RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Score = 50.6 bits (120), Expect = 9e-08 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 11/46 (23%) Query: 32 KKYKITKEEHRVFSEC----------HRIRALRGFNDVKKGALGGF 67 KY+++ E R F+ ++ A+ FNDVK G GG+ Sbjct: 2 TKYRLS-EGPRAFTYQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGW 46 >2j91_A Adenylosuccinate lyase; disease mutation, adenylosuccinase, succino AMP-lyase, purine biosynthesis, alternative splicing; HET: AMP; 1.8A {Homo sapiens} PDB: 2vd6_A* Length = 503 Score = 28.0 bits (61), Expect = 0.49 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Query: 10 QTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALR 54 Q++ S D Y P+ +Y + E VFS+ ++ R R Sbjct: 21 QSMAAGGDHGSPDSY--RSPLASRYA-SPEMCFVFSDRYKFRTWR 62 >3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} Length = 188 Score = 26.8 bits (58), Expect = 1.1 Identities = 8/22 (36%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Query: 30 MTKKYKITKEEHRVFSECHRIR 51 M+ Y+I KE F HR+ Sbjct: 1 MSLIYQIAKEFD--FCYGHRVW 20 >3bz1_O MSP, photosystem II manganese-stabilizing polypeptide; electron transport photosystem, membrane complex, transmembrane alpha-helix; HET: CLA PHO HEM PL9 BCR DGD LHG SQD LMG LMT; 2.90A {Thermosynechococcus elongatus} PDB: 2axt_O* 3bz2_O* 1s5l_O* 3a0b_O* 3a0h_O* Length = 247 Score = 25.5 bits (56), Expect = 3.3 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 7/26 (26%) Query: 4 AKEPLEQTIKGLFQQSSTDRYGRIEP 29 A EP E I+G+F Y IEP Sbjct: 228 AHEPHEVKIQGVF-------YASIEP 246 >1yis_A Adenylosuccinate lyase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.40A {Caenorhabditis elegans} Length = 478 Score = 23.7 bits (50), Expect = 9.2 Identities = 6/36 (16%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 19 SSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALR 54 +S D++ ++ +Y + SE ++ R Sbjct: 2 ASEDKF--ESVLSTRYCKNSPLVSILSETNKATLWR 35 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.322 0.138 0.401 Gapped Lambda K H 0.267 0.0447 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 603,241 Number of extensions: 21857 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's gapped: 76 Number of HSP's successfully gapped: 6 Length of query: 70 Length of database: 5,693,230 Length adjustment: 40 Effective length of query: 30 Effective length of database: 4,723,470 Effective search space: 141704100 Effective search space used: 141704100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.7 bits)