RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] (789 letters) >gnl|CDD|130674 TIGR01613, primase_Cterm, phage/plasmid primase, P4 family, C-terminal domain. This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus. Length = 304 Score = 146 bits (371), Expect = 2e-35 Identities = 82/303 (27%), Positives = 130/303 (42%), Gaps = 13/303 (4%) Query: 427 RFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESE-EVMDY 485 L +G+ DL TGQ + T+ T + + + F + E+++Y Sbjct: 1 YKLNVANGVYDLRTGQLEPHDPDEIHTRKITTEYDPKADCPTWNGFLLETFGGDNELIEY 60 Query: 486 FTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPE 545 R +G +L G Q+ + G GG+GKST NL+ G+ Y A AS M E Sbjct: 61 LQRVIGYSLTGNYTEQKLFFLYGNGGNGKSTFQNLLSNLLGD-YATTAVASLKMN----E 115 Query: 546 AGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFT 605 + L RL G R VI E + + + K +TGGD +TAR + + +P FT Sbjct: 116 FQEHRFGLARLEGKRAVIGDEVQKGYRDDESTFKSLTGGDTITARFKNKDPFEFTP-KFT 174 Query: 606 PFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAK---KWFLKG 662 N +R D RR +IPF K + L+ Y E W ++G Sbjct: 175 LVQSTNHLPRIRGFDGGIKRRLRIIPFTKVFPGEKKNK--ALKEDYINEKDVILYWAVEG 232 Query: 663 VKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYR 722 ++ G D IP+ L+A EE ++ D ++++CCD E + ++Y E+ Sbjct: 233 IRLDQRIG-DFSIPKAVLEATEEYKEENDVVARFLEECCDDSEGEKVPVRFVYEAYKEWC 291 Query: 723 EQE 725 E+ Sbjct: 292 EEG 294 >gnl|CDD|180825 PRK07078, PRK07078, hypothetical protein; Validated. Length = 759 Score = 138 bits (349), Expect = 6e-33 Identities = 102/363 (28%), Positives = 157/363 (43%), Gaps = 25/363 (6%) Query: 415 FSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITK-STGTPFVEGEPSQEFLDLV 473 + TS+ D+ L G++DL TG+ +E +TK +T TP + + FL V Sbjct: 406 HAATSEEWDADPWLLNTPGGVVDLRTGRLRPHRREDRMTKITTATPAGDCPTWRRFLAEV 465 Query: 474 SGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINA 533 +G E+ Y R G AL G + G G +GKS +N + G+ Y NA Sbjct: 466 TG--GDAELQAYLQRMAGYALTGSTSEHALFFLYGTGANGKSVFVNTLATILGD-YAANA 522 Query: 534 EASDIMQNRPPEAGKANPS-LIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLN 592 M+ R G +P+ L L G+R V ET + +K+K +TGGD ++AR Sbjct: 523 PMDTFMETR----GDRHPTDLAGLRGARFVSAIETEQGRRWAESKVKNLTGGDKISARFM 578 Query: 593 YGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPF--DKPIANRDASFAQKLETK 650 + + P F I N +RN D+A RR +IPF P RD QKL + Sbjct: 579 RQDFFEFFP-QFKLLIAGNHKPAIRNVDEAMKRRLHLIPFTVTVPPERRDKRLQQKLLAE 637 Query: 651 YTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEE 710 W ++G + GLD P+ ++A EE + D WI++ C+ G N E Sbjct: 638 RD-GILAWAVEGCLDWQRNGLDP--PQSVVEATEEYFEAEDALGQWIEERCERGANAKEL 694 Query: 711 SHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLK 770 + L + E+ E+ + S + + L +GF + R +G+ Sbjct: 695 TAELFNDWKEWAERAGEFVG---SQKRFSDLLATRGFEKW-------RLTGGLRGFRGIG 744 Query: 771 LKP 773 LKP Sbjct: 745 LKP 747 >gnl|CDD|173172 PRK14709, PRK14709, hypothetical protein; Provisional. Length = 469 Score = 132 bits (333), Expect = 4e-31 Identities = 99/366 (27%), Positives = 161/366 (43%), Gaps = 29/366 (7%) Query: 415 FSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTG-TPFVEGEPSQ--EFLD 471 F++TS+ D+ LG G +DL TG+ E IT+ T P + + FLD Sbjct: 118 FAVTSEDWDADPWLLGTPGGTVDLRTGKLRAADPEDMITRLTAVAPADTADCPRWLRFLD 177 Query: 472 LVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVI 531 +G +E++ + + G L G + + + G GG+GKS +N++ G+ Y Sbjct: 178 EATG--GDDELIRFLQQWCGYCLTGDTREHALVFVFGGGGNGKSVFLNVLAGILGD-YAT 234 Query: 532 NAEASDIMQNRPPEAGKANPS-LIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTAR 590 A M +P+ L L G+R+V SET E A+IKQMTGGD +TAR Sbjct: 235 TAA----MDTFTASKHDRHPTDLAMLRGARLVTASETEEGRAWAEARIKQMTGGDTITAR 290 Query: 591 LNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETK 650 + + P F IV N +RN D+A RR+ ++PF + A D KL + Sbjct: 291 FMRQDFFEFVP-QFKLTIVGNHKPRLRNVDEAARRRFNIVPFTRKPARPDPDLEAKLRAE 349 Query: 651 YTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDI---GENL 707 + +W + G + + GL P +A EE DT+ W+++ C + Sbjct: 350 WP-AILRWMIDGCLDWQANGLVR--PAAVTEATEEYFAEQDTFGQWLEERCIVDPGNPVC 406 Query: 708 WEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIK 767 W+ L S+ E+ E + + +++ GF +K K R + Sbjct: 407 WDVLQDLYASWCEFARAEG---EPAGTAKEFGERMEKLGF------KKDRK--NRGRGFR 455 Query: 768 GLKLKP 773 G++L+P Sbjct: 456 GIQLRP 461 >gnl|CDD|150055 pfam09250, Prim-Pol, Bifunctional DNA primase/polymerase, N-terminal. Members of this family adopt a structure consisting of a core of antiparallel beta sheets. They are found in various bacterial hypothetical proteins, and have been shown to harbour both primase and polymerase activities. Length = 161 Score = 61.3 bits (149), Expect = 9e-10 Identities = 39/167 (23%), Positives = 58/167 (34%), Gaps = 22/167 (13%) Query: 10 AKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKL----PACGFGFVCGVGEQPL 65 A + NG+ ++PL G K+P W++ +I + P G G L Sbjct: 1 ALRYAANGWAVLPLDPGSKKPLDPKGWQDATTDPAEIRRWWARNPGANIGLPTGRSG--L 58 Query: 66 YAFDIDSKDEKTANTFKDTFEILHG----TPIVRIGQKPKILIPFRMNKEGIKKKKTT-- 119 D+D+K A E G T +VR + FR+ K+ Sbjct: 59 VVLDVDTKAGGDA---LAALERAGGPLPPTLVVRTP-SGGRHLYFRVPDGPELKRNLLFA 114 Query: 120 -ESTQGHLDILGCG-QYFVAY-NIHPKTKKEYTWTTPPHRFKVEDTP 163 + G +DI G Y VA ++HP Y WT P Sbjct: 115 KDGGGGGIDIRAGGGGYVVAPPSVHPGG--PYEWTGGTPL-PPAPAP 158 >gnl|CDD|149686 pfam08707, PriCT_2, Primase C terminal 2 (PriCT-2). This alpha helical domain is found at the C terminal of primases. Length = 74 Score = 50.4 bits (121), Expect = 2e-06 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 224 GSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273 +D W+ V MA+ HE +G E+ WS + S YD KWD+F Sbjct: 13 DDYDSWLRVGMALKHEF--GEEGLELWDEWSAKSSKYDPGECERKWDSFK 60 >gnl|CDD|149685 pfam08706, D5_N, D5 N terminal like. This domain is found in D5 proteins of DNA viruses and bacteriophage P4 DNA primases phages. Length = 145 Score = 39.0 bits (91), Expect = 0.005 Identities = 35/170 (20%), Positives = 56/170 (32%), Gaps = 30/170 (17%) Query: 304 ASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMK 363 A R +D Y K Y T WY D W K + + L+ + Sbjct: 1 AKRLADRYGK---------DLRYVPGTGGWYVWDG---KRWEEDSKKAIRELADKLLRLI 48 Query: 364 EDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLD 423 + + ++E K S+S N EA ++ +T D LD Sbjct: 49 LEEAEAAKELRKFAKRSRSKSGVKNV------------------LREAKAMLDVTLDELD 90 Query: 424 SSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLV 473 + L +G+LDL TG+ E +TK T + + + Sbjct: 91 ADPYLLNFPNGVLDLRTGELRPHDPEDRLTKITPVDYDPDADCPLWKQFL 140 >gnl|CDD|150847 pfam10236, DAP3, Mitochondrial ribosomal death-associated protein 3. This is a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). Length = 274 Score = 34.5 bits (80), Expect = 0.11 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 7/55 (12%) Query: 478 ESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMN-LIKYAFGNQYVI 531 E+ E+ K RF+ + G GSGKS L+ + YA +V+ Sbjct: 6 ETLELTKKLKE-----ADASKKVVRFV-LTGERGSGKSVLLAQAMAYALTQGWVV 54 >gnl|CDD|182511 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional. Length = 902 Score = 33.5 bits (77), Expect = 0.20 Identities = 25/67 (37%), Positives = 32/67 (47%), Gaps = 18/67 (26%) Query: 587 MTARLNYGNTYSESPAS-FTPFI--VPNKHLFVRNPDDAWWRRY----IVIPFDKPIANR 639 MTA N+GN +S AS F PF+ +P HL ++N Y + IPFD N Sbjct: 705 MTASSNFGNVFSVLVASAFLPFLPMLP-LHLLIQN------LLYDVSQVAIPFD----NV 753 Query: 640 DASFAQK 646 D QK Sbjct: 754 DDEQIQK 760 >gnl|CDD|178984 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed. Length = 943 Score = 33.1 bits (77), Expect = 0.29 Identities = 12/21 (57%), Positives = 14/21 (66%) Query: 503 FIHIRGVGGSGKSTLMNLIKY 523 F + GV GSGKSTL+N Y Sbjct: 637 FTCVTGVSGSGKSTLINETLY 657 >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional. Length = 510 Score = 31.6 bits (72), Expect = 0.82 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 14/38 (36%) Query: 486 FTRCVGM--ALLGGNKAQRFIHIRGVGGSGKSTLMNLI 521 FT G ALLGGN G+GKSTLM +I Sbjct: 32 FTLHAGEVHALLGGN------------GAGKSTLMKII 57 >gnl|CDD|163051 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Length = 529 Score = 31.6 bits (72), Expect = 0.92 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Query: 461 VEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNL 520 G+P+ E DL GY S V+D V + L G + + I G GSGKSTL+ L Sbjct: 329 GLGKPTLELRDLSFGYPGSPPVLD----GVSLDLPPGER----VAILGPSGSGKSTLLML 380 Query: 521 I 521 + Sbjct: 381 L 381 >gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif. Length = 686 Score = 31.5 bits (72), Expect = 0.97 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 499 KAQRFIHIRGVGGSGKSTLMNL 520 + F+ I G GSGKSTL+ L Sbjct: 477 EPGEFVAIVGPSGSGKSTLLRL 498 >gnl|CDD|162130 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein. Length = 617 Score = 31.2 bits (71), Expect = 1.00 Identities = 16/76 (21%), Positives = 27/76 (35%), Gaps = 21/76 (27%) Query: 446 PTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIH 505 + F P + L VSG + E++ A++G + Sbjct: 17 DGSWKQLVSRLRGCFCRERPRKHLLKNVSGVAKPGELL---------AVMGSS------- 60 Query: 506 IRGVGGSGKSTLMNLI 521 G+GK+TLMN + Sbjct: 61 -----GAGKTTLMNAL 71 >gnl|CDD|161968 TIGR00630, uvra, excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 924 Score = 31.1 bits (71), Expect = 1.1 Identities = 13/23 (56%), Positives = 14/23 (60%) Query: 502 RFIHIRGVGGSGKSTLMNLIKYA 524 F I GV GSGKSTL+N Y Sbjct: 634 LFTCITGVSGSGKSTLINDTLYP 656 >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional. Length = 648 Score = 31.2 bits (71), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 500 AQRFIHIRGVGGSGKSTLMNLI 521 A + I G GSGKSTLMN++ Sbjct: 33 AGEMVAIVGASGSGKSTLMNIL 54 >gnl|CDD|130034 TIGR00960, 3a0501s02, Type II (General) Secretory Pathway (IISP) Family protein. Length = 216 Score = 30.5 bits (69), Expect = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 + + G G+GKST + LI Sbjct: 31 MVFLVGHSGAGKSTFLKLI 49 >gnl|CDD|162131 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein. Length = 1394 Score = 29.7 bits (67), Expect = 2.7 Identities = 29/128 (22%), Positives = 52/128 (40%), Gaps = 32/128 (25%) Query: 392 RRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELY 451 R + E S + +EAG + ++DL D S E+D ++ E+G+ + + L Sbjct: 712 RAKKAGETSASNKN--DIEAGEVLG-STDLTDESDDVNDEKD--MEKESGEDIFHWRNL- 765 Query: 452 ITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGG 511 T ++ E L+ V G+ + + AL+G G Sbjct: 766 ----TYEVKIKKEKRV-ILNNVDGWVKPGTLT---------ALMG------------ASG 799 Query: 512 SGKSTLMN 519 +GK+TL+N Sbjct: 800 AGKTTLLN 807 >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional. Length = 232 Score = 29.9 bits (68), Expect = 2.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 504 IHIRGVGGSGKSTLMNLI 521 + I G G+GKSTL+NLI Sbjct: 28 VAILGPSGAGKSTLLNLI 45 >gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family. This family of ATPases demonstrates extensive homology with ATP synthase F1, beta subunit. It is a mixture of members with two different protein functions. The first group is exemplified by Salmonella typhimurium FliI protein. It is needed for flagellar assembly, its ATPase activity is required for flagellation, and it may be involved in a specialized protein export pathway that proceeds without signal peptide cleavage. The second group of proteins function in the export of virulence proteins; exemplified by Yersinia sp. YscN protein an ATPase involved in the type III secretory pathway for the antihost Yops proteins. Length = 440 Score = 29.6 bits (67), Expect = 2.9 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query: 480 EEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLI 521 E++ R + LL K QR I I G GKSTL+ +I Sbjct: 144 REILSTGVRSID-GLLTVGKGQR-IGIFAGSGVGKSTLLGMI 183 >gnl|CDD|163011 TIGR02774, rexB_recomb, ATP-dependent nuclease subunit B. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RecAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. The partner may be designated AddB, as in Bacillus and in alphaproteobacteria, or RexB as in Streptococcus and Lactococcus. Note, however, that RexB proteins lack an N-terminal GxxGxGK[ST] ATP-binding motif found in Bacillus subtilis and related species, and this difference may be important; this model represents specifically RexB proteins as found in Streptococcus and Lactococcus. Length = 1076 Score = 29.4 bits (66), Expect = 3.3 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 8/93 (8%) Query: 392 RRQNVEENSKAKSTAQSLEAG---SIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTK 448 + + SK +++E+G S T ++D +RF E++ ++ L G+ V+ Sbjct: 158 NQGQYAQQSKLAHFIEAIESGKLDSDLKNTVLVIDGFTRFSAEEEALVSLLHGKGVEIII 217 Query: 449 ELYIT-KSTGTPFVEG---EPSQEFL-DLVSGY 476 Y + K+ + F EG + S +FL DL Y Sbjct: 218 GAYASQKAYKSSFSEGNLYQASVKFLHDLAQKY 250 >gnl|CDD|181578 PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated. Length = 227 Score = 29.6 bits (67), Expect = 3.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 493 ALLGGNKAQRFIHIRGVGGSGKSTLM 518 L G A RF ++ G GSG+S L+ Sbjct: 34 ELAAGPVADRFFYLWGEAGSGRSHLL 59 >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. Length = 867 Score = 29.4 bits (66), Expect = 3.8 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 16/83 (19%) Query: 587 MTARLNYGNTYSESPAS-FTPFI-VPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFA 644 MTA N+GN +S AS F PF+ + + HL ++N + + +P+DK D F Sbjct: 670 MTASSNFGNVFSVLVASAFIPFLPMLSLHLLIQNL--LYDFSQLTLPWDK----MDREFL 723 Query: 645 QKLETKYTLEAKKWFLKGVKAYI 667 +K +W KG+ ++ Sbjct: 724 KK--------PHQWEQKGMGRFM 738 >gnl|CDD|179089 PRK00698, tmk, thymidylate kinase; Validated. Length = 205 Score = 29.0 bits (66), Expect = 4.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 502 RFIHIRGVGGSGKSTLMNLIK 522 FI I G+ G+GKST + L+K Sbjct: 4 MFITIEGIDGAGKSTQIELLK 24 >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. Length = 214 Score = 29.1 bits (66), Expect = 4.7 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 503 FIHIRGVGGSGKSTLMNLI-KYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMG 558 F+ + G G+GK+TL+ L+ ++ + D+ + R G+ P L R +G Sbjct: 30 FLFLTGPSGAGKTTLLKLLYGALTPSRGQVRIAGEDVNRLR----GRQLPLLRRRIG 82 >gnl|CDD|161676 TIGR00041, DTMP_kinase, thymidylate kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate. Length = 195 Score = 28.9 bits (65), Expect = 5.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 503 FIHIRGVGGSGKSTLMNLIK 522 FI I G+ G+GK+T NL+K Sbjct: 5 FIVIEGIDGAGKTTQANLLK 24 >gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 694 Score = 28.9 bits (65), Expect = 5.3 Identities = 13/24 (54%), Positives = 15/24 (62%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLIK 522 K FI I G GSGKSTL L++ Sbjct: 481 KPGEFIGIVGPSGSGKSTLTKLLQ 504 >gnl|CDD|163254 TIGR03420, DnaA_homol_Hda, DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP. Length = 226 Score = 28.7 bits (65), Expect = 5.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 495 LGGNKAQRFIHIRGVGGSGKSTLM 518 L K RF+++ G GSGKS L+ Sbjct: 32 LAAGKGDRFLYLWGESGSGKSHLL 55 >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional. Length = 258 Score = 28.7 bits (65), Expect = 5.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 506 IRGVGGSGKSTLMNLI 521 I G GSGK+TL+N + Sbjct: 37 IVGESGSGKTTLLNAL 52 >gnl|CDD|163179 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria. Length = 650 Score = 28.9 bits (65), Expect = 6.0 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%) Query: 504 IHIRGVGGSGKSTLMNLIKYA-FGNQ-YVINAEASDIMQ------NRPPEAGKANPSLIR 555 I I G+ G+GK+TL++ I+ A +G + Q NR AGK NP+ I Sbjct: 31 ILIGGLNGAGKTTLLDAIQLALYGKRALCSGRGNKSYEQYLRGLINRQ--AGKTNPASIT 88 Query: 556 L 556 L Sbjct: 89 L 89 >gnl|CDD|179463 PRK02714, PRK02714, O-succinylbenzoate synthase; Provisional. Length = 320 Score = 28.4 bits (64), Expect = 6.4 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Query: 40 LLSSEKI----DKLPACGFGFVC 58 ++ E+I D LPAC FGF Sbjct: 71 EITPEQIFSIPDALPACQFGFES 93 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 28.5 bits (63), Expect = 6.8 Identities = 12/39 (30%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Query: 502 RFIHIRGVGGSGKSTLMNLI----KYAFGNQYVINAEAS 536 I I G GSGK+TL + G I+ E Sbjct: 3 EVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDI 41 >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. Length = 230 Score = 28.6 bits (64), Expect = 7.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 FI + G G GKSTL+NLI Sbjct: 13 FISLIGHSGCGKSTLLNLI 31 >gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional. Length = 200 Score = 28.4 bits (63), Expect = 7.1 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 +H++G G+GK+TL+ LI Sbjct: 29 LLHLKGSNGAGKTTLLKLI 47 >gnl|CDD|183250 PRK11638, PRK11638, lipopolysaccharide biosynthesis protein WzzE; Provisional. Length = 342 Score = 28.1 bits (63), Expect = 9.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 385 FWFNTDYRRQNVEENSKA 402 FW TDY +Q +E N+KA Sbjct: 111 FWLQTDYYKQRMEGNAKA 128 >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional. Length = 588 Score = 28.0 bits (63), Expect = 9.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLIKYAF 525 K + + I G G+GKSTL+NL++ F Sbjct: 359 KPGQTVAIVGPTGAGKSTLINLLQRVF 385 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.134 0.401 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 12,969,936 Number of extensions: 845506 Number of successful extensions: 1860 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1845 Number of HSP's successfully gapped: 51 Length of query: 789 Length of database: 5,994,473 Length adjustment: 101 Effective length of query: 688 Effective length of database: 3,812,065 Effective search space: 2622700720 Effective search space used: 2622700720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 61 (27.2 bits)