RPSBLAST alignment of GI: 254781226 and protein with PDBid: 1qzv

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154
 Score = 39.2 bits (90), Expect = 3e-04
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 73  DKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIE 107
           +K   K  Q+  KLY+ DS  AP   + + KA +E
Sbjct: 18  EKQALKKLQASLKLYADDS--AP--ALAI-KATME 47