RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Score = 49.1 bits (116), Expect = 1e-07 Identities = 9/37 (24%), Positives = 17/37 (45%) Query: 31 TKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGF 67 + + + + ++ A+ FNDVK G GG+ Sbjct: 8 PRAFTYQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGW 44 >d2axto1 f.4.1.4 (O:30-271) Manganese-stabilising protein, PsbO {Thermosynechococcus elongatus [TaxId: 146786]} Length = 242 Score = 26.3 bits (58), Expect = 0.63 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 7/26 (26%) Query: 4 AKEPLEQTIKGLFQQSSTDRYGRIEP 29 A EP E I+G+F Y IEP Sbjct: 224 AHEPHEVKIQGVF-------YASIEP 242 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.138 0.401 Gapped Lambda K H 0.267 0.0479 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 262,636 Number of extensions: 9640 Number of successful extensions: 21 Number of sequences better than 10.0: 1 Number of HSP's gapped: 21 Number of HSP's successfully gapped: 3 Length of query: 70 Length of database: 2,407,596 Length adjustment: 38 Effective length of query: 32 Effective length of database: 1,885,856 Effective search space: 60347392 Effective search space used: 60347392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.5 bits)