>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.

Probab=98.95  E-value=6.4e-10  Score=57.89  Aligned_cols=29  Identities=14%  Similarity=0.279  Sum_probs=10.7

Q ss_pred             CCCCEECCCCEECCCCCCCCCCCCCCCCCE
Q ss_conf             288399798154575432311222222210
Q gi|254781223|r   14 IDDARVSGNASVSRFAQVKSNAEVSDNTYV   43 (110)
Q Consensus        14 ~~~~~I~~n~~I~~~~~i~~~~~i~~~~~i   43 (110)
T Consensus         3 G~~~~Ig~~~~I~~-svIG~~c~Ig~~~~I   31 (79)
T cd03356           3 GESTVIGENAIIKN-SVIGDNVRIGDGVTI   31 (79)
T ss_pred             CCCCEECCCCEEEC-CEECCCCEECCCCEE
T ss_conf             89799999999959-999999999999699