RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} (A:) Length = 96 Score = 26.0 bits (57), Expect = 1.9 Identities = 6/21 (28%), Positives = 10/21 (47%) Query: 39 LRHIELEAKDSANELLKPLRK 59 +RHI E E ++ L+ Sbjct: 5 VRHILCEKHGKIMEAMEKLKS 25 >1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} (A:) Length = 92 Score = 24.8 bits (54), Expect = 3.8 Identities = 5/21 (23%), Positives = 12/21 (57%) Query: 39 LRHIELEAKDSANELLKPLRK 59 HI ++ + A +LL+ ++ Sbjct: 6 ALHILVKEEKLALDLLEQIKN 26 >2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} (A:) Length = 102 Score = 24.8 bits (54), Expect = 4.1 Identities = 6/21 (28%), Positives = 10/21 (47%) Query: 39 LRHIELEAKDSANELLKPLRK 59 I+ + +D A +L L K Sbjct: 8 YSIIQTKTEDEAKAVLDELNK 28 >1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} (A:) Length = 93 Score = 24.8 bits (54), Expect = 4.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 39 LRHIELEAKDSANELLKPLRK 59 HI + K +A E+ K L+K Sbjct: 7 ASHILVADKKTAEEVEKKLKK 27 >1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} (A:) Length = 141 Score = 24.7 bits (53), Expect = 5.1 Identities = 7/43 (16%), Positives = 15/43 (34%), Gaps = 7/43 (16%) Query: 6 WNGPKFDVLTRRIADQDSVLIL-------RLGLGTVSEDILRH 41 +G VL+ I D L++ L + + ++ Sbjct: 86 GSGDLGQVLSDAIEQYDVDLLVTGHHQDFWSKLMSSTRQVMNT 128 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 24.1 bits (52), Expect = 6.5 Identities = 17/83 (20%), Positives = 27/83 (32%), Gaps = 33/83 (39%) Query: 9 PKFDV------LTRRIAD-----QDSVLILRLGLGTVS-EDI-------LRHIELEA--- 46 P ++ L R A ++ + L+L + ED R I EA Sbjct: 22 PNLNMKYRKRQLVTREAQIKDWVENELEALKLEAEEIPSEDQNEFLLERTREIHNEAESQ 81 Query: 47 -KDS----ANELLK------PLR 58 + + N+ K PLR Sbjct: 82 LRAAQQQWGNDFYKRDPRIAPLR 104 >2pyq_A Uncharacterized protein; YP_512017.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.50A {Jannaschia SP} (A:) Length = 114 Score = 23.9 bits (52), Expect = 8.0 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 31 LGTVSEDILRHIELEAKDSANELLKPLRKIIDELVKGERNKWR 73 L T+ ++ L +L DS L ++ +I+ + ERNK+R Sbjct: 56 LETIKKNFLXK-KLGLADSE-SLXGGIQSVIETYGRSERNKYR 96 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0496 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 690,731 Number of extensions: 26133 Number of successful extensions: 147 Number of sequences better than 10.0: 1 Number of HSP's gapped: 147 Number of HSP's successfully gapped: 15 Length of query: 87 Length of database: 4,956,049 Length adjustment: 49 Effective length of query: 38 Effective length of database: 3,299,604 Effective search space: 125384952 Effective search space used: 125384952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.6 bits)