RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|33417 COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only]. Length = 279 Score = 27.2 bits (60), Expect = 1.0 Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Query: 7 GVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAF 63 + D K R A+LS V + + E+ E +R Y E +I F Sbjct: 175 KINLEDPWKAALARLARRPNVW-----AKLSGVYAYSDESWTVEDVRPYVEELIELF 226 >gnl|CDD|147207 pfam04924, Pox_A6, Poxvirus A6 protein. Length = 371 Score = 25.0 bits (55), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Query: 47 TDEEKLREYKE-FVISA 62 TD+EKL EY+E F IS Sbjct: 193 TDKEKLEEYREIFSIST 209 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.128 0.350 Gapped Lambda K H 0.267 0.0726 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 732,529 Number of extensions: 27603 Number of successful extensions: 82 Number of sequences better than 10.0: 1 Number of HSP's gapped: 82 Number of HSP's successfully gapped: 3 Length of query: 68 Length of database: 6,263,737 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,420,986 Effective search space: 157208594 Effective search space used: 157208594 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)