HHsearch alignment for GI: 254781225 and conserved domain: cd03239

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=92.70  E-value=0.18  Score=27.53  Aligned_cols=31  Identities=32%  Similarity=0.544  Sum_probs=26.9

Q ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             3799997078862578999999972330003
Q gi|254781225|r  501 QRFIHIRGVGGSGKSTLMNLIKYAFGNQYVI  531 (789)
Q Consensus       501 ~~~~~~~G~G~nGKSt~~~~l~~llG~~~~~  531 (789)
T Consensus        22 ~~~~~ivG~nGsGKSni~~ai~~~~g~~~~~   52 (178)
T cd03239          22 NSFNAIVGPNGSGKSNIVDAICFVLGGKAAK   52 (178)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCHHH
T ss_conf             9817998999887789999999998664276