BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] gi|254040899|gb|ACT57695.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] gi|317120686|gb|ADV02509.1| hypothetical protein SC1_gp145 [Liberibacter phage SC1] gi|317120728|gb|ADV02550.1| hypothetical protein SC2_gp145 [Liberibacter phage SC2] gi|317120789|gb|ADV02610.1| hypothetical protein SC2_gp145 [Liberibacter phage SC2] gi|317120830|gb|ADV02651.1| hypothetical protein SC1_gp145 [Liberibacter phage SC1] Length = 70 Score = 130 bits (328), Expect = 5e-29, Method: Composition-based stats. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK 60 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK Sbjct: 1 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK 60 Query: 61 KGALGGFYRR 70 KGALGGFYRR Sbjct: 61 KGALGGFYRR 70 >gi|163868226|ref|YP_001609434.1| hypothetical protein Btr_1055 [Bartonella tribocorum CIP 105476] gi|161017881|emb|CAK01439.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 257 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 ++KKY++T E H HRIRALR F+DVK GALGGF Sbjct: 6 VSKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44 >gi|163868186|ref|YP_001609394.1| hypothetical protein Btr_1004 [Bartonella tribocorum CIP 105476] gi|161017841|emb|CAK01399.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 257 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 ++KKY++T E H HRIRALR F+DVK GALGGF Sbjct: 6 VSKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44 >gi|163867446|ref|YP_001608645.1| hypothetical protein Btr_0166 [Bartonella tribocorum CIP 105476] gi|161017092|emb|CAK00650.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 197 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 ++KKY++T E H HRIRALR F+DVK GALGGF Sbjct: 6 VSKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44 >gi|163659869|ref|YP_001608492.1| hypothetical protein PlasmidBtr_0010 [Bartonella tribocorum CIP 105476] gi|161016938|emb|CAK00497.1| hypothetical protein pBT01_0010 [Bartonella tribocorum CIP 105476] Length = 257 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 ++KKY++T E H HRIRALR F+DVK GALGGF Sbjct: 6 VSKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44 >gi|163868264|ref|YP_001609473.1| hypothetical protein Btr_1102 [Bartonella tribocorum CIP 105476] gi|161017920|emb|CAK01478.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 257 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Query: 31 TKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 +KKY++T E H HRIRALR F+DVK GALGGF Sbjct: 7 SKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44 >gi|163868200|ref|YP_001609408.1| hypothetical protein Btr_1020 [Bartonella tribocorum CIP 105476] gi|161017855|emb|CAK01413.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 211 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Query: 15 LFQQSSTDRYGRIEPMTKKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 + ++T + EP KKY+ T E V F HRIRALR F DVKKG LGGF Sbjct: 10 IISSNATAPVNQQEP-AKKYEFTGETIEVGFKTLHRIRALRDFGDVKKGELGGF 62 >gi|163868210|ref|YP_001609418.1| hypothetical protein Btr_1034 [Bartonella tribocorum CIP 105476] gi|161017865|emb|CAK01423.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 213 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 KKY+ T E V F HRIRALR F DVKKG LGGF Sbjct: 28 KKYEFTGETIEVGFKTLHRIRALRDFGDVKKGELGGF 64 >gi|163659871|ref|YP_001608494.1| phage related protein [Bartonella tribocorum CIP 105476] gi|161016940|emb|CAK00499.1| phage related protein [Bartonella tribocorum CIP 105476] Length = 213 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 KKY+ T E V F HRIRALR F DVKKG LGGF Sbjct: 28 KKYEFTGETIEVGFKTLHRIRALRDFGDVKKGELGGF 64 >gi|319404492|emb|CBI78099.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 525 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Query: 17 QQSSTDRYGRIEPMTKKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 Q S D+ + E + +KY++T EE F + +RIRALR F D+K G LGGF Sbjct: 66 QIKSYDKLKKYELIDEKYELTDEEVSYGFIQLYRIRALRDFGDIKAGDLGGF 117 >gi|49475171|ref|YP_033212.1| Phage related protein [Bartonella henselae str. Houston-1] gi|49475472|ref|YP_033513.1| phage related protein [Bartonella henselae str. Houston-1] gi|49237976|emb|CAF27181.1| Phage related protein [Bartonella henselae str. Houston-1] gi|49238278|emb|CAF27492.1| phage related protein [Bartonella henselae str. Houston-1] Length = 127 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 24/41 (58%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Query: 30 MTKKYKITKEEHRVFSECH---RIRALRGFNDVKKGALGGF 67 M KKY++T E + S CH RIRALR F+DVK G LGGF Sbjct: 1 MEKKYELTDETTDIVS-CHTLYRIRALRDFDDVKAGDLGGF 40 >gi|163867677|ref|YP_001608878.1| hypothetical protein Btr_0427 [Bartonella tribocorum CIP 105476] gi|163867801|ref|YP_001609005.1| hypothetical protein Btr_0561 [Bartonella tribocorum CIP 105476] gi|161017325|emb|CAK00883.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017452|emb|CAK01010.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 180 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVF-SECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F +VKKG LGGF + Sbjct: 1 MVKKYELTDEIDEIYLRKVYRIRALRDFRNVKKGDLGGFVEK 42 >gi|163868262|ref|YP_001609471.1| hypothetical protein Btr_1100 [Bartonella tribocorum CIP 105476] gi|161017918|emb|CAK01476.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 259 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALRDFDDIKAGALGGFIEK 48 >gi|163868228|ref|YP_001609436.1| hypothetical protein Btr_1057 [Bartonella tribocorum CIP 105476] gi|161017883|emb|CAK01441.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALRDFDDIKAGALGGFIEK 48 >gi|163868197|ref|YP_001609405.1| hypothetical protein Btr_1017 [Bartonella tribocorum CIP 105476] gi|163868231|ref|YP_001609439.1| hypothetical protein Btr_1061 [Bartonella tribocorum CIP 105476] gi|161017852|emb|CAK01410.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017886|emb|CAK01444.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 259 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALRDFDDIKAGALGGFIEK 48 >gi|163868184|ref|YP_001609392.1| hypothetical protein Btr_1002 [Bartonella tribocorum CIP 105476] gi|161017839|emb|CAK01397.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 259 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALRDFDDIKAGALGGFIEK 48 >gi|163867447|ref|YP_001608646.1| hypothetical protein Btr_0167 [Bartonella tribocorum CIP 105476] gi|161017093|emb|CAK00651.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 259 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRALR F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALRDFDDIKAGALGGFIEK 48 >gi|163659870|ref|YP_001608493.1| hypothetical protein PlasmidBtr_0011 [Bartonella tribocorum CIP 105476] gi|161016939|emb|CAK00498.1| hypothetical protein pBT01_0011 [Bartonella tribocorum CIP 105476] Length = 220 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 23/40 (57%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGF 67 M KK+ +T E RVF+ +RIRALR F+DVK G+LGGF Sbjct: 1 MQKKFALTNET-RVFNNQTLYRIRALRDFDDVKAGSLGGF 39 >gi|319409066|emb|CBI82717.1| Phage-related protein (fragment) [Bartonella schoenbuchensis R1] Length = 169 Score = 43.5 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Query: 32 KKYKITKEEHRVFSEC--HRIRALRGFNDVKKGALGGFYRR 70 KKY+ T E ++ EC HRIRAL+ F DVK G LGGF + Sbjct: 2 KKYEFTSETQKL-GECTFHRIRALKDFGDVKAGDLGGFIEK 41 >gi|163868199|ref|YP_001609407.1| hypothetical protein Btr_1019 [Bartonella tribocorum CIP 105476] gi|161017854|emb|CAK01412.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 220 Score = 42.7 bits (99), Expect = 0.016, Method: Composition-based stats. Identities = 23/40 (57%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGF 67 M KK+ +T E RVF+ +RIRALR F+DVK G LGGF Sbjct: 1 MQKKFALTNET-RVFNNQTLYRIRALRDFDDVKAGQLGGF 39 >gi|163868175|ref|YP_001609383.1| hypothetical protein Btr_0991 [Bartonella tribocorum CIP 105476] gi|161017830|emb|CAK01388.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 295 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 + KKY++T E V HRIRALR F DVK+G LGGF + Sbjct: 3 VKKKYELTDETIEVNGRTLHRIRALRDFGDVKEGDLGGFIEK 44 >gi|163867678|ref|YP_001608879.1| hypothetical protein Btr_0428 [Bartonella tribocorum CIP 105476] gi|163867800|ref|YP_001609004.1| hypothetical protein Btr_0560 [Bartonella tribocorum CIP 105476] gi|161017326|emb|CAK00884.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017451|emb|CAK01009.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 163 Score = 42.3 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGF 67 M KKY++T E ++ +RIRALR F DVK G LGGF Sbjct: 1 MVKKYELTDETTWIYGNKLTYRIRALRDFGDVKAGDLGGF 40 >gi|163868170|ref|YP_001609378.1| hypothetical protein Btr_0986 [Bartonella tribocorum CIP 105476] gi|161017825|emb|CAK01383.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 176 Score = 41.9 bits (97), Expect = 0.026, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGF 67 M KKY++T E ++ +RIRALR F DVK G LGGF Sbjct: 1 MEKKYELTDETTWIYGNKLTYRIRALRDFGDVKAGDLGGF 40 >gi|163867680|ref|YP_001608881.1| hypothetical protein Btr_0430 [Bartonella tribocorum CIP 105476] gi|163867798|ref|YP_001609002.1| hypothetical protein Btr_0558 [Bartonella tribocorum CIP 105476] gi|161017328|emb|CAK00886.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017449|emb|CAK01007.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 105 Score = 41.9 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 + KKYK+T E +V + +RIRAL+ F+DVK+G LGGF Sbjct: 2 IKKKYKLTDETIKVDGTTLYRIRALKDFDDVKEGDLGGF 40 >gi|160931949|ref|ZP_02079341.1| hypothetical protein CLOLEP_00782 [Clostridium leptum DSM 753] gi|156868991|gb|EDO62363.1| hypothetical protein CLOLEP_00782 [Clostridium leptum DSM 753] Length = 206 Score = 41.5 bits (96), Expect = 0.033, Method: Composition-based stats. Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFSECHRIRALRGF-NDVKKGALGGF 67 MT KY+IT+ H F HRIRALR DV+ G LGGF Sbjct: 1 MTPKYEITRIAHPKFPWMHRIRALRDVREDVRAGDLGGF 39 >gi|307950810|gb|ADN97101.1| phage-related protein [Bartonella sp. TT0105] Length = 221 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 ++KKY+ T E +V + +RIR+LR F DVK G LGGF + Sbjct: 4 ISKKYEFTSETQQVGAHTLYRIRSLRDFGDVKAGDLGGFIEK 45 >gi|319404447|emb|CBI78050.1| Phage-related protein (fragment) [Bartonella rochalimae ATCC BAA-1498] Length = 104 Score = 41.2 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KKY+IT E ++ +RIRALR F +VK G LGGF + Sbjct: 1 MEKKYEITDETTWIYGNKLTYRIRALRDFGNVKVGELGGFIEK 43 >gi|319405065|emb|CBI78672.1| Phage-related protein [Bartonella sp. AR 15-3] Length = 180 Score = 41.2 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E V + H IRALR F +VKKG LGGF ++ Sbjct: 1 MEKKYELTDETIEVNGKTLHCIRALRDFRNVKKGYLGGFIQK 42 >gi|163868209|ref|YP_001609417.1| hypothetical protein Btr_1033 [Bartonella tribocorum CIP 105476] gi|161017864|emb|CAK01422.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 41.2 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+DVK GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFSDVKAGALGGFIEK 42 >gi|163867702|ref|YP_001608903.1| hypothetical protein Btr_0453 [Bartonella tribocorum CIP 105476] gi|163867785|ref|YP_001608989.1| hypothetical protein Btr_0543 [Bartonella tribocorum CIP 105476] gi|161017350|emb|CAK00908.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017436|emb|CAK00994.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 41.2 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+DVK GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFSDVKAGALGGFIEK 42 >gi|163868171|ref|YP_001609379.1| hypothetical protein Btr_0987 [Bartonella tribocorum CIP 105476] gi|161017826|emb|CAK01384.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 155 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E V HRIRAL+ F VKKG LGGF ++ Sbjct: 1 MEKKYELTDETIEVNRHTLHRIRALKDFGYVKKGDLGGFIQK 42 >gi|240851448|ref|YP_002972835.1| phage related protein [Bartonella grahamii as4aup] gi|240268571|gb|ACS52158.1| phage related protein [Bartonella grahamii as4aup] Length = 222 Score = 40.8 bits (94), Expect = 0.057, Method: Composition-based stats. Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query: 27 IEPMTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGFYRR 70 + ++KKY+ T E +V +RIRALR F DVK G LGGF + Sbjct: 1 MNAISKKYEFTNETKQVGDVTLYRIRALRDFGDVKAGDLGGFIEK 45 >gi|319409055|emb|CBI82708.1| Phage-related protein [Bartonella schoenbuchensis R1] Length = 222 Score = 40.8 bits (94), Expect = 0.065, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 32 KKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 KKY+ T E + HRIRALR F DVK G LGGF + Sbjct: 6 KKYEFTNETLKAGKRTLHRIRALRDFGDVKAGDLGGFIEK 45 >gi|163868227|ref|YP_001609435.1| hypothetical protein Btr_1056 [Bartonella tribocorum CIP 105476] gi|161017882|emb|CAK01440.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+D+K GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFSDIKAGALGGFIEK 42 >gi|167770475|ref|ZP_02442528.1| hypothetical protein ANACOL_01820 [Anaerotruncus colihominis DSM 17241] gi|167667070|gb|EDS11200.1| hypothetical protein ANACOL_01820 [Anaerotruncus colihominis DSM 17241] Length = 203 Score = 40.4 bits (93), Expect = 0.075, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGF 67 KKY++T+E +F + HRIRA R F++V G LGGF Sbjct: 2 KKYELTEETTNIFGKTLHRIRATRDFSNVHAGDLGGF 38 >gi|163867679|ref|YP_001608880.1| hypothetical protein Btr_0429 [Bartonella tribocorum CIP 105476] gi|163867799|ref|YP_001609003.1| hypothetical protein Btr_0559 [Bartonella tribocorum CIP 105476] gi|161017327|emb|CAK00885.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017450|emb|CAK01008.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 204 Score = 40.4 bits (93), Expect = 0.085, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 M KKY++T E+ HRIRALR F +KKG LGGF Sbjct: 1 MEKKYELTDEKAEFKGVTLHRIRALRDFGVIKKGNLGGF 39 >gi|163868263|ref|YP_001609472.1| hypothetical protein Btr_1101 [Bartonella tribocorum CIP 105476] gi|161017919|emb|CAK01477.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 40.0 bits (92), Expect = 0.095, Method: Composition-based stats. Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F DVK GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFADVKAGALGGFIEK 42 >gi|163868198|ref|YP_001609406.1| hypothetical protein Btr_1018 [Bartonella tribocorum CIP 105476] gi|163868232|ref|YP_001609440.1| hypothetical protein Btr_1062 [Bartonella tribocorum CIP 105476] gi|161017853|emb|CAK01411.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017887|emb|CAK01445.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 40.0 bits (92), Expect = 0.095, Method: Composition-based stats. Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F DVK GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFADVKAGALGGFIEK 42 >gi|163868208|ref|YP_001609416.1| hypothetical protein Btr_1032 [Bartonella tribocorum CIP 105476] gi|161017863|emb|CAK01421.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 259 Score = 40.0 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ + +RIRAL+ F+D+K G LGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNITSLYRIRALKDFDDIKAGDLGGFIEK 48 >gi|163868161|ref|YP_001609369.1| hypothetical protein Btr_0977 [Bartonella tribocorum CIP 105476] gi|161017816|emb|CAK01374.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 105 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 + KKYK+T E ++ +RIRAL+ F+DVK+G LGGF Sbjct: 2 IKKKYKLTDETIQIDGITLYRIRALKDFDDVKEGDLGGF 40 >gi|163659867|ref|YP_001608490.1| hypothetical protein PlasmidBtr_0008 [Bartonella tribocorum CIP 105476] gi|161016936|emb|CAK00495.1| hypothetical protein pBT01_0008 [Bartonella tribocorum CIP 105476] Length = 240 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 7/45 (15%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGF 67 M KKY++T + ++ + +RIRALR F+DVK G LGGF Sbjct: 1 MCKKYELTNQIKQIKDRLTKQITNLYRIRALRDFDDVKAGDLGGF 45 >gi|319899140|ref|YP_004159233.1| hypothetical protein BARCL_0981 [Bartonella clarridgeiae 73] gi|319403104|emb|CBI76662.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 467 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 KKY++T EE + S + +RIRALR F VK G LGGF Sbjct: 70 KKYELTDEEISINSHKLYRIRALRDFGHVKAGDLGGF 106 >gi|240850404|ref|YP_002971798.1| phage related protein [Bartonella grahamii as4aup] gi|240850796|ref|YP_002972196.1| phage related protein [Bartonella grahamii as4aup] gi|240850997|ref|YP_002972397.1| phage related protein [Bartonella grahamii as4aup] gi|240851026|ref|YP_002972426.1| phage related protein [Bartonella grahamii as4aup] gi|240851115|ref|YP_002972517.1| phage related protein [Bartonella grahamii as4aup] gi|240267527|gb|ACS51115.1| phage related protein [Bartonella grahamii as4aup] gi|240267919|gb|ACS51507.1| phage related protein [Bartonella grahamii as4aup] gi|240268120|gb|ACS51708.1| phage related protein [Bartonella grahamii as4aup] gi|240268149|gb|ACS51737.1| phage related protein [Bartonella grahamii as4aup] gi|240268238|gb|ACS51826.1| phage related protein [Bartonella grahamii as4aup] Length = 277 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 22/41 (53%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Query: 28 EPMTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 EP KKY+ T E HRIRALR F+D+K G LGGF Sbjct: 25 EP-AKKYEFTNENFTFDGLTLHRIRALRDFDDIKAGDLGGF 64 >gi|240850388|ref|YP_002971782.1| phage related protein [Bartonella grahamii as4aup] gi|240267511|gb|ACS51099.1| phage related protein [Bartonella grahamii as4aup] Length = 277 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 20/37 (54%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 KKY+ T E+ HRIRALR F+D+K G LGGF Sbjct: 28 KKYEFTNEKFTFDGLTLHRIRALRDFDDIKAGDLGGF 64 >gi|319403823|emb|CBI77410.1| Phage-related protein [Bartonella rochalimae ATCC BAA-1498] Length = 141 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGF 67 M KKY++T EE + F + +RIRAL+ F +VK LGGF Sbjct: 1 MCKKYELTDEEIVIGFHKLYRIRALKDFGNVKVNELGGF 39 >gi|240850386|ref|YP_002971780.1| phage related protein [Bartonella grahamii as4aup] gi|240267509|gb|ACS51097.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ +RI+AL+ F+D+K GALGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNIINLYRIKALKDFDDIKAGALGGFIEK 48 >gi|240850998|ref|YP_002972398.1| phage related protein [Bartonella grahamii as4aup] gi|240268121|gb|ACS51709.1| phage related protein [Bartonella grahamii as4aup] Length = 194 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+D+K G LGGF + Sbjct: 3 MQKKFALTNET-RVFGNHTLYRIKALKDFSDIKAGTLGGFIEK 44 >gi|240850403|ref|YP_002971797.1| phage related protein [Bartonella grahamii as4aup] gi|240267526|gb|ACS51114.1| phage related protein [Bartonella grahamii as4aup] Length = 194 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+D+K G LGGF + Sbjct: 3 MQKKFALTNET-RVFGNHTLYRIKALKDFSDIKAGTLGGFIEK 44 >gi|240851024|ref|YP_002972424.1| phage related protein [Bartonella grahamii as4aup] gi|240851113|ref|YP_002972515.1| phage related protein [Bartonella grahamii as4aup] gi|240268147|gb|ACS51735.1| phage related protein [Bartonella grahamii as4aup] gi|240268236|gb|ACS51824.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ +RI+AL+ F+DVK G+LGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNIINLYRIKALKDFDDVKAGSLGGFIEK 48 >gi|240850999|ref|YP_002972399.1| phage related protein [Bartonella grahamii as4aup] gi|240268122|gb|ACS51710.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ +RI+AL+ F+DVK G+LGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNIINLYRIKALKDFDDVKAGSLGGFIEK 48 >gi|240850794|ref|YP_002972194.1| phage related protein [Bartonella grahamii as4aup] gi|240267917|gb|ACS51505.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ +RI+AL+ F+DVK G+LGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNIINLYRIKALKDFDDVKAGSLGGFIEK 48 >gi|163868162|ref|YP_001609370.1| hypothetical protein Btr_0978 [Bartonella tribocorum CIP 105476] gi|161017817|emb|CAK01375.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 189 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRVF-------SECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E + + +RIRALR F ++KKG LGG+ ++ Sbjct: 1 MEKKYELTDEIKEFYDAKTDKSKKLYRIRALRDFRNIKKGYLGGYIQK 48 >gi|240850367|ref|YP_002971761.1| phage related protein [Bartonella grahamii as4aup] gi|240267490|gb|ACS51078.1| phage related protein [Bartonella grahamii as4aup] Length = 184 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF E +RI+AL+ F DVK LGGF + Sbjct: 1 MQKKFALTNET-RVFGEYVLYRIKALKDFADVKASTLGGFIEK 42 >gi|240850387|ref|YP_002971781.1| phage related protein [Bartonella grahamii as4aup] gi|240267510|gb|ACS51098.1| phage related protein [Bartonella grahamii as4aup] Length = 174 Score = 38.5 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F D+K G LGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIKALKDFADIKAGTLGGFIEK 42 >gi|240850366|ref|YP_002971760.1| phage related protein [Bartonella grahamii as4aup] gi|240267489|gb|ACS51077.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 38.5 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKE----EH---RVFSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E +H R +RIRAL+ F+D+K G LGGF + Sbjct: 1 MCKKYELTSEIKQIKHALTRNIINLYRIRALKDFDDIKAGDLGGFIEK 48 >gi|163659868|ref|YP_001608491.1| hypothetical protein PlasmidBtr_0009 [Bartonella tribocorum CIP 105476] gi|161016937|emb|CAK00496.1| hypothetical protein pBT01_0009 [Bartonella tribocorum CIP 105476] Length = 192 Score = 38.5 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+DVK GA GGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFSDVKAGASGGFIEK 42 >gi|240850364|ref|YP_002971757.1| phage related protein [Bartonella grahamii as4aup] gi|240267487|gb|ACS51075.1| phage related protein [Bartonella grahamii as4aup] Length = 146 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 7/45 (15%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGF 67 ++KKY++T E V +RIRALR F VKKG LGGF Sbjct: 6 VSKKYELTNETTEVKDHLYGRVRTLYRIRALRSFGGVKKGDLGGF 50 >gi|240850402|ref|YP_002971796.1| phage related protein [Bartonella grahamii as4aup] gi|240267525|gb|ACS51113.1| phage related protein [Bartonella grahamii as4aup] Length = 259 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKEEHRV-------FSECHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E ++ +RI+AL+ F+D+K G+LGGF + Sbjct: 1 MCKKYELTSEIKKIKHALTRNIISLYRIKALKDFDDIKAGSLGGFIEK 48 >gi|319898497|ref|YP_004158590.1| hypothetical protein BARCL_0323 [Bartonella clarridgeiae 73] gi|319402461|emb|CBI76004.1| Phage-related protein (fragment) [Bartonella clarridgeiae 73] Length = 173 Score = 38.5 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGF 67 M KKY++T E+ + + +RIRAL+ F DVK G LGGF Sbjct: 1 MLKKYELTDEKIIIGAHTLYRIRALKDFGDVKVGDLGGF 39 >gi|240850350|ref|YP_002971743.1| phage related protein [Bartonella grahamii as4aup] gi|240267473|gb|ACS51061.1| phage related protein [Bartonella grahamii as4aup] Length = 189 Score = 38.5 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 7/48 (14%) Query: 30 MTKKYKIT---KEEHRVFSE----CHRIRALRGFNDVKKGALGGFYRR 70 M KKY++T KE H ++ +RIRALR F ++KKG LGG+ ++ Sbjct: 1 MEKKYELTDEIKEFHDARTDKSKKLYRIRALRDFRNIKKGYLGGYIQK 48 >gi|319406831|emb|CBI80466.1| Phage-related protein [Bartonella sp. 1-1C] Length = 141 Score = 38.5 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 M KKY++T EE V S + +RIRAL+ F +VK LGGF Sbjct: 1 MCKKYELTDEEVVVGSHKLYRIRALKDFGNVKVNELGGF 39 >gi|240850795|ref|YP_002972195.1| phage related protein [Bartonella grahamii as4aup] gi|240851025|ref|YP_002972425.1| phage related protein [Bartonella grahamii as4aup] gi|240851114|ref|YP_002972516.1| phage related protein [Bartonella grahamii as4aup] gi|240267918|gb|ACS51506.1| phage related protein [Bartonella grahamii as4aup] gi|240268148|gb|ACS51736.1| phage related protein [Bartonella grahamii as4aup] gi|240268237|gb|ACS51825.1| phage related protein [Bartonella grahamii as4aup] Length = 152 Score = 38.1 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F D+K G LGGF + Sbjct: 3 MQKKFALTNET-RVFGNHTLYRIQALKDFADIKAGTLGGFIEK 44 >gi|240850351|ref|YP_002971744.1| phage related protein [Bartonella grahamii as4aup] gi|240267474|gb|ACS51062.1| phage related protein [Bartonella grahamii as4aup] Length = 129 Score = 38.1 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Query: 32 KKYKITKEEHRVFS--ECHRIRALRGFNDVKKGALGGFYRR 70 KKY+ T +E VF HRIRALR F VKKG +GGF + Sbjct: 2 KKYEFT-DEKIVFDGRTLHRIRALRDFGYVKKGDIGGFIEK 41 >gi|240850540|ref|YP_002971940.1| phage related protein [Bartonella grahamii as4aup] gi|240267663|gb|ACS51251.1| phage related protein [Bartonella grahamii as4aup] Length = 181 Score = 37.7 bits (86), Expect = 0.50, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E V + RIRALR DVK+G LGG+ + Sbjct: 1 MEKKYELTDETIEVDGKTLRRIRALRDLGDVKQGDLGGYIEK 42 >gi|319899141|ref|YP_004159234.1| hypothetical protein BARCL_0982 [Bartonella clarridgeiae 73] gi|319403105|emb|CBI76663.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 511 Score = 37.7 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFSE-CHRIRALRGFNDVKKGALGGF 67 KKY++T+E V SE +RI ALR F DV+ G LGGF Sbjct: 79 KKYELTEESILVNSEKLYRIIALRDFGDVEAGDLGGF 115 >gi|240850352|ref|YP_002971745.1| phage related protein [Bartonella grahamii as4aup] gi|240267475|gb|ACS51063.1| phage related protein [Bartonella grahamii as4aup] Length = 181 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 M KKY++T E RIRALR F+DVK G LGG+ + Sbjct: 1 MEKKYELTDETIEFGCRTLRRIRALRDFDDVKAGDLGGYIEK 42 >gi|319408674|emb|CBI82329.1| Phage-related protein [Bartonella schoenbuchensis R1] Length = 270 Score = 37.3 bits (85), Expect = 0.63, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 9/47 (19%) Query: 30 MTKKYKITKEEHRVF---------SECHRIRALRGFNDVKKGALGGF 67 + KKY++T+E +V +RIRALR F DVK G GGF Sbjct: 3 IAKKYELTEESKQVHILRFGRESTRTLYRIRALRDFGDVKAGDFGGF 49 >gi|319407485|emb|CBI81135.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 533 Score = 37.3 bits (85), Expect = 0.64, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 32 KKYKITKEE-HRVFSECHRIRALRGFNDVKKGALGGF 67 KKY++T EE +RI+ALR F D+K G LGGF Sbjct: 71 KKYELTDEEISDGLLRLYRIKALRDFGDIKTGDLGGF 107 >gi|163868185|ref|YP_001609393.1| hypothetical protein Btr_1003 [Bartonella tribocorum CIP 105476] gi|161017840|emb|CAK01398.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 192 Score = 37.3 bits (85), Expect = 0.65, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query: 30 MTKKYKITKEEHRVFSE--CHRIRALRGFNDVKKGALGGFYRR 70 M KK+ +T E RVF +RI+AL+ F+ VK GALGGF + Sbjct: 1 MQKKFALTNET-RVFGNHTLYRIQALKDFSYVKAGALGGFIEK 42 >gi|163868182|ref|YP_001609390.1| hypothetical protein Btr_0999 [Bartonella tribocorum CIP 105476] gi|161017837|emb|CAK01395.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 219 Score = 37.3 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 7/48 (14%) Query: 30 MTKKYKITKE-------EHRVFSECHRIRALRGFNDVKKGALGGFYRR 70 ++KKY++T E E + +RIRALR F DVK G LGGF + Sbjct: 6 VSKKYELTDESIKGNDKELKRTITLYRIRALRDFADVKAGDLGGFIEK 53 >gi|332653197|ref|ZP_08418942.1| phage related protein [Ruminococcaceae bacterium D16] gi|332518343|gb|EGJ47946.1| phage related protein [Ruminococcaceae bacterium D16] Length = 211 Score = 37.3 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFSECHRIRALRGFN-DVKKGALGGF 67 +KY+IT+ H + HRIRALR + +VK G LGGF Sbjct: 7 QKYEITEISHEKYPFLHRIRALRDVSAEVKAGDLGGF 43 >gi|163869085|ref|YP_001610319.1| hypothetical protein Btr_2302 [Bartonella tribocorum CIP 105476] gi|161018766|emb|CAK02324.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 156 Score = 37.3 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 + KKY++T E V +RIRAL+ F VKKG LGGF ++ Sbjct: 2 IKKKYELTDEVDEVGGHTLYRIRALKDFGYVKKGDLGGFIQK 43 >gi|240850539|ref|YP_002971939.1| phage related protein [Bartonella grahamii as4aup] gi|240267662|gb|ACS51250.1| phage related protein [Bartonella grahamii as4aup] Length = 151 Score = 37.3 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Query: 32 KKYKITKE--EHRVFSECHRIRALRGFNDVKKGALGGF 67 +KY++T E E + +RIRAL+ F DVK G LGGF Sbjct: 2 RKYELTDETIEFDGYITLYRIRALKDFGDVKAGDLGGF 39 >gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] gi|229792119|gb|EEP28233.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 30 MTKKYKITKEEHRV-FSECHRIRALRGFNDVKKGALGGFYRR 70 M KK+++T + F + +RI+AL F DVK G LGGF + Sbjct: 1 MEKKFELTSDTKDTEFRQLYRIKALIDFGDVKAGDLGGFVEK 42 >gi|282879974|ref|ZP_06288696.1| conserved domain protein [Prevotella timonensis CRIS 5C-B1] gi|281306088|gb|EFA98126.1| conserved domain protein [Prevotella timonensis CRIS 5C-B1] Length = 106 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 30 MTKKYKITKEEHRVFS--ECHRIRALRGFNDVKKGALGGF 67 M KKY++ K + HRI ALR F DVKKG GG+ Sbjct: 1 MEKKYRLLKNDTITVDGRTLHRIEALRDFADVKKGDKGGY 40 >gi|163868187|ref|YP_001609395.1| hypothetical protein Btr_1005 [Bartonella tribocorum CIP 105476] gi|161017842|emb|CAK01400.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 243 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 31 TKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGF 67 +KKY+ T E V +RIRALR F DVK G LGG+ Sbjct: 16 SKKYEFTGEMDFVTGLILYRIRALRDFGDVKAGDLGGY 53 >gi|163867445|ref|YP_001608644.1| hypothetical protein Btr_0165 [Bartonella tribocorum CIP 105476] gi|163868225|ref|YP_001609433.1| hypothetical protein Btr_1054 [Bartonella tribocorum CIP 105476] gi|163868233|ref|YP_001609441.1| hypothetical protein Btr_1063 [Bartonella tribocorum CIP 105476] gi|161017091|emb|CAK00649.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017880|emb|CAK01438.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017888|emb|CAK01446.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 219 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 31 TKKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGF 67 +KKY+ T E V +RIRALR F DVK G LGG+ Sbjct: 16 SKKYEFTGEMDFVTGLILYRIRALRDFGDVKAGDLGGY 53 >gi|160933417|ref|ZP_02080805.1| hypothetical protein CLOLEP_02263 [Clostridium leptum DSM 753] gi|156867294|gb|EDO60666.1| hypothetical protein CLOLEP_02263 [Clostridium leptum DSM 753] Length = 211 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFSECHRIRALRGF-NDVKKGALGGF 67 KKY+IT H + HRIRALR D+ G LGGF Sbjct: 4 KKYEITNIAHPHYPWLHRIRALRDVREDIHAGDLGGF 40 >gi|319899139|ref|YP_004159232.1| hypothetical protein BARCL_0980 [Bartonella clarridgeiae 73] gi|319403103|emb|CBI76661.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 353 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Query: 10 QTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67 Q ++ LF +S++ + KKYK+T E + S + +RI ALR F ++ G+LGGF Sbjct: 5 QILENLFDRSNSQAD---DTFFKKYKLTDEVITIGSHKLYRIMALRDFGYIRAGSLGGF 60 >gi|240850368|ref|YP_002971762.1| phage related protein [Bartonella grahamii as4aup] gi|240267491|gb|ACS51079.1| phage related protein [Bartonella grahamii as4aup] Length = 256 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/19 (78%), Positives = 17/19 (89%) Query: 49 RIRALRGFNDVKKGALGGF 67 RIRALR F+DVKKG LGG+ Sbjct: 46 RIRALRDFDDVKKGDLGGY 64 >gi|163868265|ref|YP_001609474.1| hypothetical protein Btr_1103 [Bartonella tribocorum CIP 105476] gi|161017921|emb|CAK01479.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 256 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/19 (78%), Positives = 17/19 (89%) Query: 49 RIRALRGFNDVKKGALGGF 67 RIRALR F+DVKKG LGG+ Sbjct: 46 RIRALRDFDDVKKGDLGGY 64 >gi|163867703|ref|YP_001608904.1| hypothetical protein Btr_0454 [Bartonella tribocorum CIP 105476] gi|163867784|ref|YP_001608988.1| hypothetical protein Btr_0542 [Bartonella tribocorum CIP 105476] gi|161017351|emb|CAK00909.1| phage-related protein [Bartonella tribocorum CIP 105476] gi|161017435|emb|CAK00993.1| phage-related protein [Bartonella tribocorum CIP 105476] Length = 226 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/19 (78%), Positives = 17/19 (89%) Query: 49 RIRALRGFNDVKKGALGGF 67 RIRALR F+DVKKG LGG+ Sbjct: 46 RIRALRDFDDVKKGDLGGY 64 >gi|154500272|ref|ZP_02038310.1| hypothetical protein BACCAP_03938 [Bacteroides capillosus ATCC 29799] gi|150271004|gb|EDM98278.1| hypothetical protein BACCAP_03938 [Bacteroides capillosus ATCC 29799] Length = 211 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 32 KKYKITKEEHRVFSECHRIRALRGFN-DVKKGALGGF 67 +KY++T+ H + HRIRALR + +V+ G LGGF Sbjct: 7 QKYELTEISHEKYPFLHRIRALRDVSAEVRAGDLGGF 43 >gi|315122490|ref|YP_004062979.1| hypothetical protein CKC_03710 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495892|gb|ADR52491.1| hypothetical protein CKC_03710 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 69 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 7/46 (15%) Query: 30 MTKKYKITKE--EHRVFSECHRIRALRGFN----DVKKGALGGFYR 69 M KK+++T E EH + HRI+ALR N +VKKG LGG+ R Sbjct: 1 MAKKFELTDETQEHNGVT-LHRIKALRDINNVGFNVKKGDLGGWVR 45 >gi|240850468|ref|YP_002971866.1| hypothetical protein Bgr_09000 [Bartonella grahamii as4aup] gi|240267591|gb|ACS51179.1| hypothetical protein Bgr_09000 [Bartonella grahamii as4aup] Length = 298 Score = 34.6 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Query: 32 KKYKITKEEHRVFSEC-HRIRALRGFNDVKKGALGGFYRR 70 KKYK+T E +V +RI+A++ F +KKG LGG+ + Sbjct: 7 KKYKLTNEAIKVGEFILYRIKAIKNFGTIKKGDLGGYIEK 46 >gi|221117402|ref|XP_002162149.1| PREDICTED: similar to CG15040 CG15040-PA [Hydra magnipapillata] Length = 2921 Score = 34.6 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Query: 11 TIKGLFQQSSTDRYGRIEPMTKKYKI 36 TIKG F Q+STD YG I P KYKI Sbjct: 730 TIKG-FLQASTDNYGNINPQATKYKI 754 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.322 0.138 0.401 Lambda K H 0.267 0.0424 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 597,965,272 Number of Sequences: 14124377 Number of extensions: 17875494 Number of successful extensions: 41847 Number of sequences better than 10.0: 86 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 57 Number of HSP's that attempted gapping in prelim test: 41818 Number of HSP's gapped (non-prelim): 86 length of query: 70 length of database: 4,842,793,630 effective HSP length: 42 effective length of query: 28 effective length of database: 4,249,569,796 effective search space: 118987954288 effective search space used: 118987954288 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.8 bits)