BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781226|ref|YP_003065639.1| hypothetical protein CLIBASIA_05665 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781226|ref|YP_003065639.1| hypothetical protein CLIBASIA_05665 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 248 bits (632), Expect = 4e-68, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY 60 MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY Sbjct: 1 MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY 60 Query: 61 REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP Sbjct: 61 REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120 Query: 121 IEELIYKRG 129 IEELIYKRG Sbjct: 121 IEELIYKRG 129 >gi|254780286|ref|YP_003064699.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Candidatus Liberibacter asiaticus str. psy62] Length = 410 Score = 28.5 bits (62), Expect = 0.038, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 13/61 (21%) Query: 1 MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY 60 +GR + PE+R L R E++R +RD+++ R LK+K ++ ++ + +D Y Sbjct: 25 LGR--MYPEKRSLTRSEFQR-----DRDRMIHTTAFRRLKDKTQV------FFHRQRDHY 71 Query: 61 R 61 R Sbjct: 72 R 72 >gi|254780148|ref|YP_003064561.1| transcription antitermination protein NusG [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 23.1 bits (48), Expect = 1.9, Method: Compositional matrix adjust. Identities = 8/34 (23%), Positives = 18/34 (52%) Query: 96 EEPMGMTKAEIEALEREIARLKAKPIEELIYKRG 129 E P +T +EIE + ++ +P+ + ++ G Sbjct: 93 ENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVG 126 >gi|254781066|ref|YP_003065479.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Score = 22.3 bits (46), Expect = 2.9, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query: 26 NRDKILERRRRRYLKNKDKIRESYHQYYLKNK 57 NRD RRR +L ++ I+ S +Y+++N+ Sbjct: 11 NRD--FHYRRRPFLLKRNMIQSSLREYFVENQ 40 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 21.9 bits (45), Expect = 4.2, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 38 YLKNKDKIRESYHQYYLKNKDKYREYK 64 Y NKD + + Y +N+++YR K Sbjct: 138 YSGNKDAVTRNKDLEYQRNEERYRFLK 164 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 21.6 bits (44), Expect = 5.1, Method: Compositional matrix adjust. Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Query: 6 LTP-EERMLCRREYKRRYYLK-NRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREY 63 LTP EER+L + R+ + N D LE +++ +++IR+ + K K R Sbjct: 620 LTPREERVL-----RMRFGIGMNTDHTLEEVGKQFCVTRERIRQIEAKAIRKLKHPSRSK 674 Query: 64 KRRYYLKN 71 K R +L Sbjct: 675 KLRSFLDG 682 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 21.6 bits (44), Expect = 5.4, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 16/22 (72%) Query: 36 RRYLKNKDKIRESYHQYYLKNK 57 ++ +KN+D I +Y ++L+NK Sbjct: 419 QKLIKNEDIIEGNYDIHWLENK 440 >gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Score = 21.6 bits (44), Expect = 5.7, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 67 YYLKNRDKMREKARQSYRKLYSK 89 YY NR K+ ++Q++++ Y+ Sbjct: 14 YYPGNRQKITVSSKQAFKRAYTS 36 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,938 Number of Sequences: 1233 Number of extensions: 3466 Number of successful extensions: 28 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 16 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)