RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781226|ref|YP_003065639.1| hypothetical protein CLIBASIA_05665 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|165391 PHA03118, PHA03118, multifunctional expression regulator; Provisional. Length = 474 Score = 29.7 bits (66), Expect = 0.23 Identities = 15/74 (20%), Positives = 34/74 (45%), Gaps = 8/74 (10%) Query: 16 REYKRRYYLKNRDKILERRRRRYL--------KNKDKIRESYHQYYLKNKDKYREYKRRY 67 + Y ++ K+RD+ L + R ++ D+ ++ ++ +D R+ R+ Sbjct: 136 KSYNQQSRKKHRDESLRNKHGRPSGPPAMSPGEHFDQTHDAEYRLRFNERDARRDRIRKE 195 Query: 68 YLKNRDKMREKARQ 81 Y DK+ E+A + Sbjct: 196 YDIPTDKITEQAIE 209 >gnl|CDD|162459 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi. Length = 509 Score = 27.2 bits (60), Expect = 1.2 Identities = 15/77 (19%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Query: 15 RREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDK 74 RR +R Y +R R RRRY + +++ + R R ++R + Sbjct: 39 RRSRERSYREDSRP----RDRRRYDSRSPRSLRYSSVRRSRDRPRRRSRSVRSIEQHRRR 94 Query: 75 MREKARQSYRKLYSKDS 91 +R+++ + + K Sbjct: 95 LRDRSPSNQWRKDDKKR 111 >gnl|CDD|150300 pfam09587, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein. Length = 237 Score = 27.2 bits (61), Expect = 1.3 Identities = 9/34 (26%), Positives = 15/34 (44%) Query: 87 YSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 Y + W A G+ + E ++ +I R K K Sbjct: 138 YGTNGWGAGPYRPGVNPLDEEKIKADIRRAKKKA 171 >gnl|CDD|179061 PRK00550, rpsE, 30S ribosomal protein S5; Validated. Length = 168 Score = 26.6 bits (60), Expect = 1.8 Identities = 9/33 (27%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Query: 98 PMGMTKAEIEALE-----REIARLKAKPIEELI 125 P+ + +A +AL+ E+A + K +EE++ Sbjct: 135 PINVVRATFDALKQLRSPEEVAAKRGKSVEEIL 167 >gnl|CDD|179009 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed. Length = 782 Score = 26.7 bits (60), Expect = 1.9 Identities = 15/93 (16%), Positives = 38/93 (40%), Gaps = 9/93 (9%) Query: 31 LERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKD 90 LER + + + + + + + ++K + + DK+ E+A + ++ + Sbjct: 528 LERELEQKAEEAEALLKEAEKLKEELEEKKEKLQEE-----EDKLLEEAEKEAQQAIKE- 581 Query: 91 SWIAPEEPMGMTKAEIEALEREIARLKAKPIEE 123 A +E + K + + A +KA + E Sbjct: 582 ---AKKEADEIIKELRQLQKGGYASVKAHELIE 611 >gnl|CDD|180929 PRK07324, PRK07324, transaminase; Validated. Length = 373 Score = 26.4 bits (59), Expect = 2.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 22 YYLKNRDKILERRRR 36 L++RD ILER R+ Sbjct: 265 LALEHRDAILERNRK 279 >gnl|CDD|178947 PRK00252, alaS, alanyl-tRNA synthetase; Reviewed. Length = 865 Score = 25.8 bits (58), Expect = 3.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 103 KAEIEALEREIARLKAK 119 E++ LE+E+ +LKAK Sbjct: 725 LEELKELEKELEQLKAK 741 >gnl|CDD|131371 TIGR02318, phosphono_phnM, phosphonate metabolism protein PhnM. This family consists of proteins from in the PhnM family. PhnM is a a protein associated with phosphonate utilization in a number of bacterial species. In Pseudomonas stutzeri WM88, a protein that is part of a system for the oxidation of phosphites (another form of reduced phosphorous compound) scores between trusted and noise cutoffs. Length = 376 Score = 25.8 bits (57), Expect = 3.4 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 1 MGRKVLTPEE--RMLCRREYKRR-YYLKNRDKILERRRRR 37 G++ L+ +E ++ R +R Y L NR +I R R Sbjct: 182 RGKRGLSDDEFDEIVEERIARRAEYGLANRSEIAALARAR 221 >gnl|CDD|178831 PRK00058, PRK00058, methionine sulfoxide reductase A; Provisional. Length = 213 Score = 25.6 bits (57), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%), Gaps = 1/15 (6%) Query: 47 ESYHQYYL-KNKDKY 60 E YHQ YL KN + Y Sbjct: 185 EDYHQQYLAKNPNGY 199 >gnl|CDD|152291 pfam11855, DUF3375, Protein of unknown function (DUF3375). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 479 to 499 amino acids in length. Length = 471 Score = 25.8 bits (57), Expect = 3.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 95 PEEPMGMTKAEIEALEREIARLKAKPIEEL 124 PE + + EI+ L+ EI RL+A + L Sbjct: 139 PEARLAELEREIDELDAEIDRLEAGDVPLL 168 >gnl|CDD|180782 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed. Length = 656 Score = 25.4 bits (56), Expect = 3.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 107 EALEREIARLKAKP 120 +A+ ++I RLKA P Sbjct: 467 KAIAQDIERLKAAP 480 >gnl|CDD|179117 PRK00770, PRK00770, deoxyhypusine synthase-like protein; Provisional. Length = 384 Score = 25.5 bits (56), Expect = 3.9 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 16 REYKRRYYLKNRDKILERRRRRYLKNKDK 44 R KR Y R+++ E+ ++ YL KD+ Sbjct: 335 RPLKRLY--DRREEMYEKLQKDYLAAKDQ 361 >gnl|CDD|180063 PRK05415, PRK05415, hypothetical protein; Provisional. Length = 341 Score = 25.6 bits (57), Expect = 4.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 61 REYKRRYYLKNRDKMREKARQ 81 RE++R L+ R +R++AR Sbjct: 120 REWRRLRRLRQRAHLRDEARA 140 >gnl|CDD|173392 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional. Length = 116 Score = 25.6 bits (56), Expect = 4.1 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 41 NKDKIRESYHQYYLKN 56 +K++IRE++ Q L+N Sbjct: 78 SKERIREAHKQLMLRN 93 >gnl|CDD|180223 PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated. Length = 319 Score = 25.1 bits (56), Expect = 4.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 8/41 (19%) Query: 96 EEPMG--------MTKAEIEALEREIARLKAKPIEELIYKR 128 EP+G A EAL +A LK EEL+ +R Sbjct: 266 PEPLGGAHRDPEAAAAALKEALLEALAELKGLSPEELLERR 306 >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional. Length = 453 Score = 25.2 bits (55), Expect = 4.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Query: 39 LKNKDKIRESYHQYYLKNKDKYREY 63 LKN++KI ++ +YL +DK++ Y Sbjct: 267 LKNQNKIEQAVFTFYLPPEDKHKGY 291 >gnl|CDD|182197 PRK10018, PRK10018, putative glycosyl transferase; Provisional. Length = 279 Score = 25.3 bits (55), Expect = 4.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 49 YHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKL 86 Y +Y K+KDK+ ++Y L ++R K R ++R L Sbjct: 224 YFHFYRKHKDKFDRASKKYQLFTLYQIRNK-RMTWRTL 260 >gnl|CDD|165477 PHA03211, PHA03211, serine/threonine kinase US3; Provisional. Length = 461 Score = 25.2 bits (55), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 95 PEEPMGMTKAEIEALEREIAR 115 P P G+T E+E L+RE AR Sbjct: 130 PAPPGGLTPEELERLDREAAR 150 >gnl|CDD|181827 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed. Length = 524 Score = 25.2 bits (56), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 21 RYYLKNRDKILERRRRR 37 RYY + K+L RRR Sbjct: 123 RYYARRAPKLLAPRRRA 139 >gnl|CDD|151899 pfam11460, DUF3007, Protein of unknown function (DUF3007). This is a family of uncharacterized proteins found in bacteria and eukaryotes. Length = 104 Score = 25.0 bits (55), Expect = 6.0 Identities = 9/35 (25%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 80 RQSYRKLYSKDSWIAPEEPM-GMTKAEIEALEREI 113 R+ YR+ Y + ++ ++ E+EAL+ E+ Sbjct: 68 RRDYREAYDALTNEELQKRFDSLSPEELEALQAEL 102 >gnl|CDD|150626 pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function. Length = 460 Score = 24.6 bits (54), Expect = 8.2 Identities = 13/107 (12%), Positives = 35/107 (32%), Gaps = 16/107 (14%) Query: 23 YLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQS 82 + + + ++ + + + ++ K +E ++ N Sbjct: 343 KKGDDNLFSLKELKKKEQKSKSFAKKFKKW---QKSVKKEVDKKGLFDNY---------R 390 Query: 83 YRKLYSKDSWIAPEEPMGM-TKAEIEALE---REIARLKAKPIEELI 125 Y + + P G E + + ++I+ LK P E++I Sbjct: 391 YLRSNTFRKLFGAWTPEGAEEYLEWKGFKNYLKDISLLKMAPPEDII 437 >gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional. Length = 433 Score = 24.6 bits (54), Expect = 8.4 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 100 GMTKAEIEALEREIARLKAKPIEELI-YKR 128 ++ AE +AL R+I +L+A IEEL+ Y R Sbjct: 239 NLSAAESQALNRDIGQLEAL-IEELLTYAR 267 >gnl|CDD|184524 PRK14127, PRK14127, cell division protein GpsB; Provisional. Length = 109 Score = 24.6 bits (54), Expect = 8.6 Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Query: 104 AEIEALEREIARLKAKPIEEL 124 EIE L++E ARLKA+ ++EL Sbjct: 44 KEIEELQQENARLKAQ-VDEL 63 >gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase. Members of this protein family are 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase, a ring-hydrolyzing enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA. Length = 360 Score = 24.5 bits (53), Expect = 8.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 49 YHQYYLKNKDKYREYKR 65 Y +YY N +YR+Y R Sbjct: 95 YAEYYAGNPQEYRQYMR 111 >gnl|CDD|184436 PRK13981, PRK13981, NAD synthetase; Provisional. Length = 540 Score = 24.3 bits (54), Expect = 9.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 10 ERMLCRREYKRR 21 ER+L EYKRR Sbjct: 501 ERLLYIAEYKRR 512 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,354,153 Number of extensions: 150394 Number of successful extensions: 833 Number of sequences better than 10.0: 1 Number of HSP's gapped: 804 Number of HSP's successfully gapped: 162 Length of query: 129 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,201,009 Effective search space: 193246414 Effective search space used: 193246414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.7 bits)