T COG5119 77 AFGGCHRLEACD 88 (119) T ss_pred EECCCHHHHHHH T ss_conf 617407769998 No 6 >KOG3388 consensus Probab=19.02 E-value=26 Score=17.58 Aligned_cols=47 Identities=28% Similarity=0.462 Sum_probs=25.2 Q ss_pred HHHHHHHH-----HHHCCCCCCCCCCCCCHHHHHHCHH---HHHHHHHHHHHHHHH Q ss_conf 59999999-----9720023201344520144210489---999999988888763 Q gi|254781222|r 7 PLEQTIKG-----LFQQSSTDRYGRIEPMTKKYKITKE---EHRVFSECHRIRALR 54 (70) Q Consensus 7 pleqtikg-----lfqqsstdrygriepmtkkykitke---ehrvfsechriralr 54 (70) +|-.|+|| +-+..+...-|..-|..-- .+.+| ----|+-|||.+|-. T Consensus 50 slm~Tmkn~~~c~les~d~~~~aGelpPiDvl-~v~~~G~~~YyaFgGCHRleAhd 104 (136) T KOG3388 50 SLMETMKNDQNCVLESEDSIRQAGELPPIDVL-EVDSEGGDYYYAFGGCHRLEAHD 104 (136) T ss_pred HHHHHHCCCCCCCHHHHHHHHHCCCCCCCEEE-EEECCCCEEEEEECCCHHHHHHH T ss_conf 99998508976331357788743778981289-99517966788617642447888 No 7 >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Probab=13.65 E-value=1.3e+02 Score=14.01 Aligned_cols=31 Identities=32% Similarity=0.418 Sum_probs=21.5 Q ss_pred CCCCCCCHHHHHHCHHHHHHHHHHHHHHHHHHH Q ss_conf 134452014421048999999998888876332 Q gi|254781222|r 24 YGRIEPMTKKYKITKEEHRVFSECHRIRALRGF 56 (70) Q Consensus 24 ygriepmtkkykitkeehrvfsechriralrgf 56 (70) -+..|.....-.--|+||+.+.| |||+|-|- T Consensus 45 q~~reaL~~eneqlk~e~~~WQe--rlrsLLGk 75 (79) T COG3074 45 QHQREALERENEQLKEEQNGWQE--RLRALLGK 75 (79) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHH T ss_conf 98799999888999989977999--99998710 No 8 >COG0350 Ada Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair] Probab=12.52 E-value=29 Score=17.37 Aligned_cols=16 Identities=44% Similarity=1.037 Sum_probs=7.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99888887633214332110011 Q gi|254781222|r 45 SECHRIRALRGFNDVKKGALGGF 67 (70) Q Consensus 45 sechriralrgfndvkkgalggf 67 (70) -.|||+.. +.|.|||| T Consensus 137 IPCHRVig-------~~G~L~Gy 152 (168) T COG0350 137 IPCHRVIG-------ADGDLGGY 152 (168) T ss_pred ECCEEEEC-------CCCCCCCC T ss_conf 54736876-------79973675 No 9 >TIGR03490 Mycoplas_LppA mycoides cluster lipoprotein, LppA/P72 family. Members of this protein family occur in Mycoplasma mycoides, Mycoplasma hyopneumoniae, and related Mycoplasmas in small paralogous families that may also include truncated forms and/or pseudogenes. Members are predicted lipoproteins with a conserved signal peptidase II processing and lipid attachment site. Note that the name for certain characterized members, p72, reflects an anomalous apparent molecular weight, given a theoretical MW of about 61 kDa. Probab=11.22 E-value=53 Score=16.02 Aligned_cols=17 Identities=59% Similarity=0.931 Sum_probs=14.9 Q ss_pred CCCCHHHHHHHHHHHHH Q ss_conf 97523459999999972 Q gi|254781222|r 1 MIKAKEPLEQTIKGLFQ 17 (70) Q Consensus 1 mikakepleqtikglfq 17 (70) .||+||++...++|||. T Consensus 239 YIK~K~~id~~l~GLfP 255 (541) T TIGR03490 239 YIKAKEKLDEKLKGLFP 255 (541) T ss_pred CCCCCCCCCHHHCCCCH T ss_conf 14556664633302158 No 10 >TIGR00589 ogt methylated-DNA-[protein]-cysteine S-methyltransferase; InterPro: IPR014048 Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase This entry represents the DNA binding region of 6-O-methylguanine-DNA methyltransferases. The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase (2.1.1.63 from EC). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme . This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources .; GO: 0003824 catalytic activity, 0006281 DNA repair. Probab=10.52 E-value=43 Score=16.47 Aligned_cols=16 Identities=44% Similarity=0.993 Sum_probs=8.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99888887633214332110011 Q gi|254781222|r 45 SECHRIRALRGFNDVKKGALGGF 67 (70) Q Consensus 45 sechriralrgfndvkkgalggf 67 (70) --|||+-. +.|+|||| T Consensus 51 vPCHRVig-------~~G~ltGY 66 (80) T TIGR00589 51 VPCHRVIG-------KNGTLTGY 66 (80) T ss_pred ECCEEEEC-------CCCCCCCC T ss_conf 07802542-------78873410 Done!