RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781226|ref|YP_003065639.1| hypothetical protein CLIBASIA_05665 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 30.2 bits (68), Expect = 0.096 Identities = 20/108 (18%), Positives = 44/108 (40%), Gaps = 22/108 (20%) Query: 2 GRKVLTPEERMLCRREY--KRRYYLKNRDKILERRRRRYLKNKDKI---RESYHQY---- 52 G+ +LT RE+ +Y N + ++ R+R+ + + +I E+ + Sbjct: 3 GKGILT------TAREHHSSVKYASPNLN--MKYRKRQLVTREAQIKDWVENELEALKLE 54 Query: 53 --YLKNKD--KYREYKRRYYLKNRDKMREKARQSY-RKLYSKDSWIAP 95 + ++D ++ + R + A+Q + Y +D IAP Sbjct: 55 AEEIPSEDQNEFLLERTREIHNEAESQLRAAQQQWGNDFYKRDPRIAP 102 Score = 24.5 bits (53), Expect = 4.8 Identities = 14/70 (20%), Positives = 26/70 (37%), Gaps = 26/70 (37%) Query: 59 KYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKA 118 KYR KR+ L R+ + ++ E+EAL+ E + + Sbjct: 27 KYR--KRQ--LVTREAQIKDWVEN----------------------ELEALKLEAEEIPS 60 Query: 119 KPIEELIYKR 128 + E + +R Sbjct: 61 EDQNEFLLER 70 >1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} (A:) Length = 139 Score = 28.0 bits (62), Expect = 0.48 Identities = 6/80 (7%), Positives = 20/80 (25%), Gaps = 3/80 (3%) Query: 18 YKRRYYLKNRDKIL--ERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYL-KNRDK 74 ++ + L + K +++ + + L R+ Sbjct: 1 MGSSHHHHHHSSGLVPRGSHMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREA 60 Query: 75 MREKARQSYRKLYSKDSWIA 94 E+ + + S + Sbjct: 61 AVEQLKSIREDIVSGKANFE 80 >2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} (A:) Length = 312 Score = 27.7 bits (61), Expect = 0.51 Identities = 7/31 (22%), Positives = 11/31 (35%) Query: 90 DSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 W P G K ++ L + + A P Sbjct: 236 GIWHGXWAPKGTPKPVVDKLVKSLQAGLADP 266 >2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} (A:) Length = 314 Score = 27.7 bits (61), Expect = 0.54 Identities = 5/31 (16%), Positives = 6/31 (19%) Query: 90 DSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 W P G + L P Sbjct: 240 PVWYGLLAPKGTPXDVVNKLRDAAVVALKDP 270 >2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} (A:) Length = 301 Score = 26.9 bits (59), Expect = 0.94 Identities = 7/34 (20%), Positives = 12/34 (35%) Query: 87 YSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 Y + W P A + L IA++ + Sbjct: 224 YELNQWHGLLVPGATPMAVRQKLYDGIAKVMQRD 257 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} (F:1-76) Length = 76 Score = 25.8 bits (56), Expect = 2.0 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Query: 73 DKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIE 107 +K K Q+ KLY+ DS AP + KA +E Sbjct: 18 EKQALKKLQASLKLYADDS--APALAI---KATME 47 >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} (A:1-144) Length = 144 Score = 25.7 bits (55), Expect = 2.4 Identities = 4/26 (15%), Positives = 8/26 (30%) Query: 87 YSKDSWIAPEEPMGMTKAEIEALERE 112 + + P + KA I + Sbjct: 117 VDRHDAVEPVRQVFEEKASIRRVIEA 142 >2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A (A:1-16,A:206-508,A:591-652) Length = 381 Score = 25.0 bits (54), Expect = 3.9 Identities = 6/64 (9%), Positives = 11/64 (17%) Query: 53 YLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALERE 112 L+ E K + N R + + Sbjct: 31 LLRRNFLPTESKANWLDMNNPAERLFVEEFGMDVSRTRLEEKVVSYYESNHEFHLRCVAY 90 Query: 113 IARL 116 +L Sbjct: 91 GTQL 94 >2zhy_A ATP:COB(I)alamin adenosyltransferase, putative; helix bundle; 1.80A {Burkholderia thailandensis} PDB: 2zhz_A* (A:) Length = 183 Score = 24.0 bits (52), Expect = 6.2 Identities = 7/48 (14%), Positives = 15/48 (31%) Query: 73 DKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 D +R L+ + +T A + L+ +A + Sbjct: 56 DDVRAALSAIQHDLFDLGGELCIPGHAAITDAHLARLDGWLAHYNGQL 103 >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} (X:195-400) Length = 206 Score = 24.1 bits (52), Expect = 6.5 Identities = 15/84 (17%), Positives = 31/84 (36%), Gaps = 5/84 (5%) Query: 33 RRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSW 92 + R + D + +Y QYYL D ++ + R + R+++ Sbjct: 78 KARDVQAADPDTLPNTYLQYYLFPDDXVKKSNPNH---TRANEVXEGREAFIFSQCD--X 132 Query: 93 IAPEEPMGMTKAEIEALEREIARL 116 I E+ ++ +I+ I L Sbjct: 133 ITREQSSENSEIKIDDHASYIVDL 156 >3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Cucumis sativus} (U:) Length = 190 Score = 24.3 bits (52), Expect = 6.8 Identities = 11/65 (16%), Positives = 26/65 (40%), Gaps = 7/65 (10%) Query: 33 RRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSW 92 +RRR + +D + + R +RR + + ++ + ++ D+W Sbjct: 128 KRRRFFENTQDVRKR------KTREAAKRNRRRRPQARFTPQNKQDVPATKQE-ADDDNW 180 Query: 93 IAPEE 97 PE+ Sbjct: 181 DLPED 185 >3bg2_A DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217} (A:120-179,A:361-444) Length = 144 Score = 23.6 bits (51), Expect = 8.7 Identities = 7/76 (9%), Positives = 23/76 (30%), Gaps = 6/76 (7%) Query: 11 RMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLK 70 ++L + + + L +R+ I + + + + + D + + + Sbjct: 47 KVLSQSKPGAQGGLNSREVIEKEIAGYEI-----LSTLL-EARCRALDNNDTHYNQLIQQ 100 Query: 71 NRDKMREKARQSYRKL 86 + Y L Sbjct: 101 LLAPNDHSEKSLYENL 116 >1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} (A:) Length = 203 Score = 23.8 bits (51), Expect = 8.7 Identities = 9/40 (22%), Positives = 13/40 (32%), Gaps = 4/40 (10%) Query: 47 ESYHQ-YYLKNKDKYREYKRRYYLKNRDKMREKARQSYRK 85 E HQ Y + + Y + R R A + R Sbjct: 159 EPEHQDYLQRYPNGYTCHFVR---PGWRLPRRTAESALRA 195 >1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} (A:) Length = 199 Score = 23.8 bits (51), Expect = 9.3 Identities = 9/15 (60%), Positives = 10/15 (66%), Gaps = 1/15 (6%) Query: 47 ESYHQYYL-KNKDKY 60 E YHQ YL K+ D Y Sbjct: 183 EDYHQQYLSKDPDGY 197 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0360 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,136,287 Number of extensions: 57818 Number of successful extensions: 541 Number of sequences better than 10.0: 1 Number of HSP's gapped: 526 Number of HSP's successfully gapped: 142 Length of query: 129 Length of database: 4,956,049 Length adjustment: 77 Effective length of query: 52 Effective length of database: 2,353,064 Effective search space: 122359328 Effective search space used: 122359328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (24.1 bits)