RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >d3bbda1 c.116.1.6 (A:2-205) Ribosome biogenesis protein NEP1 {Methanococcus jannaschii [TaxId: 2190]} Length = 204 Score = 24.4 bits (53), Expect = 2.9 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 43 AGETTDEEKLREYKEFVISAFAK 65 G+ T + L+EY F+I F Sbjct: 143 TGKLTHPKLLKEYDTFIIGGFPY 165 >d2hnga1 d.33.1.2 (A:5-128) Hypothetical protein SP1558 {Streptococcus pneumoniae [TaxId: 1313]} Length = 124 Score = 23.9 bits (52), Expect = 3.3 Identities = 10/51 (19%), Positives = 15/51 (29%), Gaps = 9/51 (17%) Query: 10 HFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVI 60 HFD R W E+ V V+ D+E ++ Sbjct: 14 HFDARN---------FEWENENGAPETKVDVNFQLLQHDQENQVTSLIVIL 55 >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Score = 22.7 bits (48), Expect = 8.8 Identities = 11/56 (19%), Positives = 22/56 (39%) Query: 10 HFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAK 65 + +R TE W+ + + + + D+E+ + KE + SA A Sbjct: 257 KTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALAT 312 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.128 0.350 Gapped Lambda K H 0.267 0.0642 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 242,142 Number of extensions: 8468 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 47 Number of HSP's successfully gapped: 6 Length of query: 68 Length of database: 2,407,596 Length adjustment: 37 Effective length of query: 31 Effective length of database: 1,899,586 Effective search space: 58887166 Effective search space used: 58887166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.1 bits)