RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|184618 PRK14318, glmM, phosphoglucosamine mutase; Provisional. Length = 448 Score = 27.6 bits (62), Expect = 0.68 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Query: 33 ADLADVRTELKQDIANVRTELKADIAD---VRTELACTKSELKDA 74 A+LA T L Q + NV K A VR +A ++EL D Sbjct: 362 AELASAMTVLPQVLINVPVVDKTTAATAPSVRAAVARAEAELGDT 406 >gnl|CDD|151900 pfam11461, RILP, Rab interacting lysosomal protein. RILP contains a domain which contains two coiled-coil regions and is found mainly in the cytosol. RILP is recruited onto late endosomal and lysosomal membranes by Rab7 and acts as a downstream effector of Rab7. This recruitment process is important for phagosome maturation and fusion with late endosomes and lysosomes. Length = 60 Score = 27.3 bits (61), Expect = 1.00 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 41 ELKQDIANVRTELKADIADVRTELACTKSELKDAIN 76 EL+ ++ R ELKA + ++ ELA KSEL Sbjct: 4 ELR-EVLQERNELKAKVFLLQEELAYYKSELLPEER 38 >gnl|CDD|151424 pfam10977, DUF2797, Protein of unknown function (DUF2797). This family of proteins has no known function. Length = 233 Score = 26.1 bits (58), Expect = 2.1 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Query: 38 VRTELKQDIA---NVRTELKADIADVRTELACTKSELKDAI 75 V LK +A N R LK + DV LA ++ L + I Sbjct: 118 VEVALKAHVADKTNWRKMLKGLVEDVD--LAAERARLLEEI 156 >gnl|CDD|177550 PHA03173, PHA03173, UL37 tegument protein; Provisional. Length = 1028 Score = 25.8 bits (57), Expect = 2.9 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query: 33 ADLADVRTELKQDIANVRTELKADIADVRTELACTKSELK--DAINSQT 79 AD+ D + + R +L+AD+A +RT +A T + L+ +A+ +QT Sbjct: 784 ADVVDAVGGYYGEYNDARADLRADLAALRTVIAETTAALQECEALAAQT 832 >gnl|CDD|150304 pfam09592, DUF2031, Protein of unknown function (DUF2031). This protein is expressed in Plasmodium; its function is unknown. It may be the product of gene family pyst-b. Length = 228 Score = 25.8 bits (57), Expect = 2.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 45 DIANVRTELKADIADVRTELACTKSELKDAINS 77 D+ NV + K I ++R EL K EL + N Sbjct: 102 DLNNVDKKTKKLINELRKELEEVKKELDNKRNG 134 >gnl|CDD|184349 PRK13824, PRK13824, replication initiation protein RepC; Provisional. Length = 404 Score = 24.8 bits (55), Expect = 4.6 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Query: 13 DSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADV 60 + VE RF + LP AT A+L + EL L+ ++ ++ Sbjct: 196 EGVEQRFRAIVARLPRRATLAELEPILDEL--------EALREEVVNL 235 >gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. Length = 1164 Score = 24.6 bits (54), Expect = 5.0 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 33 ADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINS 77 +L + + L+Q+I NV++ELK A + EL +L++A+N Sbjct: 740 EELEEDLSSLEQEIENVKSELKELEARI-EELEEDLHKLEEALND 783 >gnl|CDD|163210 TIGR03303, OM_YaeT, outer membrane protein assembly complex, YaeT protein. Members of this protein family are the YaeT protein of the YaeT/YfiO complex for assembling proteins into the outer membrane of Gram-negative bacteria. This protein is similar in sequence and function to a non-essential paralog, YtfM, that is also in the Omp85 family. Members of this family typically have five tandem copies of the surface antigen variable number repeat (pfam07244), followed by an outer membrane beta-barrel domain (pfam01103), while the YtfM family typically has a single pfam07244 repeat. Length = 741 Score = 24.5 bits (54), Expect = 6.9 Identities = 5/18 (27%), Positives = 7/18 (38%) Query: 69 SELKDAINSQTKWFMGII 86 SEL+D + F Sbjct: 166 SELRDVFALKESNFWSWF 183 >gnl|CDD|148076 pfam06248, Zw10, Centromere/kinetochore Zw10. Zw10 and rough deal proteins are both required for correct metaphase check-pointing during mitosis. These proteins bind to the centromere/kinetochore. Length = 571 Score = 23.9 bits (52), Expect = 8.9 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 26 LPYLATKADLADVRTELKQDIAN-----VRTELKADIADVRTELACTKSELKDAINS 77 LP +++ +L + L +DI++ V E+ D+ ELA K +L++ I Sbjct: 42 LPNMSSAEELLSRVSSLSEDISDLLASEVSNEILQDLNVAVEELAELKRQLEEKILG 98 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.129 0.338 Gapped Lambda K H 0.267 0.0789 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,424,547 Number of extensions: 74124 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's gapped: 217 Number of HSP's successfully gapped: 41 Length of query: 103 Length of database: 5,994,473 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,481,913 Effective search space: 147903129 Effective search space used: 147903129 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (22.9 bits)