RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >gnl|CDD|180683 PRK06762, PRK06762, hypothetical protein; Provisional. Length = 166 Score = 26.9 bits (60), Expect = 1.3 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Query: 28 RLGLGT--VSEDILRHIELEAKDSANELLKPLRKIIDELVK 66 RLG GT VS+D++R L KD L L I++LV+ Sbjct: 25 RLGRGTLLVSQDVVRRDMLRVKDGPGNLSIDL---IEQLVR 62 >gnl|CDD|180341 PRK05990, PRK05990, precorrin-2 C(20)-methyltransferase; Reviewed. Length = 241 Score = 25.7 bits (57), Expect = 2.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 12 DVLTRRIADQDSVLILRLG 30 + L RR+AD D+ +I++LG Sbjct: 165 EELRRRLADADAAVIMKLG 183 >gnl|CDD|132014 TIGR02969, mam_aldehyde_ox, aldehyde oxidase. Members of this family are mammalian aldehyde oxidase (EC 1.2.3.1) isozymes, closely related to xanthine dehydrogenase/oxidase. Length = 1330 Score = 25.4 bits (55), Expect = 3.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 44 LEAKDSANELLKPLRKIIDELVKGERNKWRQS 75 L KD+ LLK L II + +G W Q+ Sbjct: 1089 LAVKDACQTLLKRLEPIISKNPQGTWKDWAQT 1120 >gnl|CDD|168930 PRK07377, PRK07377, hypothetical protein; Provisional. Length = 184 Score = 25.4 bits (56), Expect = 3.6 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 12/44 (27%) Query: 23 SVLILRLGLGTVSEDILRHIELEAK--DSANELLKPLRKIIDEL 64 S L++RLG+ +E+E + ++L+ LR I+D+ Sbjct: 73 SSLVMRLGV----------LEIETETSSVFDQLIDQLRTILDKY 106 >gnl|CDD|183125 PRK11413, PRK11413, putative hydratase; Provisional. Length = 751 Score = 25.4 bits (56), Expect = 3.8 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 36 EDILRHIELEAKDSANELLK--PLRKIID 62 DILR +E+E++ A+ K L KI + Sbjct: 319 TDILREVEIESERVAHGKAKLSLLDKIEN 347 >gnl|CDD|185579 PTZ00370, PTZ00370, STEVOR; Provisional. Length = 296 Score = 25.0 bits (55), Expect = 4.4 Identities = 7/22 (31%), Positives = 16/22 (72%) Query: 57 LRKIIDELVKGERNKWRQSDNP 78 L++IID++ + K++Q+ +P Sbjct: 59 LKEIIDKMNEEAIKKYQQTHDP 80 >gnl|CDD|178138 PLN02523, PLN02523, galacturonosyltransferase. Length = 559 Score = 24.8 bits (54), Expect = 4.7 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Query: 32 GTVSEDILRHIELEAKDSANELLKPLRKIIDE 63 + ED+LR E E K+ +K R++I E Sbjct: 140 SAIDEDVLRQFEKEVKE----RVKVARQMIAE 167 >gnl|CDD|184510 PRK14105, PRK14105, selenophosphate synthetase; Provisional. Length = 345 Score = 24.7 bits (54), Expect = 5.1 Identities = 18/59 (30%), Positives = 30/59 (50%) Query: 8 GPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVK 66 G + D+LT+ A + VLIL LGT S L + E +D + + II++ ++ Sbjct: 154 GKEEDILTKAGAKEGDVLILTKPLGTQSAMALSRVPEEFEDLIDITKEEKEYIINKAIE 212 >gnl|CDD|178127 PLN02511, PLN02511, hydrolase. Length = 388 Score = 24.7 bits (54), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 16 RRIADQDSVLILRLGLGTVSED-ILRHIELEAK 47 R + VLIL GL S+D +RH+ L A+ Sbjct: 94 RALPADAPVLILLPGLTGGSDDSYVRHMLLRAR 126 >gnl|CDD|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component. The E1 ortholog from Corynebacterium glutamicum is unusual in having an N-terminal extension that resembles the dihydrolipoamide succinyltransferase (E2) component of 2-oxoglutarate dehydrogenase. Length = 929 Score = 24.1 bits (52), Expect = 8.0 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 21 QDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVKGERNKWRQ 74 ++SVL G T S L E + D AN + +ID+ + KW Q Sbjct: 656 EESVLGFEYGYATTSPRTLVIWEAQFGDFANGA----QVVIDQFISSGEQKWGQ 705 >gnl|CDD|183822 PRK12900, secA, preprotein translocase subunit SecA; Reviewed. Length = 1025 Score = 24.0 bits (52), Expect = 8.2 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Query: 27 LRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVKGERNKWRQSDNPD 79 ++ L ++S+D LR +E K L+P+ + +L ++ DNPD Sbjct: 30 IQASLASLSDDALREKGMELKSRVRGALEPIEQKKKDL-------EKKLDNPD 75 >gnl|CDD|163036 TIGR02827, RNR_anaer_Bdell, anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons. Length = 586 Score = 24.0 bits (52), Expect = 8.3 Identities = 8/22 (36%), Positives = 10/22 (45%) Query: 58 RKIIDELVKGERNKWRQSDNPD 79 R I EL +G SD+ D Sbjct: 272 RFIAQELAQGNSFFIYMSDSAD 293 >gnl|CDD|116940 pfam08359, TetR_C_4, YsiA-like protein, C-terminal region. The members of this family are thought to be TetR-type transcriptional regulators that bear particular similarity to YsiA, a hypothetical protein expressed by B. subtilis. Length = 133 Score = 24.3 bits (53), Expect = 8.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 31 LGTVSEDILRHIELEAKDSANELLKPLRKIIDELV 65 L V++ LR LE + NE+LK +IDE++ Sbjct: 43 LAIVTQLELRQSNLELRQKINEVLKGYLTLIDEII 77 >gnl|CDD|162883 TIGR02487, NrdD, anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer. Length = 579 Score = 24.2 bits (53), Expect = 8.5 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Query: 41 HIELEAKDSANELLKPLRKIIDELVKGERNKWRQSDNPDDDVCEVCQ 87 +IEL D A + L+ I + +K + NP DVCE C Sbjct: 490 YIEL---DEAIPDPEALKDITKKAMKNGIGYF--GINPPVDVCEDCG 531 >gnl|CDD|180119 PRK05500, PRK05500, bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated. Length = 477 Score = 23.9 bits (52), Expect = 8.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 11 FDVLTRRIADQDSVLILRL 29 FD LT+ IA S+L++ L Sbjct: 4 FDKLTQAIAQNQSLLVVGL 22 >gnl|CDD|182760 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional. Length = 222 Score = 23.7 bits (52), Expect = 9.6 Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 5 PWNGPKFDVLTRRIADQDSVLILRLG 30 PWNGP + +RI + LI Sbjct: 66 PWNGPSRQEVVQRIIARVISLIEETR 91 >gnl|CDD|179742 PRK04123, PRK04123, ribulokinase; Provisional. Length = 548 Score = 24.0 bits (53), Expect = 9.8 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 10/38 (26%) Query: 6 WNGPKFDVLTRR--IADQD-SVLILRLGLGTVSEDILR 40 +NG RR +ADQ +I L LGT + DI R Sbjct: 385 FNG-------RRTPLADQRLKGVITGLTLGTDAPDIYR 415 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0836 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,439,967 Number of extensions: 78430 Number of successful extensions: 217 Number of sequences better than 10.0: 1 Number of HSP's gapped: 217 Number of HSP's successfully gapped: 35 Length of query: 87 Length of database: 5,994,473 Length adjustment: 56 Effective length of query: 31 Effective length of database: 4,784,425 Effective search space: 148317175 Effective search space used: 148317175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (22.8 bits)