BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 206 bits (524), Expect = 8e-56, Method: Compositional matrix adjust. Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADV 60 MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADV Sbjct: 1 MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADV 60 Query: 61 RTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH 103 RTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH Sbjct: 61 RTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH 103 >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 29.6 bits (65), Expect = 0.013, Method: Compositional matrix adjust. Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 20/84 (23%) Query: 18 RFTKLETALPYLATKAD-----LADVRTELKQDIANVRTELKADIADVRTELACTKSELK 72 R T LE L+ K + L + + ++DIANVR E +A+VR E+A ++E+ Sbjct: 31 RITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE----VANVRIEVANVRTEM- 85 Query: 73 DAINSQTKWFMGIIVSVLVSTIGI 96 +G+I + + IGI Sbjct: 86 ----------LGLIWKIPATAIGI 99 >gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 28.1 bits (61), Expect = 0.035, Method: Compositional matrix adjust. Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query: 6 VRQKVQKDSVEIRFTKLETALPYLATKADLADVRTE---LKQDIANVRTELKADIADVRT 62 VR V +D +I F + +L+ + + + LK +AN+ ++ D+RT Sbjct: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188 >gi|254780668|ref|YP_003065081.1| hypothetical protein CLIBASIA_02775 [Candidatus Liberibacter asiaticus str. psy62] Length = 46 Score = 26.6 bits (57), Expect = 0.096, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 22/33 (66%) Query: 29 LATKADLADVRTELKQDIANVRTELKADIADVR 61 LAT ADL + ++ K ++A V+ ELKA++ R Sbjct: 4 LATGADLTEKFSKGKLNVAAVKCELKAEVTVTR 36 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.129 0.338 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,107 Number of Sequences: 1233 Number of extensions: 1474 Number of successful extensions: 11 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 103 length of database: 328,796 effective HSP length: 62 effective length of query: 41 effective length of database: 252,350 effective search space: 10346350 effective search space used: 10346350 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 32 (16.9 bits)