BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62] Length = 70 Score = 145 bits (367), Expect = 9e-38, Method: Compositional matrix adjust. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK 60 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK Sbjct: 1 MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVK 60 Query: 61 KGALGGFYRR 70 KGALGGFYRR Sbjct: 61 KGALGGFYRR 70 >gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 563 Score = 24.3 bits (51), Expect = 0.37, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 44 FSECHRIRALRGFNDVKKGALGG 66 F H +R L +D KKG +GG Sbjct: 454 FLGLHALRRLHNIDDAKKGEVGG 476 >gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 20.8 bits (42), Expect = 4.5, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 18/31 (58%) Query: 34 YKITKEEHRVFSECHRIRALRGFNDVKKGAL 64 Y IT + + + S C+R+ ++ +K+G + Sbjct: 205 YMITHDLNNLISTCNRVAVIQKKGIMKEGTI 235 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.138 0.401 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,455 Number of Sequences: 1233 Number of extensions: 1167 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 70 length of database: 328,796 effective HSP length: 41 effective length of query: 29 effective length of database: 278,243 effective search space: 8069047 effective search space used: 8069047 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.0 bits) S2: 31 (16.5 bits)