BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781223|ref|YP_003065636.1| intrrupted gp229, phage associated protein [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781223|ref|YP_003065636.1| intrrupted gp229, phage associated protein [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 208 bits (529), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS Sbjct: 1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60 Query: 61 VGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE 110 VGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE Sbjct: 61 VGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE 110 >gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 30.8 bits (68), Expect = 0.007, Method: Compositional matrix adjust. Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 7/110 (6%) Query: 1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVS------DNTYVRDNAKVGGYAK 54 M +N ++ A V + A + N+ + F V S E+ + V K+G + K Sbjct: 4 MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63 Query: 55 VSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARV-RGNAVVGGDTVV 103 V A +GG+ + VG + V VI + RG GG T+V Sbjct: 64 VFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIV 113 Score = 27.3 bits (59), Expect = 0.069, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Query: 40 NTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGG 99 N++V + K+G +S N + G+ IV D GG + V FT R+ A +GG Sbjct: 122 NSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFT------RIGKYAFIGG 175 Query: 100 DTVVEGDTV 108 T V D + Sbjct: 176 MTGVVHDVI 184 Score = 23.1 bits (48), Expect = 1.2, Method: Compositional matrix adjust. Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 6/73 (8%) Query: 35 AEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNAR---- 90 + + +N + A V A + N+ +G V E+G +I V++G + Sbjct: 2 SRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDF 61 Query: 91 --VRGNAVVGGDT 101 V AV+GGDT Sbjct: 62 TKVFPMAVLGGDT 74 Score = 22.7 bits (47), Expect = 1.8, Method: Compositional matrix adjust. Identities = 12/55 (21%), Positives = 24/55 (43%) Query: 29 AQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFT 83 + V + ++ + + +N + G+ V GG + V +G AF+ G T Sbjct: 123 SHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMT 177 >gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 27.3 bits (59), Expect = 0.064, Method: Composition-based stats. Identities = 14/74 (18%), Positives = 34/74 (45%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVG 62 D+ ++ + + + ++ N + + S ++ +TY+ DN +GG ++G +G Sbjct: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298 Query: 63 GNAIVRDTAEVGGD 76 N + + V D Sbjct: 299 DNVQIASKSGVLKD 312 Score = 25.4 bits (54), Expect = 0.26, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 28/65 (43%) Query: 39 DNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVG 98 D+T + +N K+ ++ N +G I+ + G ++ +I G + G +G Sbjct: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298 Query: 99 GDTVV 103 + + Sbjct: 299 DNVQI 303 Score = 24.6 bits (52), Expect = 0.48, Method: Composition-based stats. Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 11/75 (14%) Query: 15 DDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVG----------GN 64 +D ++ ++ A V E+ TYV + +G ++ N S+G GN Sbjct: 127 EDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGN 186 Query: 65 AIVRDTA-EVGGDAF 78 +++ + +G D F Sbjct: 187 SVILHSGVRIGNDGF 201 Score = 20.4 bits (41), Expect = 9.0, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 25/61 (40%) Query: 43 VRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTV 102 + A +G K+ + A+V E+G +V +VI R+ N +G + Sbjct: 119 ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSS 178 Query: 103 V 103 + Sbjct: 179 I 179 >gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 600 Score = 22.3 bits (46), Expect = 2.4, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 13 VIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYA 53 + D V G ASV+ + S+ V+ N Y+ D V GY Sbjct: 97 IFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI-VDGYG 136 >gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 22.3 bits (46), Expect = 2.5, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSN 34 DN + I+DA GNA +SR A + S+ Sbjct: 8 DNKTEAPSSKKIEDALNEGNAPISREASLFSS 39 >gi|254780170|ref|YP_003064583.1| cationic amino acid ABC transporter, periplasmic binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 342 Score = 21.9 bits (45), Expect = 2.7, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 20/42 (47%) Query: 52 YAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRG 93 + S NAS+ G+ R + G + ++GF + N +G Sbjct: 17 FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKG 58 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 21.2 bits (43), Expect = 5.0, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 79 VIGFTVISGNARVRGNAVVGGDTVVEGDTVLE 110 VI +I +RVRG V + +E VLE Sbjct: 1136 VITNQIIDSTSRVRGEIVDISNKFIETSRVLE 1167 >gi|254780777|ref|YP_003065190.1| uridylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 20.8 bits (42), Expect = 6.9, Method: Compositional matrix adjust. Identities = 25/66 (37%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Query: 37 VSDNTYVRDNAKVGGYAKVSGNASVGG-----NAIVRDTAEVGGDAFVIGFTVISGNARV 91 +SD Y R KV G A ++G + G N I D AEV IG V GN Sbjct: 1 MSDFPYKRVLLKVSGEA-LAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNI-F 58 Query: 92 RGNAVV 97 RG+ VV Sbjct: 59 RGSQVV 64 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.131 0.358 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,263 Number of Sequences: 1233 Number of extensions: 2363 Number of successful extensions: 34 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 32 (16.9 bits)