RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|36664 KOG1451, KOG1451, KOG1451, Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms]. Length = 812 Score = 27.3 bits (60), Expect = 0.86 Identities = 16/65 (24%), Positives = 31/65 (47%) Query: 9 KVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTK 68 +VQ+ RF +E L +L + V +EL QD + +L+ + + R T+ Sbjct: 183 EVQEVQERKRFEFVEPLLAFLYSLFSFFHVGSELHQDFKPFKDQLQTSVQNTRNNFNATR 242 Query: 69 SELKD 73 +E ++ Sbjct: 243 AEAEE 247 >gnl|CDD|31524 COG1333, ResB, ResB protein required for cytochrome c biosynthesis [Posttranslational modification, protein turnover, chaperones]. Length = 478 Score = 26.8 bits (59), Expect = 1.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 81 WFMGIIVSVLVSTIGILLK 99 WF+ IIV + VS +G L Sbjct: 58 WFLAIIVLLGVSLVGCSLP 76 >gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like. Aldehyde dehydrogenase AlkH (locus name P12693, EC=1.2.1.3) of the alkBFGHJKL operon that allows Pseudomonas putida to metabolize alkanes and the aldehyde dehydrogenase AldX of Bacillus subtilis (locus P46329, EC=1.2.1.3), and similar sequences, are present in this CD. Length = 433 Score = 24.9 bits (55), Expect = 5.0 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 13/66 (19%) Query: 29 LATKADLADVRTE----LKQDIANVRTELKADI-ADVR--------TELACTKSELKDAI 75 LA +A A R LK+ I R E+ A + AD R TE+ SE+ AI Sbjct: 12 LALRASTAAERIAKLKRLKKAILARREEIIAALAADFRKPAAEVDLTEILPVLSEINHAI 71 Query: 76 NSQTKW 81 KW Sbjct: 72 KHLKKW 77 >gnl|CDD|144876 pfam01442, Apolipoprotein, Apolipoprotein A1/A4/E domain. These proteins contain several 22 residue repeats which form a pair of alpha helices. This family includes: Apolipoprotein A-I, Apolipoprotein A-IV, and Apolipoprotein E. Length = 191 Score = 24.9 bits (55), Expect = 5.8 Identities = 11/43 (25%), Positives = 20/43 (46%) Query: 37 DVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQT 79 + +L ++ +R EL+ D+ +VR L ELK + Sbjct: 27 EFWAQLSKETEALREELQKDLEEVRARLQPYLDELKAKVGQNL 69 Score = 24.1 bits (53), Expect = 7.7 Identities = 11/47 (23%), Positives = 25/47 (53%) Query: 33 ADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQT 79 DL +VR L+ + ++ ++ ++ ++R LA EL++ +N Sbjct: 45 KDLEEVRARLQPYLDELKAKVGQNLEELRQRLAPYAEELRERLNRDA 91 >gnl|CDD|30657 COG0309, HypE, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]. Length = 339 Score = 24.4 bits (53), Expect = 7.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 37 DVRTELKQDIANVRTELKADIADVRTELACTKSELKDA 74 ++ TEL D A + +KA ++ V LA + + DA Sbjct: 188 ELETELGSDCAPLAKLVKALLSVVGEALAAAVTAMHDA 225 >gnl|CDD|31749 COG1561, COG1561, Uncharacterized stress-induced protein [Function unknown]. Length = 290 Score = 24.0 bits (52), Expect = 8.6 Identities = 12/53 (22%), Positives = 24/53 (45%) Query: 6 VRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIA 58 + ++ + ++ +LE + LA KAD+A+ LK + R L+ Sbjct: 188 LVARLNEAQDQLDEDRLEQEVALLAQKADIAEELDRLKSHVKEFRNILEKGGP 240 >gnl|CDD|176967 CHL00025, ndhF, NADH dehydrogenase subunit 5. Length = 741 Score = 24.1 bits (53), Expect = 8.8 Identities = 6/12 (50%), Positives = 11/12 (91%) Query: 86 IVSVLVSTIGIL 97 I+ +L++T+GIL Sbjct: 95 IMLILITTVGIL 106 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.129 0.338 Gapped Lambda K H 0.267 0.0752 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 967,684 Number of extensions: 38985 Number of successful extensions: 125 Number of sequences better than 10.0: 1 Number of HSP's gapped: 124 Number of HSP's successfully gapped: 19 Length of query: 103 Length of database: 6,263,737 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,751,107 Effective search space: 156786531 Effective search space used: 156786531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)